SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378448943|ref|YP_005236302.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378448943|ref|YP_005236302.1|
Domain Number 1 Region: 15-532
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.72e-123
Family Acetyl-CoA synthetase-like 0.00000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378448943|ref|YP_005236302.1|
Sequence length 536
Comment enterobactin synthase subunit E [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIEGERAFSYRQLNQAADN
LACSLRRQGIKPGETALVQLGNVPELYITFFALLKLGVAPVLALFSHQRTELNAYAMQIA
PTLVIADRQHTLFAGEDFLNTFVAEHRSVRVVLLRNDDGDHSLDAAMRQAAEDFTATPSP
ADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEICGFNEDTRFLCAIPAAHNYAMSS
PGALGVFLAKGTVVLATDPSATLCFPLIEKHQINATALVPPAVSLWLQAIQEWGGNAPLA
SLRLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSPERIINTQGRPMC
PDDEVWVADADGNPLPPGEIGRLMTRGPYTFRGYFNSPLHNASAFDANGFYCSGDLISID
QDGYITVHGREKDQINRGGEKIAAEEIENLLLRHPVVIHAALVSMEDELLGEKSCAYLVV
KEPLRAVQVRRFLREQGVAEFKLPDRVECVASLPLTPVGKVDKKQLRQRLASRSPL
Download sequence
Identical sequences A0A0D6H4V5 A0A0F6AY84 A0A0F7J475 A0A0H3NAG6 A0A0U1F2H1 A0A0W4HHF1 A0A2D3AM78 A0A2H9YMN4 Q8ZR32
gi|549723299|ref|YP_008643489.1| gi|378698549|ref|YP_005180506.1| gi|378448943|ref|YP_005236302.1| gi|378983199|ref|YP_005246354.1| NP_459588.1.58477 WP_001222445.1.100010 WP_001222445.1.100115 WP_001222445.1.100234 WP_001222445.1.100376 WP_001222445.1.100424 WP_001222445.1.100436 WP_001222445.1.100484 WP_001222445.1.100488 WP_001222445.1.100597 WP_001222445.1.10076 WP_001222445.1.100781 WP_001222445.1.100793 WP_001222445.1.100869 WP_001222445.1.100871 WP_001222445.1.100882 WP_001222445.1.101007 WP_001222445.1.101020 WP_001222445.1.101074 WP_001222445.1.101078 WP_001222445.1.101180 WP_001222445.1.101259 WP_001222445.1.101284 WP_001222445.1.101291 WP_001222445.1.101353 WP_001222445.1.101386 WP_001222445.1.101404 WP_001222445.1.101420 WP_001222445.1.101589 WP_001222445.1.101707 WP_001222445.1.101734 WP_001222445.1.101878 WP_001222445.1.101953 WP_001222445.1.10220 WP_001222445.1.10266 WP_001222445.1.10429 WP_001222445.1.10439 WP_001222445.1.10678 WP_001222445.1.10753 WP_001222445.1.10992 WP_001222445.1.11024 WP_001222445.1.11031 WP_001222445.1.11098 WP_001222445.1.11168 WP_001222445.1.11190 WP_001222445.1.11295 WP_001222445.1.11455 WP_001222445.1.11458 WP_001222445.1.11518 WP_001222445.1.11532 WP_001222445.1.11543 WP_001222445.1.11763 WP_001222445.1.11772 WP_001222445.1.11897 WP_001222445.1.12114 WP_001222445.1.12244 WP_001222445.1.12351 WP_001222445.1.12370 WP_001222445.1.12546 WP_001222445.1.12584 WP_001222445.1.1264 WP_001222445.1.12728 WP_001222445.1.12879 WP_001222445.1.12936 WP_001222445.1.12995 WP_001222445.1.13027 WP_001222445.1.13106 WP_001222445.1.13130 WP_001222445.1.13414 WP_001222445.1.13488 WP_001222445.1.13509 WP_001222445.1.13669 WP_001222445.1.13741 WP_001222445.1.1387 WP_001222445.1.13908 WP_001222445.1.13932 WP_001222445.1.13968 WP_001222445.1.14001 WP_001222445.1.14151 WP_001222445.1.14239 WP_001222445.1.14286 WP_001222445.1.14320 WP_001222445.1.14379 WP_001222445.1.14406 WP_001222445.1.14410 WP_001222445.1.14516 WP_001222445.1.14524 WP_001222445.1.14554 WP_001222445.1.14725 WP_001222445.1.14852 