SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448935|ref|YP_005236294.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448935|ref|YP_005236294.1|
Domain Number 1 Region: 421-989
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.22e-147
Family Acetyl-CoA synthetase-like 0.000000137
Further Details:      
 
Domain Number 2 Region: 1049-1292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.95e-47
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.006
Further Details:      
 
Domain Number 3 Region: 190-426
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.22e-32
Family NRPS condensation domain (amide synthase) 0.0011
Further Details:      
 
Domain Number 4 Region: 9-183
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.11e-31
Family NRPS condensation domain (amide synthase) 0.0026
Further Details:      
 
Domain Number 5 Region: 970-1042
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000576
Family Peptidyl carrier domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378448935|ref|YP_005236294.1|
Sequence length 1294
Comment enterobactin synthase subunit F [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTQRLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELNGELDAALLAKAVAVGMQQADTLRM
RFTEENGEVWQWIDPEHTFGEPPIADLRDQPDPHHAALALMQADLRQNLRADSGKPLAFH
QLIRIDDTRWYWYQRYHHLLVDGFSFPAITRQIAAIYRAWQSDAPTPESPFTPFADVVEE
YQRYRQSEAWQRDGAFWAQQRRELPPPASMSAAPLPGRSASADILRMKLSAPAGAFRQLA
AHMPEIPRADLALALVTLWLGRLCGRMDYAAGFIFMRRMGSAALTATGPVLNVLPLAVNL
HATEDLPTLAKRLAAQLKKMRRHQRYDAEQIVRDSGRAAGETPLFGPVLNIKVFDYHLDL
PGIQAQTHTLATGPVNDLELALFPDENGGLDIELLANAQRYDDATLSRHALRLMALITQF
ADNPALRCGDAQMLLAEEQTQLAHLNNTAVTIPAATLSDLVAQQAQKTPEASALADAHYH
FTYREMREQVVALAYALRERGVQPGDSVAVALPRSVFLTLALHGIVEAGAAWLPLDTGYP
DDRLRMMLEDAQPKLLITTQAQLARFHDIPGMEYLCYSQPLPVSDATPLRLSLPHHTAYI
IFTSGSTGRPKGVMVGQTAIVNRLLWMQDHYPLTADDVVAQKTPCSFDVSVWEFFWPFIA
GAKLVMAEPEAHRDPLAMQRFFAQYGVTTTHFVPSMLAAFIASLTPASAGKSCASLKRVF
CSGEALPTALCREWETLTNAPLHNLYGPTEAAVDVSWYPACGDELAAVDGNSIPIGYPVW
NTGLRILDAHMQPVPPGVAGDLYLTGIQLAQGYLGRPDLTASRFIADPFAPGERMYRTGD
VARWLDSGAVEYLGRSDDQLKIRGQRIELGEIDRVMQTLPDVEQAVAHACVFNQAAATGG
DARQLVGYLVSHSGLPLDLPALQEKLRQKLPAHMVPVVLLQLASLPLSANGKLDRKALPL
PDLAPRVKGRAPQSATEIAVAAAFSRLLGCEINDVESDFFALGGHSLLAMKLAAQLSQTF
NRQVTPGQVMVASDVAQLSKLLDTDDDERSRNLGFGPLLPLRESDGPTLFCFHPASGFAW
QFSVLSRYLSPSWSIMGIQSPRPAGPMQTATTLDEVCEHHLATLLARQPHGPYYLLGYSL
GGTLAQGIAARLRARGETVAFLGLLDTWPPETQNWREKEANGLNPDVLAEIERERAAFVA
AQQGNASDALFTAIEGNYADAVRLLTTAHSVPFDGHATLFVADKTVPEGVSPEQSWSPWI
ASLAIYRQPCAHVDIISPSAFETIGPIISELINK
Download sequence
Identical sequences A0A0D6H563 A0A0F6AY76 A0A0F7J4M2 A0A0U1FIA8 A0A0W4PBI7 A0A249V167 A0A2D3AM80 A0A2H9YMM2 Q8ZR37
gi|482904826|ref|YP_007903386.1| gi|378983191|ref|YP_005246346.1| gi|378987987|ref|YP_005251151.1| gi|525838983|ref|YP_008256172.1| gi|16763965|ref|NP_459580.1| gi|526219461|ref|YP_008264837.1| NP_459580.1.58477 WP_000194139.1.100010 WP_000194139.1.100234 WP_000194139.1.100258 WP_000194139.1.100376 WP_000194139.1.100424 WP_000194139.1.100484 WP_000194139.1.100488 WP_000194139.1.100597 WP_000194139.1.10076 WP_000194139.1.100781 WP_000194139.1.100793 WP_000194139.1.100871 WP_000194139.1.100882 