SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449432|ref|YP_005236791.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|378449432|ref|YP_005236791.1|
Domain Number - Region: 88-150
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0356
Family YML079-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378449432|ref|YP_005236791.1|
Sequence length 180
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MRIKPDDNWRWYYDEEHDRMMLDLANGMLFRSRFSRKMLTPDAFCPTGFCVDDAALYFSF
EEKCRDFELTKEQRAELVLNALVAIRYLKPQMPKSWHFVAHGEMWTPGTGDAASVWLSDT
AEQVNLLVVEPGENAALCLLAQPGVVIAGRTMQLGDAIKIMNDRLKPQVHCHSFSLEQAV
Download sequence
Identical sequences A0A0F5BD10 A0A0F6AZM1 A0A0F7DIA3 A0A0H2WRA0 A0A0H3NBS1 A0A0L9EK51 A0A0M0Q3Q8 A0A0M2IZB9 A0A0N1QSG0 A0A0T9XS42 A0A0U1GEB7 A0A0V2DGK6 A0A1C2ZTV3 A0A1S0ZLW8 A0A1X2T687 A0A1X2UV91 A0A1X2Y297 A0A1Z3Q2Q0 A0A221YJ96 A0A221Z1I7 A0A241SBX2 A0A265BA96 A0A267SF39 A0A271CAW9 A0A271CZC6 A0A2C6FF47 A0A2C9P1G6 A0A2D1XFL0 A0A2D1XTG5 A0A2D3ANF3 A0A2D3TXF4 A0A2G1P246 A0A2H9YAX9 A0A2I5HIE6 A0A2I6MA44 A0A2I6MMU2 A0A2I6N110 A0A2I6NF21 A0A2I6NSY4 A0A2I6P5P9 A0A2K3A9I1 B5F1U3 C0PVS4 E8XE16 G4C0G1 G5L7A4 G5LLZ8 G5MGF7 G5NB21 G5PKY0 G5Q0R4 G5QGY2 G5QY25 G5RDD7 G5RTD4 G5SA12 Q57QU3 Q8ZQ75 S5HU29 V1XKD4 V7IKE6 V7UUL2
272994.SPAB_02499 295319.SPA1791 321314.SC1012 439843.SeSA_A1121 454166.SeAg_B1017 454169.SeHA_C1168 476213.SPC_2690 554290.SSPA1664 99287.STM1059 gi|194447583|ref|YP_002045061.1| gi|525816948|ref|YP_008246966.1| gi|62179582|ref|YP_215999.1| gi|549723701|ref|YP_008643891.1| gi|386590930|ref|YP_006087330.1| gi|525857248|ref|YP_008260254.1| gi|525947720|ref|YP_008309164.1| gi|538361561|ref|YP_008504846.1| gi|409249445|ref|YP_006885271.1| gi|525827073|ref|YP_008249597.1| gi|482902873|ref|YP_007901433.1| gi|383495791|ref|YP_005396480.1| gi|409994528|ref|NP_805630.2| gi|194734123|ref|YP_002114059.1| gi|161614747|ref|YP_001588712.1| gi|378449432|ref|YP_005236791.1| APC23296 gi|378960031|ref|YP_005217517.1| gi|224584434|ref|YP_002638232.1| gi|550900440|ref|YP_008669532.1| gi|452120833|ref|YP_007471081.1| gi|525838654|ref|YP_008255743.1| gi|379700228|ref|YP_005241956.1| gi|488654379|ref|YP_007926182.1| gi|378988406|ref|YP_005251570.1| gi|378444497|ref|YP_005232129.1| gi|549478951|ref|YP_008612850.1| gi|378983622|ref|YP_005246777.1| gi|378698955|ref|YP_005180912.1| gi|197248324|ref|YP_002145929.1| gi|197362867|ref|YP_002142504.1| NP_460033.1.58477 WP_001220671.1.100002 WP_001220671.1.100007 WP_001220671.1.100008 WP_001220671.1.100010 WP_001220671.1.100031 WP_001220671.1.100036 WP_001220671.1.100079 WP_001220671.1.100115 WP_001220671.1.100129 WP_001220671.1.10013 WP_001220671.1.100137 WP_001220671.1.100165 WP_001220671.1.100196 WP_001220671.1.1002 WP_001220671.1.100234 WP_001220671.1.100258 WP_001220671.1.100266 WP_001220671.1.100284 WP_001220671.1.100288 WP_001220671.1.100313 WP_001220671.1.100314 WP_001220671.1.100321 WP_001220671.1.100354 WP_001220671.1.100376 WP_001220671.1.100413 WP_001220671.1.100421 WP_001220671.1.100424 WP_001220671.1.100432 WP_001220671.1.100436 