WP_001222445.1.14932 WP_001222445.1.15055 WP_001222445.1.15223 WP_001222445.1.15226 WP_001222445.1.15316 WP_001222445.1.15353 WP_001222445.1.15369 WP_001222445.1.1540 WP_001222445.1.15508 WP_001222445.1.15784 WP_001222445.1.15830 WP_001222445.1.16062 WP_001222445.1.16063 WP_001222445.1.16103 WP_001222445.1.16226 WP_001222445.1.16233 WP_001222445.1.16284 WP_001222445.1.16328 WP_001222445.1.1635 WP_001222445.1.16468 WP_001222445.1.16614 WP_001222445.1.16650 WP_001222445.1.16686 WP_001222445.1.16691 WP_001222445.1.16732 WP_001222445.1.16735 WP_001222445.1.16786 WP_001222445.1.16819 WP_001222445.1.16858 WP_001222445.1.16896 WP_001222445.1.16916 WP_001222445.1.16965 WP_001222445.1.1700 WP_001222445.1.17307 WP_001222445.1.174 WP_001222445.1.17480 WP_001222445.1.17546 WP_001222445.1.17702 WP_001222445.1.17705 WP_001222445.1.18019 WP_001222445.1.18111 WP_001222445.1.18163 WP_001222445.1.18265 WP_001222445.1.18267 WP_001222445.1.18468 WP_001222445.1.18607 WP_001222445.1.18705 WP_001222445.1.18715 WP_001222445.1.18776 WP_001222445.1.18822 WP_001222445.1.18881 WP_001222445.1.18940 WP_001222445.1.18949 WP_001222445.1.19053 WP_001222445.1.19320 WP_001222445.1.19458 WP_001222445.1.19460 WP_001222445.1.19461 WP_001222445.1.19614 WP_001222445.1.19702 WP_001222445.1.19706 WP_001222445.1.19724 WP_001222445.1.19749 WP_001222445.1.19784 WP_001222445.1.19802 WP_001222445.1.19809 WP_001222445.1.19867 WP_001222445.1.1998 WP_001222445.1.2010 WP_001222445.1.20212 WP_001222445.1.20266 WP_001222445.1.20271 WP_001222445.1.20362 WP_001222445.1.20418 WP_001222445.1.20443 WP_001222445.1.20525 WP_001222445.1.2054 WP_001222445.1.20553 WP_001222445.1.20626 WP_001222445.1.20646 WP_001222445.1.20721 WP_001222445.1.20886 WP_001222445.1.20908 WP_001222445.1.21049 WP_001222445.1.21245 WP_001222445.1.21246 WP_001222445.1.21269 WP_001222445.1.21400 WP_001222445.1.21497 WP_001222445.1.21499 WP_001222445.1.21603 WP_001222445.1.21751 WP_001222445.1.21757 WP_001222445.1.22024 WP_001222445.1.2205 WP_001222445.1.22062 WP_001222445.1.22067 WP_001222445.1.2221 WP_001222445.1.22379 WP_001222445.1.22427 WP_001222445.1.2246 WP_001222445.1.22485 WP_001222445.1.22620 WP_001222445.1.22870 WP_001222445.1.22979 WP_001222445.1.23102 WP_001222445.1.23114 WP_001222445.1.2314 WP_001222445.1.23192 WP_001222445.1.23259 WP_001222445.1.23460 WP_001222445.1.23472 WP_001222445.1.2364 WP_001222445.1.23643 WP_001222445.1.23685 WP_001222445.1.23932 WP_001222445.1.24017 WP_001222445.1.24206 WP_001222445.1.24308 WP_001222445.1.24578 WP_001222445.1.24723 WP_001222445.1.24737 WP_001222445.1.24779 WP_001222445.1.25008 WP_001222445.1.25015 WP_001222445.1.25405 WP_001222445.1.25454 WP_001222445.1.25493 WP_001222445.1.25668 WP_001222445.1.25690 WP_001222445.1.2570 WP_001222445.1.25740 WP_001222445.1.25793 WP_001222445.1.25814 WP_001222445.1.25988 WP_001222445.1.26030 WP_001222445.1.26282 WP_001222445.1.26311 WP_001222445.1.26319 WP_001222445.1.2634 WP_001222445.1.26429 WP_001222445.1.26440 WP_001222445.1.26493 WP_001222445.1.26551 WP_001222445.1.26567 WP_001222445.1.2660 WP_001222445.1.27010 WP_001222445.1.27173 WP_001222445.1.27206 WP_001222445.1.27423 WP_001222445.1.27556 WP_001222445.1.27561 WP_001222445.1.2763 