SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449406|ref|YP_005236765.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449406|ref|YP_005236765.1|
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Phage tail proteins 4.08e-33
Family gpFII-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449406|ref|YP_005236765.1|
Sequence length 99
Comment ATP-binding sugar transporter-like protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAELGPVEGNGKNVVVFSGNVI
PRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEENNGGKGA
Download sequence
Identical sequences A0A0F6AZJ5 A0A0G2NLK4 A0A0H3BMM3 A0A0H3NAB9 A0A0M0Q3M2 A0A0R9NQY2 A0A249V007 A0A265B8Q6 A0A2D0ML47 A0A2D3ANB7 A0A2H9Y9S6 A0A2J0RMI6 B5R8Q9 E8XDI9 M7R8X1 Q8ZQ92
gi|169257304|ref|YP_001700680.1| gi|194442487|ref|YP_002040237.1| gi|198245904|ref|YP_002215246.1| gi|529222260|ref|YP_008381035.1| gi|409249746|ref|YP_006885565.1| gi|549723677|ref|YP_008643867.1| gi|550900411|ref|YP_008669503.1| NP_460010.1.58477 WP_000774239.1.100010 WP_000774239.1.100017 WP_000774239.1.100234 WP_000774239.1.100376 WP_000774239.1.100424 WP_000774239.1.100436 WP_000774239.1.100484 WP_000774239.1.100488 WP_000774239.1.100502 WP_000774239.1.100541 WP_000774239.1.100597 WP_000774239.1.100711 WP_000774239.1.100730 WP_000774239.1.100793 WP_000774239.1.100871 WP_000774239.1.101007 WP_000774239.1.101042 WP_000774239.1.101074 WP_000774239.1.101126 WP_000774239.1.101180 WP_000774239.1.101259 WP_000774239.1.101284 WP_000774239.1.101291 WP_000774239.1.1013 WP_000774239.1.101353 WP_000774239.1.101404 WP_000774239.1.101420 WP_000774239.1.101454 WP_000774239.1.101589 WP_000774239.1.101636 WP_000774239.1.101707 WP_000774239.1.101878 WP_000774239.1.101927 WP_000774239.1.101953 WP_000774239.1.101975 WP_000774239.1.10220 WP_000774239.1.10231 WP_000774239.1.10266 WP_000774239.1.10439 WP_000774239.1.10566 WP_000774239.1.10675 WP_000774239.1.10711 WP_000774239.1.10753 WP_000774239.1.10992 WP_000774239.1.11031 WP_000774239.1.11098 WP_000774239.1.1110 WP_000774239.1.11156 WP_000774239.1.11295 WP_000774239.1.11458 WP_000774239.1.11518 WP_000774239.1.11532 WP_000774239.1.11543 WP_000774239.1.11588 WP_000774239.1.11677 WP_000774239.1.11687 WP_000774239.1.11735 WP_000774239.1.11763 WP_000774239.1.11772 WP_000774239.1.11834 WP_000774239.1.11964 WP_000774239.1.12017 WP_000774239.1.12114 WP_000774239.1.12280 WP_000774239.1.12351 WP_000774239.1.12370 WP_000774239.1.1239 WP_000774239.1.12546 WP_000774239.1.12701 WP_000774239.1.12879 WP_000774239.1.12936 WP_000774239.1.12995 WP_000774239.1.13027 WP_000774239.1.13106 WP_000774239.1.13207 WP_000774239.1.1326 WP_000774239.1.13488 WP_000774239.1.13509 WP_000774239.1.13661 WP_000774239.1.1387 WP_000774239.1.13908 WP_000774239.1.13932 WP_000774239.1.13968 WP_000774239.1.14001 WP_000774239.1.14050 WP_000774239.1.14056 WP_000774239.1.14111 WP_000774239.1.14151 WP_000774239.1.14239 WP_000774239.1.14320 WP_000774239.1.14379 WP_000774239.1.14410 WP_000774239.1.14436 WP_000774239.1.14458 WP_000774239.1.14524 WP_000774239.1.14554 WP_000774239.1.14618 WP_000774239.1.14725 WP_000774239.1.14852 WP_000774239.1.14876 WP_000774239.1.1489 WP_000774239.1.14932 WP_000774239.1.15055 WP_000774239.1.15214 WP_000774239.1.15223 WP_000774239.1.15226 WP_000774239.1.15316 WP_000774239.1.15369 WP_000774239.1.1540 WP_000774239.1.15468 WP_000774239.1.15483 WP_000774239.1.15508 WP_000774239.1.15625 WP_000774239.1.15627 WP_000774239.1.15637 WP_000774239.1.15708 WP_000774239.1.15784 WP_000774239.1.15862 WP_000774239.1.15910 WP_000774239.1.15986 WP_000774239.1.16004 WP_000774239.1.16047 WP_000774239.1.16103 WP_000774239.1.16233 WP_000774239.1.16244 WP_000774239.1.16284 WP_000774239.1.1635 WP_000774239.1.16361 WP_000774239.1.16468 WP_000774239.1.16525 WP_000774239.1.16551 WP_000774239.1.16650 WP_000774239.1.16686 WP_000774239.1.16691 WP_000774239.1.16735 WP_000774239.1.16786 WP_000774239.1.16858 