WP_000194139.1.101007 WP_000194139.1.101020 WP_000194139.1.101074 WP_000194139.1.101078 WP_000194139.1.101180 WP_000194139.1.101259 WP_000194139.1.101284 WP_000194139.1.101291 WP_000194139.1.101353 WP_000194139.1.101386 WP_000194139.1.101404 WP_000194139.1.101420 WP_000194139.1.101589 WP_000194139.1.101707 WP_000194139.1.101734 WP_000194139.1.101878 WP_000194139.1.101953 WP_000194139.1.10220 WP_000194139.1.10266 WP_000194139.1.10439 WP_000194139.1.10678 WP_000194139.1.10753 WP_000194139.1.10992 WP_000194139.1.11000 WP_000194139.1.11031 WP_000194139.1.11098 WP_000194139.1.11168 WP_000194139.1.11190 WP_000194139.1.11295 WP_000194139.1.11455 WP_000194139.1.11458 WP_000194139.1.11518 WP_000194139.1.11532 WP_000194139.1.11772 WP_000194139.1.11897 WP_000194139.1.12025 WP_000194139.1.12114 WP_000194139.1.12351 WP_000194139.1.12370 WP_000194139.1.12546 WP_000194139.1.1264 WP_000194139.1.12728 WP_000194139.1.12879 WP_000194139.1.12936 WP_000194139.1.12995 WP_000194139.1.13027 WP_000194139.1.13106 WP_000194139.1.13130 WP_000194139.1.13334 WP_000194139.1.13488 WP_000194139.1.13509 WP_000194139.1.13741 WP_000194139.1.1387 WP_000194139.1.13908 WP_000194139.1.13968 WP_000194139.1.14001 WP_000194139.1.14151 WP_000194139.1.14320 WP_000194139.1.14379 WP_000194139.1.14406 WP_000194139.1.14410 WP_000194139.1.14466 WP_000194139.1.14524 WP_000194139.1.14554 WP_000194139.1.14725 WP_000194139.1.14852 WP_000194139.1.14932 WP_000194139.1.15055 WP_000194139.1.15124 WP_000194139.1.15223 WP_000194139.1.15226 WP_000194139.1.15316 WP_000194139.1.15369 WP_000194139.1.1540 WP_000194139.1.15508 WP_000194139.1.15784 WP_000194139.1.15830 WP_000194139.1.16062 WP_000194139.1.16063 WP_000194139.1.16103 WP_000194139.1.16226 WP_000194139.1.16233 WP_000194139.1.16284 WP_000194139.1.16328 WP_000194139.1.1635 WP_000194139.1.16468 WP_000194139.1.16614 WP_000194139.1.16650 WP_000194139.1.16686 WP_000194139.1.167 WP_000194139.1.16732 WP_000194139.1.16735 WP_000194139.1.16786 WP_000194139.1.16858 WP_000194139.1.16896 WP_000194139.1.16965 WP_000194139.1.1700 WP_000194139.1.17307 WP_000194139.1.17480 WP_000194139.1.17546 WP_000194139.1.17702 WP_000194139.1.17705 WP_000194139.1.17747 WP_000194139.1.18019 WP_000194139.1.18111 WP_000194139.1.18163 WP_000194139.1.18265 WP_000194139.1.18267 WP_000194139.1.18282 WP_000194139.1.18468 WP_000194139.1.18607 WP_000194139.1.18705 WP_000194139.1.18715 WP_000194139.1.18776 WP_000194139.1.18822 WP_000194139.1.18881 WP_000194139.1.18940 WP_000194139.1.18949 WP_000194139.1.19053 WP_000194139.1.19320 WP_000194139.1.19458 WP_000194139.1.19461 WP_000194139.1.19614 WP_000194139.1.19642 WP_000194139.1.19702 WP_000194139.1.19706 WP_000194139.1.19724 WP_000194139.1.19784 WP_000194139.1.19809 WP_000194139.1.19867 WP_000194139.1.20 WP_000194139.1.2010 WP_000194139.1.20212 WP_000194139.1.20266 WP_000194139.1.20271 WP_000194139.1.20330 WP_000194139.1.20362 WP_000194139.1.20418 WP_000194139.1.20443 WP_000194139.1.20525 WP_000194139.1.2054 WP_000194139.1.20626 WP_000194139.1.20646 WP_000194139.1.20886 WP_000194139.1.20908 WP_000194139.1.21049 WP_000194139.1.21245 WP_000194139.1.21246 WP_000194139.1.21269 