SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449300|ref|YP_005236659.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449300|ref|YP_005236659.1|
Domain Number 1 Region: 56-211
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-36
Family Retroviral integrase, catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378449300|ref|YP_005236659.1|
Sequence length 227
Comment putative integrase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MQADKTLNIGRDRLFNLLGEYRLLVPVKRAYHKTTNSHHRFYRHPNLLKPGPEQVTALEP
EQVWVADITYLPLRSGTACLSLVTDACSRKIVGYHVGENLQTENVVKAFRQALRRRKTTG
PLVHHSDRGLQYCSVLYQSVHERNGITCSMTDGYDCYQNALAERINGILKNEFLLSRPAD
LEQAREIVKESVAIYNHERPHLALKYKTPDDVHQAFYRQKTVNLYQD
Download sequence
Identical sequences A0A0D6GSL0 A0A0F6AZ89 A0A0F7J4V0 A0A0H3N9L0 A0A0U1J576 A0A0W3RIF3 A0A2D3API6 A0A2K2ZSW0 E8XCQ5 G5S9I5 Q8ZQE2
gi|378444385|ref|YP_005232017.1| gi|378698844|ref|YP_005180801.1| gi|525838732|ref|YP_008255858.1| ABAM02000001|CDS_1481991-1481308 ABAO01000011|CDS_119976-119293 ABFG01000002|CDS_400898-400215 ABFG01000021|CDS_16949-16266 AE006468|CDS_1026770-1026087 CP000886|CDS_1062721-1063404 CP000886|CDS_1377205-1377888 CP001363|CDS_985099-984416 FN424405|CDS_1022678-1021995 272994.SPAB_01196 272994.SPAB_01619 99287.STM0947 gi|379700115|ref|YP_005241843.1| gi|549723593|ref|YP_008643783.1| gi|383495690|ref|YP_005396379.1| gi|16764309|ref|NP_459924.1| gi|378988294|ref|YP_005251458.1| gi|526219712|ref|YP_008265148.1| gi|482904510|ref|YP_007903070.1| gi|161613479|ref|YP_001587444.1| gi|161613882|ref|YP_001587847.1| gi|550900323|ref|YP_008669415.1| gi|378983509|ref|YP_005246664.1| gi|378449300|ref|YP_005236659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]