WP_000774239.1.16873 WP_000774239.1.1689 WP_000774239.1.16896 WP_000774239.1.16903 WP_000774239.1.16941 WP_000774239.1.16965 WP_000774239.1.17093 WP_000774239.1.17096 WP_000774239.1.17285 WP_000774239.1.17307 WP_000774239.1.174 WP_000774239.1.17480 WP_000774239.1.17546 WP_000774239.1.1757 WP_000774239.1.17702 WP_000774239.1.17705 WP_000774239.1.17743 WP_000774239.1.17755 WP_000774239.1.17758 WP_000774239.1.17891 WP_000774239.1.1798 WP_000774239.1.17991 WP_000774239.1.18019 WP_000774239.1.18122 WP_000774239.1.18163 WP_000774239.1.1818 WP_000774239.1.1825 WP_000774239.1.18254 WP_000774239.1.18265 WP_000774239.1.18281 WP_000774239.1.18282 WP_000774239.1.18607 WP_000774239.1.18705 WP_000774239.1.18715 WP_000774239.1.18776 WP_000774239.1.18949 WP_000774239.1.1897 WP_000774239.1.19273 WP_000774239.1.19320 WP_000774239.1.19458 WP_000774239.1.19460 WP_000774239.1.19461 WP_000774239.1.19588 WP_000774239.1.19614 WP_000774239.1.19616 WP_000774239.1.19642 WP_000774239.1.1968 WP_000774239.1.19702 WP_000774239.1.19706 WP_000774239.1.19724 WP_000774239.1.19740 WP_000774239.1.19749 WP_000774239.1.19784 WP_000774239.1.19793 WP_000774239.1.19802 WP_000774239.1.19867 WP_000774239.1.19938 WP_000774239.1.19975 WP_000774239.1.2010 WP_000774239.1.20266 WP_000774239.1.20271 WP_000774239.1.20391 WP_000774239.1.20415 WP_000774239.1.20418 WP_000774239.1.20425 WP_000774239.1.20443 WP_000774239.1.20446 WP_000774239.1.2047 WP_000774239.1.20488 WP_000774239.1.20525 WP_000774239.1.2054 WP_000774239.1.20553 WP_000774239.1.20614 WP_000774239.1.20626 WP_000774239.1.20646 WP_000774239.1.20695 WP_000774239.1.20767 WP_000774239.1.20862 WP_000774239.1.20886 WP_000774239.1.20900 WP_000774239.1.20908 WP_000774239.1.21049 WP_000774239.1.21136 WP_000774239.1.21245 WP_000774239.1.21269 WP_000774239.1.21351 WP_000774239.1.21400 WP_000774239.1.2146 WP_000774239.1.21497 WP_000774239.1.21499 WP_000774239.1.21603 WP_000774239.1.21616 WP_000774239.1.21991 WP_000774239.1.22024 WP_000774239.1.22062 WP_000774239.1.22067 WP_000774239.1.2221 WP_000774239.1.22235 WP_000774239.1.2235 WP_000774239.1.22379 WP_000774239.1.22485 WP_000774239.1.22590 WP_000774239.1.22692 WP_000774239.1.22758 WP_000774239.1.22864 WP_000774239.1.23114 WP_000774239.1.2314 WP_000774239.1.23192 WP_000774239.1.23379 WP_000774239.1.23460 WP_000774239.1.23509 WP_000774239.1.23634 WP_000774239.1.2364 WP_000774239.1.23646 WP_000774239.1.23736 WP_000774239.1.23932 WP_000774239.1.23959 WP_000774239.1.24082 WP_000774239.1.24308 WP_000774239.1.24476 WP_000774239.1.24578 WP_000774239.1.24779 WP_000774239.1.24803 WP_000774239.1.24995 WP_000774239.1.25008 WP_000774239.1.25119 WP_000774239.1.25405 WP_000774239.1.25421 WP_000774239.1.25454 WP_000774239.1.25564 WP_000774239.1.25668 WP_000774239.1.2568 WP_000774239.1.25690 WP_000774239.1.2570 WP_000774239.1.25709 WP_000774239.1.25740 WP_000774239.1.25793 WP_000774239.1.25814 WP_000774239.1.25928 WP_000774239.1.25988 WP_000774239.1.26199 WP_000774239.1.26311 WP_000774239.1.26319 WP_000774239.1.26426 WP_000774239.1.26429 WP_000774239.1.26440 WP_000774239.1.26493 WP_000774239.1.26532 WP_000774239.1.26551 WP_000774239.1.26567 WP_000774239.1.26587 WP_000774239.1.26741 WP_000774239.1.26856 WP_000774239.1.26882 WP_000774239.1.26919 WP_000774239.1.27010 WP_000774239.1.27072 WP_000774239.1.27084 WP_000774239.1.27173 WP_000774239.1.27206 WP_000774239.1.27223 WP_000774239.1.27423 WP_000774239.1.27544 WP_000774239.1.27561 WP_000774239.1.2763 WP_000774239.1.27755 WP_000774239.1.27761 WP_000774239.1.2777 WP_000774239.1.27977 WP_000774239.1.28032 WP_000774239.1.28094 WP_000774239.1.28170 WP_000774239.1.2835 WP_000774239.1.28514 WP_000774239.1.28575 WP_000774239.1.28612 WP_000774239.1.28625 WP_000774239.1.28655 WP_000774239.1.28694 WP_000774239.1.28733 WP_000774239.1.2879 WP_000774239.1.2890 WP_000774239.1.28938 WP_000774239.1.28946 WP_000774239.1.28948 WP_000774239.1.29010 