WP_001222445.1.27665 WP_001222445.1.27707 WP_001222445.1.27761 WP_001222445.1.2777 WP_001222445.1.27857 WP_001222445.1.27977 WP_001222445.1.28094 WP_001222445.1.28302 WP_001222445.1.2835 WP_001222445.1.28370 WP_001222445.1.28538 WP_001222445.1.28575 WP_001222445.1.28625 WP_001222445.1.28655 WP_001222445.1.28694 WP_001222445.1.2879 WP_001222445.1.2890 WP_001222445.1.28938 WP_001222445.1.28946 WP_001222445.1.29006 WP_001222445.1.29010 WP_001222445.1.2910 WP_001222445.1.29588 WP_001222445.1.29601 WP_001222445.1.29606 WP_001222445.1.29615 WP_001222445.1.29619 WP_001222445.1.29704 WP_001222445.1.29969 WP_001222445.1.30006 WP_001222445.1.30027 WP_001222445.1.30180 WP_001222445.1.30469 WP_001222445.1.30505 WP_001222445.1.30507 WP_001222445.1.30535 WP_001222445.1.30547 WP_001222445.1.30794 WP_001222445.1.30833 WP_001222445.1.30835 WP_001222445.1.30972 WP_001222445.1.31 WP_001222445.1.3113 WP_001222445.1.31185 WP_001222445.1.3119 WP_001222445.1.31190 WP_001222445.1.31195 WP_001222445.1.31196 WP_001222445.1.31281 WP_001222445.1.31504 WP_001222445.1.31515 WP_001222445.1.31578 WP_001222445.1.31658 WP_001222445.1.31762 WP_001222445.1.31940 WP_001222445.1.31967 WP_001222445.1.31972 WP_001222445.1.32192 WP_001222445.1.32206 WP_001222445.1.32438 WP_001222445.1.32515 WP_001222445.1.32629 WP_001222445.1.32660 WP_001222445.1.32702 WP_001222445.1.32714 WP_001222445.1.32786 WP_001222445.1.32804 WP_001222445.1.32907 WP_001222445.1.33030 WP_001222445.1.33078 WP_001222445.1.33127 WP_001222445.1.33143 WP_001222445.1.33248 WP_001222445.1.33261 WP_001222445.1.333 WP_001222445.1.33492 WP_001222445.1.33553 WP_001222445.1.33592 WP_001222445.1.33894 WP_001222445.1.34043 WP_001222445.1.34075 WP_001222445.1.34257 WP_001222445.1.34279 WP_001222445.1.34319 WP_001222445.1.34453 WP_001222445.1.34667 WP_001222445.1.34975 WP_001222445.1.35045 WP_001222445.1.35129 WP_001222445.1.35184 WP_001222445.1.35404 WP_001222445.1.35408 WP_001222445.1.35446 WP_001222445.1.35463 WP_001222445.1.35503 WP_001222445.1.35509 WP_001222445.1.35590 WP_001222445.1.35940 WP_001222445.1.36003 WP_001222445.1.3601 WP_001222445.1.36609 WP_001222445.1.36690 WP_001222445.1.3670 WP_001222445.1.36705 WP_001222445.1.36918 WP_001222445.1.36931 WP_001222445.1.37063 WP_001222445.1.37073 WP_001222445.1.37111 WP_001222445.1.37112 WP_001222445.1.37256 WP_001222445.1.37293 WP_001222445.1.3734 WP_001222445.1.37370 WP_001222445.1.37376 WP_001222445.1.3744 WP_001222445.1.37498 WP_001222445.1.37504 WP_001222445.1.37618 WP_001222445.1.37968 WP_001222445.1.37978 WP_001222445.1.38001 WP_001222445.1.38125 WP_001222445.1.38145 WP_001222445.1.383 WP_001222445.1.3848 WP_001222445.1.38613 WP_001222445.1.38673 WP_001222445.1.38693 WP_001222445.1.38773 WP_001222445.1.38882 WP_001222445.1.38913 WP_001222445.1.39003 WP_001222445.1.39136 WP_001222445.1.39197 WP_001222445.1.39229 WP_001222445.1.39385 WP_001222445.1.39405 WP_001222445.1.39420 WP_001222445.1.39449 WP_001222445.1.39512 WP_001222445.1.39629 WP_001222445.1.39763 WP_001222445.1.39862 WP_001222445.1.39921 WP_001222445.1.39923 WP_001222445.1.40017 WP_001222445.1.40072 WP_001222445.1.40073 WP_001222445.1.4011 WP_001222445.1.40208 WP_001222445.1.40240 WP_001222445.1.40257 WP_001222445.1.40292 