WP_000194139.1.21400 WP_000194139.1.21497 WP_000194139.1.21499 WP_000194139.1.21548 WP_000194139.1.21603 WP_000194139.1.21751 WP_000194139.1.21757 WP_000194139.1.22024 WP_000194139.1.2205 WP_000194139.1.22062 WP_000194139.1.22067 WP_000194139.1.2221 WP_000194139.1.2235 WP_000194139.1.22379 WP_000194139.1.22427 WP_000194139.1.2246 WP_000194139.1.22485 WP_000194139.1.22537 WP_000194139.1.22620 WP_000194139.1.22870 WP_000194139.1.22979 WP_000194139.1.23114 WP_000194139.1.2314 WP_000194139.1.23192 WP_000194139.1.23259 WP_000194139.1.23460 WP_000194139.1.23472 WP_000194139.1.23482 WP_000194139.1.23634 WP_000194139.1.2364 WP_000194139.1.23932 WP_000194139.1.24017 WP_000194139.1.24206 WP_000194139.1.24308 WP_000194139.1.24578 WP_000194139.1.24737 WP_000194139.1.24779 WP_000194139.1.25008 WP_000194139.1.25015 WP_000194139.1.25206 WP_000194139.1.25454 WP_000194139.1.25493 WP_000194139.1.25668 WP_000194139.1.25690 WP_000194139.1.2570 WP_000194139.1.25740 WP_000194139.1.25814 WP_000194139.1.25988 WP_000194139.1.26311 WP_000194139.1.26429 WP_000194139.1.26440 WP_000194139.1.26493 WP_000194139.1.26551 WP_000194139.1.26567 WP_000194139.1.27206 WP_000194139.1.27423 WP_000194139.1.2763 WP_000194139.1.27665 WP_000194139.1.27707 WP_000194139.1.27761 WP_000194139.1.2777 WP_000194139.1.27857 WP_000194139.1.27977 WP_000194139.1.28094 WP_000194139.1.28126 WP_000194139.1.28302 WP_000194139.1.2835 WP_000194139.1.28370 WP_000194139.1.28538 WP_000194139.1.28575 WP_000194139.1.28625 WP_000194139.1.28655 WP_000194139.1.28694 WP_000194139.1.2879 WP_000194139.1.2890 WP_000194139.1.28938 WP_000194139.1.28946 WP_000194139.1.29006 WP_000194139.1.29010 WP_000194139.1.2910 WP_000194139.1.29588 WP_000194139.1.29601 WP_000194139.1.29606 WP_000194139.1.29615 WP_000194139.1.29704 WP_000194139.1.29969 WP_000194139.1.30006 WP_000194139.1.30027 WP_000194139.1.30180 WP_000194139.1.30469 WP_000194139.1.30505 WP_000194139.1.30507 WP_000194139.1.30535 WP_000194139.1.30547 WP_000194139.1.30794 WP_000194139.1.30833 WP_000194139.1.30972 WP_000194139.1.31 WP_000194139.1.31185 WP_000194139.1.3119 WP_000194139.1.31190 WP_000194139.1.31195 WP_000194139.1.31196 WP_000194139.1.31219 WP_000194139.1.31281 WP_000194139.1.31504 WP_000194139.1.31515 WP_000194139.1.31578 WP_000194139.1.31658 WP_000194139.1.31940 WP_000194139.1.31967 WP_000194139.1.31972 WP_000194139.1.32192 WP_000194139.1.32515 WP_000194139.1.32527 WP_000194139.1.32660 WP_000194139.1.32702 WP_000194139.1.32714 WP_000194139.1.32786 WP_000194139.1.32804 WP_000194139.1.32860 WP_000194139.1.32907 WP_000194139.1.33030 WP_000194139.1.33127 WP_000194139.1.33248 WP_000194139.1.33261 WP_000194139.1.333 WP_000194139.1.33492 WP_000194139.1.33553 WP_000194139.1.33592 WP_000194139.1.33825 WP_000194139.1.33894 WP_000194139.1.34043 WP_000194139.1.34075 WP_000194139.1.34257 WP_000194139.1.34279 WP_000194139.1.34319 WP_000194139.1.34453 WP_000194139.1.34610 WP_000194139.1.34856 WP_000194139.1.34975 WP_000194139.1.34977 WP_000194139.1.35045 WP_000194139.1.35129 WP_000194139.1.35184 WP_000194139.1.35404 WP_000194139.1.35408 WP_000194139.1.35429 WP_000194139.1.35509 WP_000194139.1.35590 WP_000194139.1.35940 