WP_000774239.1.2910 WP_000774239.1.29113 WP_000774239.1.29274 WP_000774239.1.29349 WP_000774239.1.29509 WP_000774239.1.29606 WP_000774239.1.29615 WP_000774239.1.29619 WP_000774239.1.29711 WP_000774239.1.29827 WP_000774239.1.29969 WP_000774239.1.29990 WP_000774239.1.30022 WP_000774239.1.30027 WP_000774239.1.30180 WP_000774239.1.30202 WP_000774239.1.30505 WP_000774239.1.30507 WP_000774239.1.30547 WP_000774239.1.30619 WP_000774239.1.3067 WP_000774239.1.3068 WP_000774239.1.30794 WP_000774239.1.30833 WP_000774239.1.30835 WP_000774239.1.30909 WP_000774239.1.30972 WP_000774239.1.31 WP_000774239.1.31092 WP_000774239.1.31122 WP_000774239.1.3113 WP_000774239.1.3114 WP_000774239.1.3119 WP_000774239.1.31190 WP_000774239.1.31195 WP_000774239.1.31196 WP_000774239.1.31210 WP_000774239.1.31362 WP_000774239.1.31451 WP_000774239.1.31476 WP_000774239.1.31504 WP_000774239.1.31578 WP_000774239.1.31658 WP_000774239.1.31665 WP_000774239.1.31940 WP_000774239.1.31967 WP_000774239.1.31972 WP_000774239.1.31983 WP_000774239.1.32192 WP_000774239.1.32206 WP_000774239.1.32255 WP_000774239.1.32260 WP_000774239.1.32438 WP_000774239.1.32491 WP_000774239.1.32515 WP_000774239.1.32527 WP_000774239.1.32702 WP_000774239.1.33030 WP_000774239.1.33106 WP_000774239.1.33127 WP_000774239.1.33143 WP_000774239.1.33248 WP_000774239.1.33261 WP_000774239.1.333 WP_000774239.1.33492 WP_000774239.1.33553 WP_000774239.1.33580 WP_000774239.1.33592 WP_000774239.1.33865 WP_000774239.1.33894 WP_000774239.1.3394 WP_000774239.1.33986 WP_000774239.1.34 WP_000774239.1.34043 WP_000774239.1.34075 WP_000774239.1.34257 WP_000774239.1.34279 WP_000774239.1.34319 WP_000774239.1.34417 WP_000774239.1.34458 WP_000774239.1.34684 WP_000774239.1.34854 WP_000774239.1.34972 WP_000774239.1.34975 WP_000774239.1.35045 WP_000774239.1.35129 WP_000774239.1.35184 WP_000774239.1.35193 WP_000774239.1.35219 WP_000774239.1.35332 WP_000774239.1.35404 WP_000774239.1.35408 WP_000774239.1.35425 WP_000774239.1.35446 WP_000774239.1.35463 WP_000774239.1.35503 WP_000774239.1.35509 WP_000774239.1.35590 WP_000774239.1.35619 WP_000774239.1.3572 WP_000774239.1.35892 WP_000774239.1.35940 WP_000774239.1.36003 WP_000774239.1.3601 WP_000774239.1.36011 WP_000774239.1.36017 WP_000774239.1.36157 WP_000774239.1.36547 WP_000774239.1.3670 WP_000774239.1.36705 WP_000774239.1.36931 WP_000774239.1.37073 WP_000774239.1.37111 WP_000774239.1.37112 WP_000774239.1.37256 WP_000774239.1.3726 WP_000774239.1.37293 WP_000774239.1.37370 WP_000774239.1.3744 WP_000774239.1.37478 WP_000774239.1.37498 WP_000774239.1.37521 WP_000774239.1.37558 WP_000774239.1.37618 WP_000774239.1.37968 WP_000774239.1.37978 WP_000774239.1.38199 WP_000774239.1.383 WP_000774239.1.38393 WP_000774239.1.3848 WP_000774239.1.38569 WP_000774239.1.38673 WP_000774239.1.38693 WP_000774239.1.38781 WP_000774239.1.39136 WP_000774239.1.39197 WP_000774239.1.39229 WP_000774239.1.39265 WP_000774239.1.39405 WP_000774239.1.39414 WP_000774239.1.39420 WP_000774239.1.39512 WP_000774239.1.39584 WP_000774239.1.39609 WP_000774239.1.39614 WP_000774239.1.39629 WP_000774239.1.39632 WP_000774239.1.39724 WP_000774239.1.39763 WP_000774239.1.39862 WP_000774239.1.39921 WP_000774239.1.39923 WP_000774239.1.40017 WP_000774239.1.40072 WP_000774239.1.40073 WP_000774239.1.4011 WP_000774239.1.40158 WP_000774239.1.40208 WP_000774239.1.40229 WP_000774239.1.40240 WP_000774239.1.40257 WP_000774239.1.40258 WP_000774239.1.40284 WP_000774239.1.40292 WP_000774239.1.40341 WP_000774239.1.40395 WP_000774239.1.40465 WP_000774239.1.40528 WP_000774239.1.40710 WP_000774239.1.4075 WP_000774239.1.4087 WP_000774239.1.40877 WP_000774239.1.40996 WP_000774239.1.41017 WP_000774239.1.41018 WP_000774239.1.41086 WP_000774239.1.41091 WP_000774239.1.41279 WP_000774239.1.4141 WP_000774239.1.41434 WP_000774239.1.41440 WP_000774239.1.41516 WP_000774239.1.41554 WP_000774239.1.41591 WP_000774239.1.41761 WP_000774239.1.41802 WP_000774239.1.41877 