WP_001222445.1.40305 WP_001222445.1.40311 WP_001222445.1.40395 WP_001222445.1.40465 WP_001222445.1.40508 WP_001222445.1.40710 WP_001222445.1.4075 WP_001222445.1.4087 WP_001222445.1.40877 WP_001222445.1.41017 WP_001222445.1.41086 WP_001222445.1.41091 WP_001222445.1.41226 WP_001222445.1.41279 WP_001222445.1.41516 WP_001222445.1.41554 WP_001222445.1.41591 WP_001222445.1.41662 WP_001222445.1.41761 WP_001222445.1.41882 WP_001222445.1.41979 WP_001222445.1.41985 WP_001222445.1.42104 WP_001222445.1.42320 WP_001222445.1.42342 WP_001222445.1.42422 WP_001222445.1.4276 WP_001222445.1.42864 WP_001222445.1.4288 WP_001222445.1.42957 WP_001222445.1.43018 WP_001222445.1.43041 WP_001222445.1.43244 WP_001222445.1.43312 WP_001222445.1.43437 WP_001222445.1.43522 WP_001222445.1.43613 WP_001222445.1.43668 WP_001222445.1.43886 WP_001222445.1.44005 WP_001222445.1.44043 WP_001222445.1.44099 WP_001222445.1.44121 WP_001222445.1.44291 WP_001222445.1.44310 WP_001222445.1.44479 WP_001222445.1.44640 WP_001222445.1.4467 WP_001222445.1.44747 WP_001222445.1.4485 WP_001222445.1.44927 WP_001222445.1.45067 WP_001222445.1.45074 WP_001222445.1.45079 WP_001222445.1.45098 WP_001222445.1.45177 WP_001222445.1.45184 WP_001222445.1.45259 WP_001222445.1.45349 WP_001222445.1.45365 WP_001222445.1.45468 WP_001222445.1.45550 WP_001222445.1.45585 WP_001222445.1.45660 WP_001222445.1.45690 WP_001222445.1.458 WP_001222445.1.46011 WP_001222445.1.46069 WP_001222445.1.46112 WP_001222445.1.46173 WP_001222445.1.46174 WP_001222445.1.46187 WP_001222445.1.46286 WP_001222445.1.46574 WP_001222445.1.46595 WP_001222445.1.46620 WP_001222445.1.46666 WP_001222445.1.46675 WP_001222445.1.47214 WP_001222445.1.47429 WP_001222445.1.47448 WP_001222445.1.4747 WP_001222445.1.47472 WP_001222445.1.47478 WP_001222445.1.47621 WP_001222445.1.47649 WP_001222445.1.47799 WP_001222445.1.47814 WP_001222445.1.48209 WP_001222445.1.48242 WP_001222445.1.48253 WP_001222445.1.483 WP_001222445.1.48367 WP_001222445.1.48377 WP_001222445.1.4853 WP_001222445.1.48570 WP_001222445.1.48788 WP_001222445.1.48894 WP_001222445.1.48919 WP_001222445.1.48985 WP_001222445.1.49084 WP_001222445.1.49155 WP_001222445.1.49204 WP_001222445.1.49239 WP_001222445.1.49256 WP_001222445.1.49290 WP_001222445.1.49340 WP_001222445.1.49366 WP_001222445.1.49472 WP_001222445.1.49490 WP_001222445.1.49515 WP_001222445.1.49572 WP_001222445.1.4979 WP_001222445.1.49803 WP_001222445.1.49805 WP_001222445.1.49929 WP_001222445.1.50161 WP_001222445.1.50211 WP_001222445.1.50376 WP_001222445.1.50389 WP_001222445.1.50676 WP_001222445.1.50804 WP_001222445.1.50808 WP_001222445.1.5088 WP_001222445.1.50908 WP_001222445.1.50941 WP_001222445.1.51014 WP_001222445.1.51022 WP_001222445.1.51179 WP_001222445.1.51182 WP_001222445.1.51186 WP_001222445.1.51487 WP_001222445.1.51488 WP_001222445.1.51634 WP_001222445.1.51649 WP_001222445.1.51686 WP_001222445.1.51756 WP_001222445.1.51911 WP_001222445.1.51932 WP_001222445.1.51989 WP_001222445.1.52121 WP_001222445.1.52346 WP_001222445.1.52353 WP_001222445.1.52361 WP_001222445.1.52438 WP_001222445.1.52653 WP_001222445.1.52656 WP_001222445.1.52743 WP_001222445.1.52857 WP_001222445.1.52898 WP_001222445.1.52915 WP_001222445.1.53190 WP_001222445.1.5333 