WP_000194139.1.36003 WP_000194139.1.3601 WP_000194139.1.36609 WP_000194139.1.36690 WP_000194139.1.36705 WP_000194139.1.36918 WP_000194139.1.37063 WP_000194139.1.37073 WP_000194139.1.37111 WP_000194139.1.37112 WP_000194139.1.37256 WP_000194139.1.37293 WP_000194139.1.37370 WP_000194139.1.37376 WP_000194139.1.3744 WP_000194139.1.37498 WP_000194139.1.37504 WP_000194139.1.37618 WP_000194139.1.37687 WP_000194139.1.37968 WP_000194139.1.37978 WP_000194139.1.38125 WP_000194139.1.38145 WP_000194139.1.3848 WP_000194139.1.38613 WP_000194139.1.38673 WP_000194139.1.3869 WP_000194139.1.38693 WP_000194139.1.38882 WP_000194139.1.38913 WP_000194139.1.39003 WP_000194139.1.39136 WP_000194139.1.39197 WP_000194139.1.39229 WP_000194139.1.39405 WP_000194139.1.39420 WP_000194139.1.39449 WP_000194139.1.39512 WP_000194139.1.39556 WP_000194139.1.39763 WP_000194139.1.39862 WP_000194139.1.39923 WP_000194139.1.40072 WP_000194139.1.40073 WP_000194139.1.4011 WP_000194139.1.40208 WP_000194139.1.40240 WP_000194139.1.40257 WP_000194139.1.40292 WP_000194139.1.40305 WP_000194139.1.40311 WP_000194139.1.40380 WP_000194139.1.40395 WP_000194139.1.40465 WP_000194139.1.40710 WP_000194139.1.4075 WP_000194139.1.4087 WP_000194139.1.40877 WP_000194139.1.41017 WP_000194139.1.41086 WP_000194139.1.41091 WP_000194139.1.41226 WP_000194139.1.41279 WP_000194139.1.41516 WP_000194139.1.41554 WP_000194139.1.41572 WP_000194139.1.41591 WP_000194139.1.41662 WP_000194139.1.41708 WP_000194139.1.41761 WP_000194139.1.41859 WP_000194139.1.41882 WP_000194139.1.41979 WP_000194139.1.41985 WP_000194139.1.42104 WP_000194139.1.42320 WP_000194139.1.42342 WP_000194139.1.42422 WP_000194139.1.4276 WP_000194139.1.42864 WP_000194139.1.4288 WP_000194139.1.43018 WP_000194139.1.43041 WP_000194139.1.43244 WP_000194139.1.43312 WP_000194139.1.43334 WP_000194139.1.43351 WP_000194139.1.43437 WP_000194139.1.43522 WP_000194139.1.43613 WP_000194139.1.43886 WP_000194139.1.44043 WP_000194139.1.44099 WP_000194139.1.44121 WP_000194139.1.44291 WP_000194139.1.44310 WP_000194139.1.44479 WP_000194139.1.4467 WP_000194139.1.44747 WP_000194139.1.4485 WP_000194139.1.44877 WP_000194139.1.44927 WP_000194139.1.44971 WP_000194139.1.45074 WP_000194139.1.45079 WP_000194139.1.45098 WP_000194139.1.45177 WP_000194139.1.45184 WP_000194139.1.45259 WP_000194139.1.45344 WP_000194139.1.45349 WP_000194139.1.45365 WP_000194139.1.45550 WP_000194139.1.45585 WP_000194139.1.45660 WP_000194139.1.45690 WP_000194139.1.45797 WP_000194139.1.458 WP_000194139.1.46011 WP_000194139.1.46069 WP_000194139.1.46173 WP_000194139.1.46174 WP_000194139.1.46187 WP_000194139.1.46303 WP_000194139.1.46595 WP_000194139.1.46675 WP_000194139.1.46930 WP_000194139.1.47057 WP_000194139.1.47214 WP_000194139.1.47429 WP_000194139.1.47448 WP_000194139.1.4747 WP_000194139.1.47472 WP_000194139.1.47478 WP_000194139.1.47621 WP_000194139.1.47799 WP_000194139.1.48242 WP_000194139.1.48253 WP_000194139.1.483 WP_000194139.1.48367 WP_000194139.1.48377 WP_000194139.1.4853 WP_000194139.1.48788 WP_000194139.1.4885 WP_000194139.1.48894 WP_000194139.1.48919 WP_000194139.1.49084 WP_000194139.1.49155 WP_000194139.1.49204 WP_000194139.1.49239 