WP_000774239.1.41882 WP_000774239.1.41979 WP_000774239.1.42156 WP_000774239.1.4222 WP_000774239.1.42243 WP_000774239.1.42320 WP_000774239.1.4239 WP_000774239.1.42422 WP_000774239.1.42444 WP_000774239.1.42595 WP_000774239.1.42676 WP_000774239.1.4276 WP_000774239.1.42797 WP_000774239.1.42829 WP_000774239.1.42864 WP_000774239.1.42887 WP_000774239.1.43018 WP_000774239.1.43041 WP_000774239.1.43244 WP_000774239.1.43276 WP_000774239.1.43312 WP_000774239.1.43339 WP_000774239.1.43371 WP_000774239.1.43437 WP_000774239.1.43441 WP_000774239.1.43613 WP_000774239.1.43668 WP_000774239.1.43778 WP_000774239.1.43875 WP_000774239.1.43886 WP_000774239.1.43951 WP_000774239.1.44005 WP_000774239.1.44043 WP_000774239.1.4405 WP_000774239.1.44099 WP_000774239.1.44121 WP_000774239.1.44187 WP_000774239.1.44291 WP_000774239.1.44300 WP_000774239.1.44310 WP_000774239.1.44386 WP_000774239.1.44397 WP_000774239.1.44433 WP_000774239.1.44440 WP_000774239.1.44479 WP_000774239.1.44607 WP_000774239.1.44640 WP_000774239.1.4467 WP_000774239.1.4485 WP_000774239.1.44877 WP_000774239.1.449 WP_000774239.1.44933 WP_000774239.1.45067 WP_000774239.1.45074 WP_000774239.1.45079 WP_000774239.1.45145 WP_000774239.1.45177 WP_000774239.1.45184 WP_000774239.1.45259 WP_000774239.1.45349 WP_000774239.1.45365 WP_000774239.1.4540 WP_000774239.1.45434 WP_000774239.1.45550 WP_000774239.1.45582 WP_000774239.1.45585 WP_000774239.1.45622 WP_000774239.1.45660 WP_000774239.1.45690 WP_000774239.1.45706 WP_000774239.1.45781 WP_000774239.1.45848 WP_000774239.1.4592 WP_000774239.1.46011 WP_000774239.1.46069 WP_000774239.1.46112 WP_000774239.1.46173 WP_000774239.1.46174 WP_000774239.1.46187 WP_000774239.1.46205 WP_000774239.1.46250 WP_000774239.1.46278 WP_000774239.1.46303 WP_000774239.1.46323 WP_000774239.1.46434 WP_000774239.1.46572 WP_000774239.1.46595 WP_000774239.1.46930 WP_000774239.1.46961 WP_000774239.1.47008 WP_000774239.1.47057 WP_000774239.1.47214 WP_000774239.1.47429 WP_000774239.1.4747 WP_000774239.1.47472 WP_000774239.1.47506 WP_000774239.1.47579 WP_000774239.1.47621 WP_000774239.1.4770 WP_000774239.1.4775 WP_000774239.1.47799 WP_000774239.1.48268 WP_000774239.1.483 WP_000774239.1.48367 WP_000774239.1.48377 WP_000774239.1.48493 WP_000774239.1.48524 WP_000774239.1.4853 WP_000774239.1.48788 WP_000774239.1.48855 WP_000774239.1.48876 WP_000774239.1.48894 WP_000774239.1.48919 WP_000774239.1.49012 WP_000774239.1.49084 WP_000774239.1.49102 WP_000774239.1.49113 WP_000774239.1.49155 WP_000774239.1.49175 WP_000774239.1.49204 WP_000774239.1.49226 WP_000774239.1.49239 WP_000774239.1.49256 WP_000774239.1.49290 WP_000774239.1.49366 WP_000774239.1.49490 WP_000774239.1.49515 WP_000774239.1.49572 WP_000774239.1.4979 WP_000774239.1.49803 WP_000774239.1.49929 WP_000774239.1.49931 WP_000774239.1.50007 WP_000774239.1.50080 WP_000774239.1.50161 WP_000774239.1.50251 WP_000774239.1.50376 WP_000774239.1.50389 WP_000774239.1.50404 WP_000774239.1.50497 WP_000774239.1.50676 WP_000774239.1.50804 WP_000774239.1.50808 WP_000774239.1.5088 WP_000774239.1.50905 WP_000774239.1.50941 WP_000774239.1.50999 WP_000774239.1.51014 WP_000774239.1.51066 WP_000774239.1.51162 WP_000774239.1.51182 WP_000774239.1.51186 WP_000774239.1.51224 WP_000774239.1.51487 WP_000774239.1.51518 WP_000774239.1.51555 WP_000774239.1.51611 WP_000774239.1.51634 WP_000774239.1.51649 WP_000774239.1.51686 WP_000774239.1.51756 WP_000774239.1.51831 WP_000774239.1.51911 WP_000774239.1.51932 WP_000774239.1.51989 WP_000774239.1.52121 WP_000774239.1.52170 WP_000774239.1.52336 WP_000774239.1.52346 WP_000774239.1.52353 WP_000774239.1.52653 WP_000774239.1.52656 WP_000774239.1.52692 WP_000774239.1.52743 WP_000774239.1.52744 WP_000774239.1.52857 WP_000774239.1.52866 WP_000774239.1.52949 WP_000774239.1.52985 WP_000774239.1.53272 WP_000774239.1.53406 WP_000774239.1.53529 WP_000774239.1.53543 WP_000774239.1.53757 WP_000774239.1.53812 WP_000774239.1.53905 