WP_001222445.1.53406 WP_001222445.1.53466 WP_001222445.1.53529 WP_001222445.1.53543 WP_001222445.1.53757 WP_001222445.1.53812 WP_001222445.1.53935 WP_001222445.1.54033 WP_001222445.1.54075 WP_001222445.1.54196 WP_001222445.1.54209 WP_001222445.1.54271 WP_001222445.1.54274 WP_001222445.1.54319 WP_001222445.1.54364 WP_001222445.1.54400 WP_001222445.1.54569 WP_001222445.1.54644 WP_001222445.1.54662 WP_001222445.1.54722 WP_001222445.1.54749 WP_001222445.1.54764 WP_001222445.1.55008 WP_001222445.1.55152 WP_001222445.1.55156 WP_001222445.1.55285 WP_001222445.1.55475 WP_001222445.1.55647 WP_001222445.1.55743 WP_001222445.1.55768 WP_001222445.1.55782 WP_001222445.1.55796 WP_001222445.1.56002 WP_001222445.1.56012 WP_001222445.1.56105 WP_001222445.1.56238 WP_001222445.1.56286 WP_001222445.1.56304 WP_001222445.1.56414 WP_001222445.1.56438 WP_001222445.1.56560 WP_001222445.1.56601 WP_001222445.1.56614 WP_001222445.1.56671 WP_001222445.1.56682 WP_001222445.1.56853 WP_001222445.1.56875 WP_001222445.1.56893 WP_001222445.1.57168 WP_001222445.1.57187 WP_001222445.1.57307 WP_001222445.1.57377 WP_001222445.1.57418 WP_001222445.1.57433 WP_001222445.1.57515 WP_001222445.1.57529 WP_001222445.1.57576 WP_001222445.1.57601 WP_001222445.1.57607 WP_001222445.1.57763 WP_001222445.1.57862 WP_001222445.1.57890 WP_001222445.1.57891 WP_001222445.1.57978 WP_001222445.1.5801 WP_001222445.1.58040 WP_001222445.1.58041 WP_001222445.1.58548 WP_001222445.1.5858 WP_001222445.1.58662 WP_001222445.1.58669 WP_001222445.1.58745 WP_001222445.1.58803 WP_001222445.1.5886 WP_001222445.1.59094 WP_001222445.1.59224 WP_001222445.1.59336 WP_001222445.1.59375 WP_001222445.1.59381 WP_001222445.1.59458 WP_001222445.1.59490 WP_001222445.1.59508 WP_001222445.1.59641 WP_001222445.1.59684 WP_001222445.1.59694 WP_001222445.1.59771 WP_001222445.1.5979 WP_001222445.1.59830 WP_001222445.1.59953 WP_001222445.1.60008 WP_001222445.1.60021 WP_001222445.1.60069 WP_001222445.1.60140 WP_001222445.1.60155 WP_001222445.1.60285 WP_001222445.1.60379 WP_001222445.1.60464 WP_001222445.1.60874 WP_001222445.1.60919 WP_001222445.1.60941 WP_001222445.1.61078 WP_001222445.1.6114 WP_001222445.1.61232 WP_001222445.1.6129 WP_001222445.1.61296 WP_001222445.1.61345 WP_001222445.1.61417 WP_001222445.1.6164 WP_001222445.1.61712 WP_001222445.1.61714 WP_001222445.1.61730 WP_001222445.1.61857 WP_001222445.1.61918 WP_001222445.1.61952 WP_001222445.1.62007 WP_001222445.1.62025 WP_001222445.1.62204 WP_001222445.1.62304 WP_001222445.1.62364 WP_001222445.1.62374 WP_001222445.1.62403 WP_001222445.1.6253 WP_001222445.1.62853 WP_001222445.1.62903 WP_001222445.1.62910 WP_001222445.1.62955 WP_001222445.1.63155 WP_001222445.1.63203 WP_001222445.1.63256 WP_001222445.1.63290 WP_001222445.1.63382 WP_001222445.1.63432 WP_001222445.1.63461 WP_001222445.1.63479 WP_001222445.1.63577 WP_001222445.1.63664 WP_001222445.1.63718 WP_001222445.1.6375 WP_001222445.1.63834 WP_001222445.1.63934 WP_001222445.1.64007 WP_001222445.1.64046 WP_001222445.1.6423 WP_001222445.1.64244 WP_001222445.1.64403 WP_001222445.1.64649 WP_001222445.1.64702 WP_001222445.1.64757 WP_001222445.1.64781 WP_001222445.1.64831 WP_001222445.1.6489 WP_001222445.1.65018 WP_001222445.1.65027 