WP_000194139.1.49256 WP_000194139.1.49290 WP_000194139.1.49340 WP_000194139.1.49366 WP_000194139.1.49490 WP_000194139.1.49515 WP_000194139.1.49572 WP_000194139.1.4979 WP_000194139.1.49803 WP_000194139.1.49805 WP_000194139.1.49929 WP_000194139.1.50080 WP_000194139.1.50161 WP_000194139.1.50211 WP_000194139.1.50376 WP_000194139.1.50389 WP_000194139.1.50676 WP_000194139.1.50774 WP_000194139.1.50804 WP_000194139.1.50808 WP_000194139.1.5088 WP_000194139.1.50908 WP_000194139.1.50941 WP_000194139.1.51014 WP_000194139.1.51022 WP_000194139.1.51179 WP_000194139.1.51182 WP_000194139.1.51186 WP_000194139.1.51487 WP_000194139.1.51488 WP_000194139.1.51634 WP_000194139.1.51686 WP_000194139.1.51911 WP_000194139.1.51932 WP_000194139.1.51989 WP_000194139.1.52121 WP_000194139.1.52148 WP_000194139.1.52361 WP_000194139.1.52653 WP_000194139.1.52743 WP_000194139.1.52857 WP_000194139.1.52898 WP_000194139.1.52915 WP_000194139.1.53190 WP_000194139.1.53406 WP_000194139.1.53436 WP_000194139.1.53466 WP_000194139.1.53529 WP_000194139.1.53543 WP_000194139.1.53757 WP_000194139.1.53812 WP_000194139.1.54033 WP_000194139.1.54196 WP_000194139.1.542 WP_000194139.1.54209 WP_000194139.1.54271 WP_000194139.1.54273 WP_000194139.1.54274 WP_000194139.1.54319 WP_000194139.1.54364 WP_000194139.1.54400 WP_000194139.1.54644 WP_000194139.1.54662 WP_000194139.1.54722 WP_000194139.1.54749 WP_000194139.1.54764 WP_000194139.1.55008 WP_000194139.1.55152 WP_000194139.1.55156 WP_000194139.1.55285 WP_000194139.1.55475 WP_000194139.1.55647 WP_000194139.1.55743 WP_000194139.1.55768 WP_000194139.1.55782 WP_000194139.1.55796 WP_000194139.1.55993 WP_000194139.1.56002 WP_000194139.1.56012 WP_000194139.1.56105 WP_000194139.1.56238 WP_000194139.1.56286 WP_000194139.1.56304 WP_000194139.1.56414 WP_000194139.1.56438 WP_000194139.1.56560 WP_000194139.1.56597 WP_000194139.1.56614 WP_000194139.1.56671 WP_000194139.1.56682 WP_000194139.1.56875 WP_000194139.1.56877 WP_000194139.1.57168 WP_000194139.1.57187 WP_000194139.1.57232 WP_000194139.1.57377 WP_000194139.1.57433 WP_000194139.1.57515 WP_000194139.1.57529 WP_000194139.1.57576 WP_000194139.1.57601 WP_000194139.1.57763 WP_000194139.1.57862 WP_000194139.1.57890 WP_000194139.1.57891 WP_000194139.1.57978 WP_000194139.1.5801 WP_000194139.1.5854 WP_000194139.1.58548 WP_000194139.1.5858 WP_000194139.1.58662 WP_000194139.1.58669 WP_000194139.1.58745 WP_000194139.1.58803 WP_000194139.1.5886 WP_000194139.1.59094 WP_000194139.1.59375 WP_000194139.1.59458 WP_000194139.1.59490 WP_000194139.1.59508 WP_000194139.1.5953 WP_000194139.1.59684 WP_000194139.1.59694 WP_000194139.1.59771 WP_000194139.1.5979 WP_000194139.1.59953 WP_000194139.1.60008 WP_000194139.1.60021 WP_000194139.1.60069 WP_000194139.1.60140 WP_000194139.1.60155 WP_000194139.1.60285 WP_000194139.1.60379 WP_000194139.1.60464 WP_000194139.1.60874 WP_000194139.1.60941 WP_000194139.1.61078 WP_000194139.1.6114 WP_000194139.1.61232 WP_000194139.1.6129 WP_000194139.1.61345 WP_000194139.1.61417 WP_000194139.1.61574 WP_000194139.1.61609 WP_000194139.1.61712 WP_000194139.1.61714 WP_000194139.1.61730 WP_000194139.1.61857 WP_000194139.1.61952 WP_000194139.1.62007 