WP_000774239.1.54033 WP_000774239.1.54061 WP_000774239.1.54068 WP_000774239.1.54075 WP_000774239.1.54082 WP_000774239.1.54196 WP_000774239.1.54209 WP_000774239.1.54274 WP_000774239.1.54319 WP_000774239.1.54364 WP_000774239.1.54400 WP_000774239.1.54469 WP_000774239.1.54522 WP_000774239.1.54526 WP_000774239.1.5456 WP_000774239.1.54662 WP_000774239.1.54722 WP_000774239.1.54749 WP_000774239.1.54764 WP_000774239.1.54814 WP_000774239.1.54845 WP_000774239.1.54992 WP_000774239.1.55008 WP_000774239.1.55073 WP_000774239.1.55152 WP_000774239.1.5517 WP_000774239.1.5523 WP_000774239.1.5527 WP_000774239.1.55285 WP_000774239.1.55325 WP_000774239.1.55430 WP_000774239.1.55475 WP_000774239.1.55557 WP_000774239.1.5560 WP_000774239.1.55647 WP_000774239.1.55706 WP_000774239.1.55743 WP_000774239.1.55768 WP_000774239.1.55796 WP_000774239.1.55853 WP_000774239.1.55973 WP_000774239.1.56002 WP_000774239.1.56012 WP_000774239.1.56026 WP_000774239.1.56105 WP_000774239.1.56238 WP_000774239.1.56244 WP_000774239.1.56286 WP_000774239.1.56304 WP_000774239.1.56393 WP_000774239.1.56414 WP_000774239.1.56559 WP_000774239.1.56560 WP_000774239.1.56601 WP_000774239.1.56614 WP_000774239.1.56647 WP_000774239.1.56660 WP_000774239.1.56671 WP_000774239.1.56682 WP_000774239.1.56875 WP_000774239.1.56877 WP_000774239.1.56950 WP_000774239.1.57000 WP_000774239.1.57125 WP_000774239.1.57149 WP_000774239.1.57168 WP_000774239.1.57187 WP_000774239.1.57356 WP_000774239.1.57357 WP_000774239.1.57377 WP_000774239.1.57433 WP_000774239.1.57576 WP_000774239.1.57601 WP_000774239.1.57607 WP_000774239.1.57862 WP_000774239.1.57890 WP_000774239.1.57891 WP_000774239.1.58041 WP_000774239.1.58249 WP_000774239.1.58301 WP_000774239.1.58358 WP_000774239.1.58407 WP_000774239.1.58418 WP_000774239.1.58442 WP_000774239.1.58548 WP_000774239.1.5858 WP_000774239.1.58662 WP_000774239.1.58669 WP_000774239.1.58698 WP_000774239.1.58745 WP_000774239.1.58749 WP_000774239.1.58803 WP_000774239.1.5886 WP_000774239.1.59094 WP_000774239.1.59224 WP_000774239.1.59321 WP_000774239.1.59335 WP_000774239.1.59375 WP_000774239.1.59420 WP_000774239.1.59490 WP_000774239.1.59508 WP_000774239.1.59684 WP_000774239.1.59694 WP_000774239.1.59928 WP_000774239.1.60008 WP_000774239.1.60021 WP_000774239.1.60069 WP_000774239.1.60155 WP_000774239.1.60209 WP_000774239.1.60379 WP_000774239.1.60464 WP_000774239.1.60545 WP_000774239.1.60561 WP_000774239.1.60746 WP_000774239.1.60772 WP_000774239.1.60838 WP_000774239.1.60941 WP_000774239.1.61233 WP_000774239.1.6129 WP_000774239.1.61296 WP_000774239.1.61345 WP_000774239.1.61417 WP_000774239.1.61712 WP_000774239.1.61730 WP_000774239.1.61918 WP_000774239.1.61952 WP_000774239.1.62007 WP_000774239.1.62020 WP_000774239.1.62025 WP_000774239.1.6209 WP_000774239.1.62204 WP_000774239.1.62245 WP_000774239.1.62257 WP_000774239.1.62271 WP_000774239.1.62304 WP_000774239.1.62339 WP_000774239.1.62364 WP_000774239.1.62374 WP_000774239.1.62403 WP_000774239.1.6253 WP_000774239.1.62564 WP_000774239.1.62619 WP_000774239.1.62853 WP_000774239.1.62903 WP_000774239.1.62910 WP_000774239.1.62955 WP_000774239.1.63043 WP_000774239.1.63186 WP_000774239.1.63203 WP_000774239.1.63234 WP_000774239.1.63382 WP_000774239.1.63432 WP_000774239.1.63461 WP_000774239.1.63577 WP_000774239.1.63718 WP_000774239.1.63797 WP_000774239.1.63824 WP_000774239.1.63834 WP_000774239.1.63992 WP_000774239.1.64018 WP_000774239.1.64046 WP_000774239.1.64121 WP_000774239.1.6423 WP_000774239.1.64242 WP_000774239.1.64244 WP_000774239.1.64387 WP_000774239.1.64403 WP_000774239.1.64569 WP_000774239.1.64649 WP_000774239.1.64690 WP_000774239.1.64702 WP_000774239.1.64757 WP_000774239.1.64781 WP_000774239.1.64831 WP_000774239.1.64894 WP_000774239.1.65028 WP_000774239.1.65171 WP_000774239.1.65248 WP_000774239.1.65269 WP_000774239.1.6535 WP_000774239.1.65474 WP_000774239.1.65633 WP_000774239.1.6565 WP_000774239.1.65696 WP_000774239.1.65838 