WP_001222445.1.65028 WP_001222445.1.65171 WP_001222445.1.65248 WP_001222445.1.6535 WP_001222445.1.65474 WP_001222445.1.65633 WP_001222445.1.6565 WP_001222445.1.65696 WP_001222445.1.6575 WP_001222445.1.65782 WP_001222445.1.6630 WP_001222445.1.66314 WP_001222445.1.66362 WP_001222445.1.6638 WP_001222445.1.6640 WP_001222445.1.66600 WP_001222445.1.66698 WP_001222445.1.6680 WP_001222445.1.66834 WP_001222445.1.66901 WP_001222445.1.66962 WP_001222445.1.67037 WP_001222445.1.67045 WP_001222445.1.67181 WP_001222445.1.67268 WP_001222445.1.67288 WP_001222445.1.67347 WP_001222445.1.67465 WP_001222445.1.67552 WP_001222445.1.67682 WP_001222445.1.67829 WP_001222445.1.67887 WP_001222445.1.68073 WP_001222445.1.68201 WP_001222445.1.68206 WP_001222445.1.6827 WP_001222445.1.68275 WP_001222445.1.6849 WP_001222445.1.68532 WP_001222445.1.68547 WP_001222445.1.68589 WP_001222445.1.68655 WP_001222445.1.68656 WP_001222445.1.68778 WP_001222445.1.68787 WP_001222445.1.68894 WP_001222445.1.68928 WP_001222445.1.68975 WP_001222445.1.69006 WP_001222445.1.6913 WP_001222445.1.69146 WP_001222445.1.69255 WP_001222445.1.69397 WP_001222445.1.69564 WP_001222445.1.69636 WP_001222445.1.69644 WP_001222445.1.69704 WP_001222445.1.7021 WP_001222445.1.70241 WP_001222445.1.70269 WP_001222445.1.70289 WP_001222445.1.70321 WP_001222445.1.70447 WP_001222445.1.70485 WP_001222445.1.70643 WP_001222445.1.70683 WP_001222445.1.70883 WP_001222445.1.70922 WP_001222445.1.70948 WP_001222445.1.71116 WP_001222445.1.71146 WP_001222445.1.71165 WP_001222445.1.71188 WP_001222445.1.71202 WP_001222445.1.71243 WP_001222445.1.71306 WP_001222445.1.71337 WP_001222445.1.71378 WP_001222445.1.71401 WP_001222445.1.71446 WP_001222445.1.71481 WP_001222445.1.71702 WP_001222445.1.7174 WP_001222445.1.71750 WP_001222445.1.71845 WP_001222445.1.71881 WP_001222445.1.71908 WP_001222445.1.71952 WP_001222445.1.71973 WP_001222445.1.72105 WP_001222445.1.72203 WP_001222445.1.72226 WP_001222445.1.72376 WP_001222445.1.72594 WP_001222445.1.72871 WP_001222445.1.72975 WP_001222445.1.7315 WP_001222445.1.73200 WP_001222445.1.7334 WP_001222445.1.73377 WP_001222445.1.7356 WP_001222445.1.73581 WP_001222445.1.73617 WP_001222445.1.73753 WP_001222445.1.73758 WP_001222445.1.73794 WP_001222445.1.73831 WP_001222445.1.7387 WP_001222445.1.73924 WP_001222445.1.74029 WP_001222445.1.74181 WP_001222445.1.74191 WP_001222445.1.7433 WP_001222445.1.74379 WP_001222445.1.74410 WP_001222445.1.74466 WP_001222445.1.74529 WP_001222445.1.74545 WP_001222445.1.74745 WP_001222445.1.75129 WP_001222445.1.75187 WP_001222445.1.75288 WP_001222445.1.75334 WP_001222445.1.75362 WP_001222445.1.75385 WP_001222445.1.75392 WP_001222445.1.75402 WP_001222445.1.75760 WP_001222445.1.75764 WP_001222445.1.75828 WP_001222445.1.75837 WP_001222445.1.75874 WP_001222445.1.75945 WP_001222445.1.76020 WP_001222445.1.76055 WP_001222445.1.76097 WP_001222445.1.76252 WP_001222445.1.76364 WP_001222445.1.76445 WP_001222445.1.7660 WP_001222445.1.76673 WP_001222445.1.76706 WP_001222445.1.76721 WP_001222445.1.76756 WP_001222445.1.76760 WP_001222445.1.76806 WP_001222445.1.76875 WP_001222445.1.76880 WP_001222445.1.76899 WP_001222445.1.77038 WP_001222445.1.77047 WP_001222445.1.77080 WP_001222445.1.7712 