WP_000194139.1.62025 WP_000194139.1.62204 WP_000194139.1.62304 WP_000194139.1.62364 WP_000194139.1.62374 WP_000194139.1.62403 WP_000194139.1.62570 WP_000194139.1.62853 WP_000194139.1.62903 WP_000194139.1.62955 WP_000194139.1.63063 WP_000194139.1.63181 WP_000194139.1.63203 WP_000194139.1.63256 WP_000194139.1.63290 WP_000194139.1.63382 WP_000194139.1.63461 WP_000194139.1.63479 WP_000194139.1.63664 WP_000194139.1.63718 WP_000194139.1.6375 WP_000194139.1.63757 WP_000194139.1.63834 WP_000194139.1.64046 WP_000194139.1.6423 WP_000194139.1.64244 WP_000194139.1.64403 WP_000194139.1.64649 WP_000194139.1.64702 WP_000194139.1.64757 WP_000194139.1.64781 WP_000194139.1.64831 WP_000194139.1.6489 WP_000194139.1.65018 WP_000194139.1.65171 WP_000194139.1.65248 WP_000194139.1.6535 WP_000194139.1.65474 WP_000194139.1.65572 WP_000194139.1.65633 WP_000194139.1.6565 WP_000194139.1.65696 WP_000194139.1.6575 WP_000194139.1.65782 WP_000194139.1.6630 WP_000194139.1.66314 WP_000194139.1.66358 WP_000194139.1.66362 WP_000194139.1.6638 WP_000194139.1.66698 WP_000194139.1.6680 WP_000194139.1.66834 WP_000194139.1.66901 WP_000194139.1.66962 WP_000194139.1.67045 WP_000194139.1.67268 WP_000194139.1.67347 WP_000194139.1.67465 WP_000194139.1.67552 WP_000194139.1.67682 WP_000194139.1.67829 WP_000194139.1.67887 WP_000194139.1.68201 WP_000194139.1.68206 WP_000194139.1.6827 WP_000194139.1.68275 WP_000194139.1.6849 WP_000194139.1.68547 WP_000194139.1.68589 WP_000194139.1.68655 WP_000194139.1.68656 WP_000194139.1.68778 WP_000194139.1.68787 WP_000194139.1.68894 WP_000194139.1.68928 WP_000194139.1.68975 WP_000194139.1.69006 WP_000194139.1.6913 WP_000194139.1.69146 WP_000194139.1.69255 WP_000194139.1.69397 WP_000194139.1.69564 WP_000194139.1.69644 WP_000194139.1.69704 WP_000194139.1.7021 WP_000194139.1.70241 WP_000194139.1.70269 WP_000194139.1.70289 WP_000194139.1.70447 WP_000194139.1.70485 WP_000194139.1.70643 WP_000194139.1.70683 WP_000194139.1.70883 WP_000194139.1.70922 WP_000194139.1.70948 WP_000194139.1.71116 WP_000194139.1.71146 WP_000194139.1.71165 WP_000194139.1.71188 WP_000194139.1.71202 WP_000194139.1.71243 WP_000194139.1.71337 WP_000194139.1.71378 WP_000194139.1.71401 WP_000194139.1.71481 WP_000194139.1.71691 WP_000194139.1.71702 WP_000194139.1.71881 WP_000194139.1.71908 WP_000194139.1.71952 WP_000194139.1.71973 WP_000194139.1.72105 WP_000194139.1.72203 WP_000194139.1.72372 WP_000194139.1.72376 WP_000194139.1.72594 WP_000194139.1.72871 WP_000194139.1.72975 WP_000194139.1.73062 WP_000194139.1.7315 WP_000194139.1.73200 WP_000194139.1.7334 WP_000194139.1.73377 WP_000194139.1.73481 WP_000194139.1.7356 WP_000194139.1.73561 WP_000194139.1.73581 WP_000194139.1.73617 WP_000194139.1.73667 WP_000194139.1.73753 WP_000194139.1.73758 WP_000194139.1.73794 WP_000194139.1.7387 WP_000194139.1.73926 WP_000194139.1.74181 WP_000194139.1.74191 WP_000194139.1.7433 WP_000194139.1.74379 WP_000194139.1.74410 WP_000194139.1.74466 WP_000194139.1.74529 WP_000194139.1.74545 WP_000194139.1.74745 WP_000194139.1.75187 WP_000194139.1.75288 WP_000194139.1.75334 WP_000194139.1.75385 WP_000194139.1.75392 WP_000194139.1.75760 WP_000194139.1.75764 