WP_000774239.1.65940 WP_000774239.1.65956 WP_000774239.1.66049 WP_000774239.1.66122 WP_000774239.1.66167 WP_000774239.1.66289 WP_000774239.1.6630 WP_000774239.1.66314 WP_000774239.1.66330 WP_000774239.1.66362 WP_000774239.1.6638 WP_000774239.1.66534 WP_000774239.1.66678 WP_000774239.1.66698 WP_000774239.1.6680 WP_000774239.1.66834 WP_000774239.1.66937 WP_000774239.1.66962 WP_000774239.1.67 WP_000774239.1.67037 WP_000774239.1.67100 WP_000774239.1.67181 WP_000774239.1.67184 WP_000774239.1.67235 WP_000774239.1.67347 WP_000774239.1.67374 WP_000774239.1.6739 WP_000774239.1.67465 WP_000774239.1.67552 WP_000774239.1.67803 WP_000774239.1.67827 WP_000774239.1.67829 WP_000774239.1.67905 WP_000774239.1.68073 WP_000774239.1.6809 WP_000774239.1.68201 WP_000774239.1.68206 WP_000774239.1.6827 WP_000774239.1.68401 WP_000774239.1.68477 WP_000774239.1.6849 WP_000774239.1.68547 WP_000774239.1.68589 WP_000774239.1.68655 WP_000774239.1.68778 WP_000774239.1.68787 WP_000774239.1.68928 WP_000774239.1.68975 WP_000774239.1.69001 WP_000774239.1.69006 WP_000774239.1.6904 WP_000774239.1.6913 WP_000774239.1.69146 WP_000774239.1.69151 WP_000774239.1.69255 WP_000774239.1.69288 WP_000774239.1.69359 WP_000774239.1.6954 WP_000774239.1.69644 WP_000774239.1.69704 WP_000774239.1.69758 WP_000774239.1.69785 WP_000774239.1.69808 WP_000774239.1.69848 WP_000774239.1.69975 WP_000774239.1.7010 WP_000774239.1.7014 WP_000774239.1.7016 WP_000774239.1.7021 WP_000774239.1.70241 WP_000774239.1.70269 WP_000774239.1.70303 WP_000774239.1.70326 WP_000774239.1.70485 WP_000774239.1.70523 WP_000774239.1.70547 WP_000774239.1.70643 WP_000774239.1.70683 WP_000774239.1.70922 WP_000774239.1.70929 WP_000774239.1.70948 WP_000774239.1.70959 WP_000774239.1.70977 WP_000774239.1.71023 WP_000774239.1.71116 WP_000774239.1.71146 WP_000774239.1.71188 WP_000774239.1.71202 WP_000774239.1.71248 WP_000774239.1.71306 WP_000774239.1.71337 WP_000774239.1.71363 WP_000774239.1.71378 WP_000774239.1.71401 WP_000774239.1.71418 WP_000774239.1.71481 WP_000774239.1.71600 WP_000774239.1.71636 WP_000774239.1.71702 WP_000774239.1.71750 WP_000774239.1.71798 WP_000774239.1.71845 WP_000774239.1.71908 WP_000774239.1.71952 WP_000774239.1.71973 WP_000774239.1.72105 WP_000774239.1.72182 WP_000774239.1.72188 WP_000774239.1.72203 WP_000774239.1.72376 WP_000774239.1.72403 WP_000774239.1.72470 WP_000774239.1.72594 WP_000774239.1.72625 WP_000774239.1.72642 WP_000774239.1.72975 WP_000774239.1.73125 WP_000774239.1.73144 WP_000774239.1.7315 WP_000774239.1.7334 WP_000774239.1.73377 WP_000774239.1.73461 WP_000774239.1.7356 WP_000774239.1.73617 WP_000774239.1.73753 WP_000774239.1.73758 WP_000774239.1.73764 WP_000774239.1.73794 WP_000774239.1.73847 WP_000774239.1.73924 WP_000774239.1.74029 WP_000774239.1.74181 WP_000774239.1.74191 WP_000774239.1.7433 WP_000774239.1.74379 WP_000774239.1.74410 WP_000774239.1.745 WP_000774239.1.74529 WP_000774239.1.74545 WP_000774239.1.74661 WP_000774239.1.7491 WP_000774239.1.74996 WP_000774239.1.75009 WP_000774239.1.75129 WP_000774239.1.75187 WP_000774239.1.75334 WP_000774239.1.75362 WP_000774239.1.75385 WP_000774239.1.75609 WP_000774239.1.75760 WP_000774239.1.75764 WP_000774239.1.75793 WP_000774239.1.75837 WP_000774239.1.75874 WP_000774239.1.76020 WP_000774239.1.76208 WP_000774239.1.76327 WP_000774239.1.76445 WP_000774239.1.76548 WP_000774239.1.76576 WP_000774239.1.7660 WP_000774239.1.76673 WP_000774239.1.76721 WP_000774239.1.76760 WP_000774239.1.76875 WP_000774239.1.76899 WP_000774239.1.77047 WP_000774239.1.77067 WP_000774239.1.7712 WP_000774239.1.77177 WP_000774239.1.77180 WP_000774239.1.77244 WP_000774239.1.77267 WP_000774239.1.77292 WP_000774239.1.77349 WP_000774239.1.77390 WP_000774239.1.77514 WP_000774239.1.77543 WP_000774239.1.77549 WP_000774239.1.77710 WP_000774239.1.77851 WP_000774239.1.77960 WP_000774239.1.78033 WP_000774239.1.78076 WP_000774239.1.78096 WP_000774239.1.78100 WP_000774239.1.78301 