WP_001222445.1.77180 WP_001222445.1.77244 WP_001222445.1.77292 WP_001222445.1.77514 WP_001222445.1.77549 WP_001222445.1.77692 WP_001222445.1.7782 WP_001222445.1.77851 WP_001222445.1.77918 WP_001222445.1.77960 WP_001222445.1.78033 WP_001222445.1.78076 WP_001222445.1.78096 WP_001222445.1.78100 WP_001222445.1.78110 WP_001222445.1.78120 WP_001222445.1.78201 WP_001222445.1.78383 WP_001222445.1.78407 WP_001222445.1.7861 WP_001222445.1.78618 WP_001222445.1.78673 WP_001222445.1.78735 WP_001222445.1.78802 WP_001222445.1.78830 WP_001222445.1.78835 WP_001222445.1.78871 WP_001222445.1.78874 WP_001222445.1.78918 WP_001222445.1.78928 WP_001222445.1.78930 WP_001222445.1.79151 WP_001222445.1.79167 WP_001222445.1.79335 WP_001222445.1.79462 WP_001222445.1.79472 WP_001222445.1.79490 WP_001222445.1.79495 WP_001222445.1.79529 WP_001222445.1.7964 WP_001222445.1.79659 WP_001222445.1.79668 WP_001222445.1.79708 WP_001222445.1.79845 WP_001222445.1.80077 WP_001222445.1.80137 WP_001222445.1.80182 WP_001222445.1.80296 WP_001222445.1.80366 WP_001222445.1.80529 WP_001222445.1.80780 WP_001222445.1.80831 WP_001222445.1.80850 WP_001222445.1.80881 WP_001222445.1.80939 WP_001222445.1.8096 WP_001222445.1.81037 WP_001222445.1.81069 WP_001222445.1.81149 WP_001222445.1.81175 WP_001222445.1.8119 WP_001222445.1.81354 WP_001222445.1.81425 WP_001222445.1.81750 WP_001222445.1.81785 WP_001222445.1.81902 WP_001222445.1.81974 WP_001222445.1.82479 WP_001222445.1.82503 WP_001222445.1.82515 WP_001222445.1.82676 WP_001222445.1.82761 WP_001222445.1.8282 WP_001222445.1.82841 WP_001222445.1.82944 WP_001222445.1.82956 WP_001222445.1.83092 WP_001222445.1.83163 WP_001222445.1.83305 WP_001222445.1.83413 WP_001222445.1.83491 WP_001222445.1.83523 WP_001222445.1.8354 WP_001222445.1.83650 WP_001222445.1.83651 WP_001222445.1.83721 WP_001222445.1.83760 WP_001222445.1.83854 WP_001222445.1.83995 WP_001222445.1.84103 WP_001222445.1.84283 WP_001222445.1.84355 WP_001222445.1.84392 WP_001222445.1.8441 WP_001222445.1.84532 WP_001222445.1.84659 WP_001222445.1.84899 WP_001222445.1.8497 WP_001222445.1.85040 WP_001222445.1.85134 WP_001222445.1.85178 WP_001222445.1.85180 WP_001222445.1.85190 WP_001222445.1.8533 WP_001222445.1.8545 WP_001222445.1.85481 WP_001222445.1.85483 WP_001222445.1.85541 WP_001222445.1.8556 WP_001222445.1.85615 WP_001222445.1.85617 WP_001222445.1.85663 WP_001222445.1.85671 WP_001222445.1.85672 WP_001222445.1.85777 WP_001222445.1.85886 WP_001222445.1.85900 WP_001222445.1.85904 WP_001222445.1.85976 WP_001222445.1.86306 WP_001222445.1.86356 WP_001222445.1.86450 WP_001222445.1.86453 WP_001222445.1.86469 WP_001222445.1.86580 WP_001222445.1.86588 WP_001222445.1.86661 WP_001222445.1.8672 WP_001222445.1.8678 WP_001222445.1.86810 WP_001222445.1.8684 WP_001222445.1.86895 WP_001222445.1.86906 WP_001222445.1.87095 WP_001222445.1.87323 WP_001222445.1.8736 WP_001222445.1.87460 WP_001222445.1.87552 WP_001222445.1.87779 WP_001222445.1.87875 WP_001222445.1.87945 WP_001222445.1.88019 WP_001222445.1.88073 WP_001222445.1.8809 WP_001222445.1.88291 WP_001222445.1.88293 WP_001222445.1.8837 WP_001222445.1.88393 WP_001222445.1.88703 WP_001222445.1.88792 WP_001222445.1.88902 WP_001222445.1.8891 WP_001222445.1.88981 WP_001222445.1.89008 