WP_000194139.1.75837 WP_000194139.1.75874 WP_000194139.1.75945 WP_000194139.1.76020 WP_000194139.1.76252 WP_000194139.1.76445 WP_000194139.1.7660 WP_000194139.1.76673 WP_000194139.1.76706 WP_000194139.1.76721 WP_000194139.1.76756 WP_000194139.1.76760 WP_000194139.1.76875 WP_000194139.1.76880 WP_000194139.1.76899 WP_000194139.1.77038 WP_000194139.1.77047 WP_000194139.1.77080 WP_000194139.1.7712 WP_000194139.1.77180 WP_000194139.1.77244 WP_000194139.1.77292 WP_000194139.1.77514 WP_000194139.1.77529 WP_000194139.1.77549 WP_000194139.1.77692 WP_000194139.1.7782 WP_000194139.1.77851 WP_000194139.1.77898 WP_000194139.1.77918 WP_000194139.1.77960 WP_000194139.1.78076 WP_000194139.1.78096 WP_000194139.1.78100 WP_000194139.1.78110 WP_000194139.1.78383 WP_000194139.1.78407 WP_000194139.1.7861 WP_000194139.1.78618 WP_000194139.1.78735 WP_000194139.1.78802 WP_000194139.1.78830 WP_000194139.1.78835 WP_000194139.1.78871 WP_000194139.1.78874 WP_000194139.1.78918 WP_000194139.1.78930 WP_000194139.1.79151 WP_000194139.1.79335 WP_000194139.1.79462 WP_000194139.1.79472 WP_000194139.1.79495 WP_000194139.1.79529 WP_000194139.1.79570 WP_000194139.1.7964 WP_000194139.1.79708 WP_000194139.1.79845 WP_000194139.1.80077 WP_000194139.1.80137 WP_000194139.1.80182 WP_000194139.1.80296 WP_000194139.1.80366 WP_000194139.1.80780 WP_000194139.1.80831 WP_000194139.1.80850 WP_000194139.1.80881 WP_000194139.1.8096 WP_000194139.1.81037 WP_000194139.1.81069 WP_000194139.1.81149 WP_000194139.1.81175 WP_000194139.1.8119 WP_000194139.1.81410 WP_000194139.1.81425 WP_000194139.1.81750 WP_000194139.1.81974 WP_000194139.1.82479 WP_000194139.1.82503 WP_000194139.1.82515 WP_000194139.1.82676 WP_000194139.1.82761 WP_000194139.1.8282 WP_000194139.1.82944 WP_000194139.1.82956 WP_000194139.1.83092 WP_000194139.1.83163 WP_000194139.1.83305 WP_000194139.1.83365 WP_000194139.1.83413 WP_000194139.1.83491 WP_000194139.1.83523 WP_000194139.1.8354 WP_000194139.1.83651 WP_000194139.1.83721 WP_000194139.1.83760 WP_000194139.1.83995 WP_000194139.1.84103 WP_000194139.1.84283 WP_000194139.1.84392 WP_000194139.1.8441 WP_000194139.1.84532 WP_000194139.1.84554 WP_000194139.1.84659 WP_000194139.1.84693 WP_000194139.1.84899 WP_000194139.1.8497 WP_000194139.1.85040 WP_000194139.1.85178 WP_000194139.1.85190 WP_000194139.1.8545 WP_000194139.1.85481 WP_000194139.1.85483 WP_000194139.1.85541 WP_000194139.1.8556 WP_000194139.1.85615 WP_000194139.1.85617 WP_000194139.1.85663 WP_000194139.1.85671 WP_000194139.1.85672 WP_000194139.1.85777 WP_000194139.1.85855 WP_000194139.1.85886 WP_000194139.1.85900 WP_000194139.1.85904 WP_000194139.1.86306 WP_000194139.1.86356 WP_000194139.1.86450 WP_000194139.1.86580 WP_000194139.1.86588 WP_000194139.1.86661 WP_000194139.1.8672 WP_000194139.1.8678 WP_000194139.1.86810 WP_000194139.1.8684 WP_000194139.1.86895 WP_000194139.1.86906 WP_000194139.1.87095 WP_000194139.1.87323 WP_000194139.1.8736 WP_000194139.1.87460 WP_000194139.1.87552 WP_000194139.1.87779 WP_000194139.1.87945 WP_000194139.1.88073 WP_000194139.1.8809 WP_000194139.1.88291 WP_000194139.1.8837 WP_000194139.1.88393 WP_000194139.1.88703 WP_000194139.1.88792 