WP_000774239.1.78372 WP_000774239.1.78383 WP_000774239.1.78735 WP_000774239.1.78738 WP_000774239.1.78802 WP_000774239.1.78830 WP_000774239.1.78835 WP_000774239.1.78838 WP_000774239.1.78871 WP_000774239.1.78874 WP_000774239.1.78918 WP_000774239.1.78930 WP_000774239.1.79167 WP_000774239.1.79335 WP_000774239.1.79462 WP_000774239.1.79472 WP_000774239.1.79490 WP_000774239.1.79495 WP_000774239.1.79529 WP_000774239.1.7964 WP_000774239.1.79659 WP_000774239.1.79668 WP_000774239.1.79708 WP_000774239.1.79734 WP_000774239.1.79757 WP_000774239.1.79910 WP_000774239.1.80077 WP_000774239.1.80137 WP_000774239.1.80296 WP_000774239.1.80366 WP_000774239.1.80609 WP_000774239.1.80651 WP_000774239.1.80741 WP_000774239.1.80780 WP_000774239.1.80831 WP_000774239.1.80850 WP_000774239.1.80881 WP_000774239.1.8096 WP_000774239.1.81069 WP_000774239.1.81149 WP_000774239.1.81175 WP_000774239.1.8119 WP_000774239.1.81302 WP_000774239.1.81305 WP_000774239.1.81320 WP_000774239.1.81328 WP_000774239.1.81354 WP_000774239.1.81425 WP_000774239.1.81455 WP_000774239.1.81504 WP_000774239.1.81528 WP_000774239.1.81667 WP_000774239.1.81735 WP_000774239.1.81750 WP_000774239.1.81760 WP_000774239.1.81785 WP_000774239.1.81902 WP_000774239.1.81995 WP_000774239.1.82192 WP_000774239.1.82232 WP_000774239.1.82269 WP_000774239.1.82337 WP_000774239.1.82395 WP_000774239.1.82503 WP_000774239.1.82515 WP_000774239.1.82676 WP_000774239.1.82761 WP_000774239.1.82895 WP_000774239.1.82946 WP_000774239.1.82992 WP_000774239.1.83061 WP_000774239.1.83092 WP_000774239.1.83305 WP_000774239.1.83378 WP_000774239.1.83413 WP_000774239.1.83491 WP_000774239.1.8354 WP_000774239.1.83651 WP_000774239.1.83760 WP_000774239.1.83995 WP_000774239.1.84103 WP_000774239.1.84168 WP_000774239.1.8425 WP_000774239.1.84283 WP_000774239.1.84291 WP_000774239.1.84397 WP_000774239.1.8441 WP_000774239.1.84461 WP_000774239.1.84532 WP_000774239.1.84554 WP_000774239.1.84659 WP_000774239.1.84899 WP_000774239.1.849 WP_000774239.1.8497 WP_000774239.1.85040 WP_000774239.1.85134 WP_000774239.1.85180 WP_000774239.1.8545 WP_000774239.1.85483 WP_000774239.1.8552 WP_000774239.1.85541 WP_000774239.1.8556 WP_000774239.1.85568 WP_000774239.1.85617 WP_000774239.1.85663 WP_000774239.1.85671 WP_000774239.1.85672 WP_000774239.1.85675 WP_000774239.1.85777 WP_000774239.1.85886 WP_000774239.1.85900 WP_000774239.1.85904 WP_000774239.1.85976 WP_000774239.1.86007 WP_000774239.1.86043 WP_000774239.1.86159 WP_000774239.1.86173 WP_000774239.1.86240 WP_000774239.1.86306 WP_000774239.1.86356 WP_000774239.1.86450 WP_000774239.1.86469 WP_000774239.1.86588 WP_000774239.1.86661 WP_000774239.1.8671 WP_000774239.1.8672 WP_000774239.1.86895 WP_000774239.1.87095 WP_000774239.1.87323 WP_000774239.1.8736 WP_000774239.1.87460 WP_000774239.1.87552 WP_000774239.1.87695 WP_000774239.1.87760 WP_000774239.1.87899 WP_000774239.1.8792 WP_000774239.1.87936 WP_000774239.1.87945 WP_000774239.1.88019 WP_000774239.1.88073 WP_000774239.1.8809 WP_000774239.1.88092 WP_000774239.1.88174 WP_000774239.1.88222 WP_000774239.1.88291 WP_000774239.1.88293 WP_000774239.1.88423 WP_000774239.1.88703 WP_000774239.1.88902 WP_000774239.1.8891 WP_000774239.1.88957 WP_000774239.1.88980 WP_000774239.1.88981 WP_000774239.1.88982 WP_000774239.1.88995 WP_000774239.1.89008 WP_000774239.1.89054 WP_000774239.1.89114 WP_000774239.1.89116 WP_000774239.1.89119 WP_000774239.1.89138 WP_000774239.1.89188 WP_000774239.1.89215 WP_000774239.1.89304 WP_000774239.1.89570 WP_000774239.1.89622 WP_000774239.1.89657 WP_000774239.1.89659 WP_000774239.1.89765 WP_000774239.1.89817 WP_000774239.1.8996 WP_000774239.1.90033 WP_000774239.1.90252 WP_000774239.1.90453 WP_000774239.1.90585 WP_000774239.1.90641 WP_000774239.1.90734 WP_000774239.1.90983 WP_000774239.1.91003 WP_000774239.1.91056 WP_000774239.1.91069 WP_000774239.1.91179 WP_000774239.1.91278 WP_000774239.1.91459 WP_000774239.1.91512 WP_000774239.1.91524 