WP_001222445.1.89116 WP_001222445.1.89138 WP_001222445.1.89291 WP_001222445.1.89304 WP_001222445.1.89512 WP_001222445.1.89527 WP_001222445.1.89570 WP_001222445.1.89604 WP_001222445.1.89622 WP_001222445.1.89659 WP_001222445.1.89902 WP_001222445.1.8996 WP_001222445.1.90097 WP_001222445.1.90252 WP_001222445.1.90417 WP_001222445.1.90453 WP_001222445.1.90458 WP_001222445.1.90557 WP_001222445.1.90585 WP_001222445.1.90641 WP_001222445.1.90734 WP_001222445.1.91003 WP_001222445.1.91069 WP_001222445.1.91278 WP_001222445.1.91470 WP_001222445.1.91512 WP_001222445.1.91524 WP_001222445.1.91564 WP_001222445.1.91628 WP_001222445.1.91724 WP_001222445.1.91732 WP_001222445.1.91788 WP_001222445.1.92013 WP_001222445.1.92093 WP_001222445.1.92108 WP_001222445.1.92183 WP_001222445.1.92208 WP_001222445.1.92268 WP_001222445.1.92310 WP_001222445.1.92443 WP_001222445.1.92482 WP_001222445.1.92531 WP_001222445.1.92669 WP_001222445.1.92671 WP_001222445.1.92729 WP_001222445.1.92738 WP_001222445.1.92975 WP_001222445.1.93086 WP_001222445.1.93101 WP_001222445.1.93136 WP_001222445.1.93155 WP_001222445.1.93365 WP_001222445.1.93543 WP_001222445.1.93650 WP_001222445.1.93656 WP_001222445.1.93662 WP_001222445.1.937 WP_001222445.1.93705 WP_001222445.1.93804 WP_001222445.1.9389 WP_001222445.1.93994 WP_001222445.1.94072 WP_001222445.1.94162 WP_001222445.1.94168 WP_001222445.1.94198 WP_001222445.1.9432 WP_001222445.1.94354 WP_001222445.1.94380 WP_001222445.1.94458 WP_001222445.1.94565 WP_001222445.1.94584 WP_001222445.1.94674 WP_001222445.1.94796 WP_001222445.1.94959 WP_001222445.1.95051 WP_001222445.1.95085 WP_001222445.1.95121 WP_001222445.1.95282 WP_001222445.1.95546 WP_001222445.1.95630 WP_001222445.1.95911 WP_001222445.1.96139 WP_001222445.1.96317 WP_001222445.1.96335 WP_001222445.1.96343 WP_001222445.1.9644 WP_001222445.1.96469 WP_001222445.1.96500 WP_001222445.1.96555 WP_001222445.1.96563 WP_001222445.1.96732 WP_001222445.1.96771 WP_001222445.1.97015 WP_001222445.1.97145 WP_001222445.1.97190 WP_001222445.1.97318 WP_001222445.1.97369 WP_001222445.1.97594 WP_001222445.1.97597 WP_001222445.1.97613 WP_001222445.1.97620 WP_001222445.1.97727 WP_001222445.1.97732 WP_001222445.1.97736 WP_001222445.1.9775 WP_001222445.1.97846 WP_001222445.1.98006 WP_001222445.1.98019 WP_001222445.1.98022 WP_001222445.1.98110 WP_001222445.1.98146 WP_001222445.1.98219 WP_001222445.1.9841 WP_001222445.1.98495 WP_001222445.1.98531 WP_001222445.1.98577 WP_001222445.1.98677 WP_001222445.1.98760 WP_001222445.1.98843 WP_001222445.1.98899 WP_001222445.1.99072 WP_001222445.1.99098 WP_001222445.1.99184 WP_001222445.1.99276 WP_001222445.1.99646 WP_001222445.1.99657 WP_001222445.1.99660 WP_001222445.1.99712 WP_001222445.1.99813 WP_001222445.1.99858 WP_001222445.1.99889 WP_001222445.1.99958 99287.STM0596 gi|525838977|ref|YP_008256165.1| gi|525948041|ref|YP_008309555.1| gi|550900029|ref|YP_008669121.1| gi|378987995|ref|YP_005251159.1| gi|16763973|ref|NP_459588.1| ABAO01000003|CDS_156466-158076 AE006468|CDS_657440-659050 CP001363|CDS_658134-659744 FN424405|CDS_696250-697860 gi|378444090|ref|YP_005231722.1| gi|526219468|ref|YP_008264845.1| gi|482904818|ref|YP_007903378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]