WP_000194139.1.88902 WP_000194139.1.8891 WP_000194139.1.88981 WP_000194139.1.89008 WP_000194139.1.89116 WP_000194139.1.89138 WP_000194139.1.89304 WP_000194139.1.89512 WP_000194139.1.89527 WP_000194139.1.89570 WP_000194139.1.89604 WP_000194139.1.89622 WP_000194139.1.89659 WP_000194139.1.8996 WP_000194139.1.90097 WP_000194139.1.90252 WP_000194139.1.90417 WP_000194139.1.90453 WP_000194139.1.90458 WP_000194139.1.90557 WP_000194139.1.90585 WP_000194139.1.90641 WP_000194139.1.90734 WP_000194139.1.91003 WP_000194139.1.91069 WP_000194139.1.91278 WP_000194139.1.9131 WP_000194139.1.91512 WP_000194139.1.91524 WP_000194139.1.91564 WP_000194139.1.91628 WP_000194139.1.91655 WP_000194139.1.91724 WP_000194139.1.91732 WP_000194139.1.91788 WP_000194139.1.92060 WP_000194139.1.92093 WP_000194139.1.92171 WP_000194139.1.92183 WP_000194139.1.92208 WP_000194139.1.92268 WP_000194139.1.92310 WP_000194139.1.92318 WP_000194139.1.92443 WP_000194139.1.92482 WP_000194139.1.92531 WP_000194139.1.92669 WP_000194139.1.92671 WP_000194139.1.92738 WP_000194139.1.93086 WP_000194139.1.93101 WP_000194139.1.93136 WP_000194139.1.93155 WP_000194139.1.93365 WP_000194139.1.93376 WP_000194139.1.93543 WP_000194139.1.93650 WP_000194139.1.93656 WP_000194139.1.93662 WP_000194139.1.937 WP_000194139.1.93705 WP_000194139.1.93804 WP_000194139.1.9389 WP_000194139.1.93994 WP_000194139.1.94072 WP_000194139.1.94162 WP_000194139.1.94168 WP_000194139.1.94198 WP_000194139.1.9432 WP_000194139.1.94354 WP_000194139.1.94380 WP_000194139.1.94565 WP_000194139.1.94584 WP_000194139.1.94674 WP_000194139.1.94796 WP_000194139.1.94959 WP_000194139.1.95051 WP_000194139.1.95085 WP_000194139.1.95121 WP_000194139.1.95282 WP_000194139.1.95546 WP_000194139.1.95630 WP_000194139.1.95911 WP_000194139.1.96139 WP_000194139.1.96317 WP_000194139.1.96343 WP_000194139.1.9644 WP_000194139.1.96469 WP_000194139.1.96497 WP_000194139.1.96500 WP_000194139.1.96555 WP_000194139.1.96563 WP_000194139.1.96732 WP_000194139.1.96771 WP_000194139.1.97015 WP_000194139.1.97145 WP_000194139.1.97190 WP_000194139.1.97318 WP_000194139.1.97369 WP_000194139.1.97597 WP_000194139.1.97613 WP_000194139.1.97620 WP_000194139.1.97727 WP_000194139.1.97732 WP_000194139.1.97736 WP_000194139.1.9775 WP_000194139.1.97846 WP_000194139.1.98006 WP_000194139.1.98019 WP_000194139.1.98022 WP_000194139.1.98110 WP_000194139.1.98146 WP_000194139.1.98219 WP_000194139.1.9841 WP_000194139.1.98495 WP_000194139.1.98531 WP_000194139.1.98577 WP_000194139.1.98676 WP_000194139.1.98677 WP_000194139.1.98760 WP_000194139.1.98843 WP_000194139.1.9898 WP_000194139.1.99072 WP_000194139.1.99098 WP_000194139.1.99184 WP_000194139.1.99267 WP_000194139.1.99276 WP_000194139.1.99646 WP_000194139.1.99657 WP_000194139.1.99660 WP_000194139.1.99712 WP_000194139.1.99813 WP_000194139.1.99889 WP_000194139.1.99958 gi|378444082|ref|YP_005231714.1| gi|549723292|ref|YP_008643482.1| ABAM02000001|CDS_1144368-1148252 ABAO01000003|CDS_144488-148372 AE006468|CDS_645462-649346 CP001363|CDS_646156-650040 FN424405|CDS_684272-688156 gi|550900021|ref|YP_008669113.1| 99287.STM0588 gi|378448935|ref|YP_005236294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]