WP_000774239.1.91564 WP_000774239.1.91579 WP_000774239.1.91621 WP_000774239.1.91625 WP_000774239.1.91724 WP_000774239.1.91732 WP_000774239.1.91788 WP_000774239.1.92013 WP_000774239.1.92067 WP_000774239.1.92093 WP_000774239.1.92165 WP_000774239.1.92183 WP_000774239.1.92213 WP_000774239.1.92310 WP_000774239.1.92318 WP_000774239.1.92411 WP_000774239.1.92439 WP_000774239.1.92443 WP_000774239.1.92482 WP_000774239.1.92529 WP_000774239.1.92531 WP_000774239.1.92575 WP_000774239.1.92669 WP_000774239.1.92671 WP_000774239.1.92738 WP_000774239.1.92754 WP_000774239.1.92879 WP_000774239.1.92893 WP_000774239.1.93059 WP_000774239.1.93101 WP_000774239.1.93136 WP_000774239.1.93155 WP_000774239.1.93339 WP_000774239.1.93365 WP_000774239.1.93410 WP_000774239.1.93543 WP_000774239.1.93596 WP_000774239.1.93656 WP_000774239.1.93662 WP_000774239.1.937 WP_000774239.1.93705 WP_000774239.1.93804 WP_000774239.1.9389 WP_000774239.1.93937 WP_000774239.1.93994 WP_000774239.1.94072 WP_000774239.1.94168 WP_000774239.1.94198 WP_000774239.1.94354 WP_000774239.1.94380 WP_000774239.1.94458 WP_000774239.1.94584 WP_000774239.1.94655 WP_000774239.1.94674 WP_000774239.1.94967 WP_000774239.1.94983 WP_000774239.1.95051 WP_000774239.1.95085 WP_000774239.1.95152 WP_000774239.1.9516 WP_000774239.1.95248 WP_000774239.1.95277 WP_000774239.1.95282 WP_000774239.1.95388 WP_000774239.1.95404 WP_000774239.1.95546 WP_000774239.1.95558 WP_000774239.1.95630 WP_000774239.1.95670 WP_000774239.1.95691 WP_000774239.1.95701 WP_000774239.1.95826 WP_000774239.1.95911 WP_000774239.1.95939 WP_000774239.1.96004 WP_000774239.1.96139 WP_000774239.1.96162 WP_000774239.1.96317 WP_000774239.1.96343 WP_000774239.1.96429 WP_000774239.1.9644 WP_000774239.1.96469 WP_000774239.1.96490 WP_000774239.1.96500 WP_000774239.1.96555 WP_000774239.1.96563 WP_000774239.1.96584 WP_000774239.1.9674 WP_000774239.1.96771 WP_000774239.1.96798 WP_000774239.1.96890 WP_000774239.1.97047 WP_000774239.1.97089 WP_000774239.1.97143 WP_000774239.1.97145 WP_000774239.1.97297 WP_000774239.1.97318 WP_000774239.1.97369 WP_000774239.1.97386 WP_000774239.1.97413 WP_000774239.1.97477 WP_000774239.1.97487 WP_000774239.1.97613 WP_000774239.1.97620 WP_000774239.1.97631 WP_000774239.1.97732 WP_000774239.1.97736 WP_000774239.1.9775 WP_000774239.1.97846 WP_000774239.1.97873 WP_000774239.1.9799 WP_000774239.1.98006 WP_000774239.1.98019 WP_000774239.1.98022 WP_000774239.1.98107 WP_000774239.1.98110 WP_000774239.1.98146 WP_000774239.1.98170 WP_000774239.1.98219 WP_000774239.1.9826 WP_000774239.1.9841 WP_000774239.1.98531 WP_000774239.1.98577 WP_000774239.1.98677 WP_000774239.1.98843 WP_000774239.1.99072 WP_000774239.1.99098 WP_000774239.1.99184 WP_000774239.1.99197 WP_000774239.1.99276 WP_000774239.1.99339 WP_000774239.1.99426 WP_000774239.1.99577 WP_000774239.1.99626 WP_000774239.1.99646 WP_000774239.1.99657 WP_000774239.1.99660 WP_000774239.1.99712 WP_000774239.1.99858 WP_000774239.1.99889 WP_000774239.1.99958 gi|525816925|ref|YP_008246943.1| gi|378698932|ref|YP_005180889.1| APC23283 gi|378955402|ref|YP_005212889.1| gi|386590906|ref|YP_006087306.1| gi|205352453|ref|YP_002226254.1| gi|16764395|ref|NP_460010.1| gi|378988381|ref|YP_005251545.1| gi|378449406|ref|YP_005236765.1| gi|482902848|ref|YP_007901408.1| gi|526222099|ref|YP_008265237.1| gi|525830211|ref|YP_008249620.1| ABAO01000024|CDS_32232-32531 ABEL01000010|CDS_55457-55756 AE006468|CDS_1123154-1123453 AM933173|CDS_1291263-1291562 CP001113|CDS_1083640-1083939 CP001120|CDS_1128072-1128371 CP001144|CDS_1379733-1380032 CP001363|CDS_1081513-1081812 FN424405|CDS_1119030-1119329 gi|379700203|ref|YP_005241931.1| 423368.SNSL254_A1073 439851.SeD_A1410 454169.SeHA_C1145 550538.SG1215 99287.STM1035 gi|537436970|ref|YP_008481347.1| gi|378444474|ref|YP_005232106.1| gi|378983597|ref|YP_005246752.1| gi|194450417|ref|YP_002045039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]