WP_001220671.1.100438 WP_001220671.1.100446 WP_001220671.1.100450 WP_001220671.1.100472 WP_001220671.1.100484 WP_001220671.1.100488 WP_001220671.1.100521 WP_001220671.1.100584 WP_001220671.1.100589 WP_001220671.1.100592 WP_001220671.1.100597 WP_001220671.1.100610 WP_001220671.1.100642 WP_001220671.1.10065 WP_001220671.1.100650 WP_001220671.1.100707 WP_001220671.1.100714 WP_001220671.1.100721 WP_001220671.1.100730 WP_001220671.1.100732 WP_001220671.1.100733 WP_001220671.1.100739 WP_001220671.1.10074 WP_001220671.1.100750 WP_001220671.1.10076 WP_001220671.1.100764 WP_001220671.1.100773 WP_001220671.1.100781 WP_001220671.1.100790 WP_001220671.1.100793 WP_001220671.1.100799 WP_001220671.1.100814 WP_001220671.1.100865 WP_001220671.1.100869 WP_001220671.1.100870 WP_001220671.1.100871 WP_001220671.1.100882 WP_001220671.1.100886 WP_001220671.1.100932 WP_001220671.1.100941 WP_001220671.1.100944 WP_001220671.1.100948 WP_001220671.1.100953 WP_001220671.1.101007 WP_001220671.1.101011 WP_001220671.1.101020 WP_001220671.1.101042 WP_001220671.1.101074 WP_001220671.1.101078 WP_001220671.1.10108 WP_001220671.1.101091 WP_001220671.1.101094 WP_001220671.1.101111 WP_001220671.1.101123 WP_001220671.1.101126 WP_001220671.1.101147 WP_001220671.1.101180 WP_001220671.1.101185 WP_001220671.1.101199 WP_001220671.1.101223 WP_001220671.1.101226 WP_001220671.1.101239 WP_001220671.1.10124 WP_001220671.1.101259 WP_001220671.1.101271 WP_001220671.1.101284 WP_001220671.1.101291 WP_001220671.1.1013 WP_001220671.1.101312 WP_001220671.1.101320 WP_001220671.1.101322 WP_001220671.1.101353 WP_001220671.1.101374 WP_001220671.1.101386 WP_001220671.1.101404 WP_001220671.1.101420 WP_001220671.1.101425 WP_001220671.1.101454 WP_001220671.1.101473 WP_001220671.1.101519 WP_001220671.1.101520 WP_001220671.1.101589 WP_001220671.1.101609 WP_001220671.1.101612 WP_001220671.1.101616 WP_001220671.1.101636 WP_001220671.1.101639 WP_001220671.1.10164 WP_001220671.1.101666 WP_001220671.1.101707 WP_001220671.1.101724 WP_001220671.1.101734 WP_001220671.1.101740 WP_001220671.1.101741 WP_001220671.1.101744 WP_001220671.1.101759 WP_001220671.1.10177 WP_001220671.1.101776 WP_001220671.1.101815 WP_001220671.1.101839 WP_001220671.1.101841 WP_001220671.1.101868 WP_001220671.1.101878 WP_001220671.1.101890 WP_001220671.1.101904 WP_001220671.1.10191 WP_001220671.1.101941 WP_001220671.1.101949 WP_001220671.1.101953 WP_001220671.1.101975 WP_001220671.1.102009 WP_001220671.1.102050 WP_001220671.1.102087 WP_001220671.1.102103 WP_001220671.1.10220 WP_001220671.1.10231 WP_001220671.1.10237 WP_001220671.1.10266 WP_001220671.1.10276 WP_001220671.1.10293 WP_001220671.1.10310 WP_001220671.1.10338 WP_001220671.1.1038 WP_001220671.1.10394 WP_001220671.1.104 WP_001220671.1.10401 WP_001220671.1.10428 WP_001220671.1.10429 WP_001220671.1.10439 WP_001220671.1.10459 WP_001220671.1.10465 WP_001220671.1.10475 WP_001220671.1.10507 WP_001220671.1.10511 WP_001220671.1.10514 WP_001220671.1.10521 WP_001220671.1.10530 WP_001220671.1.10532 WP_001220671.1.10547 WP_001220671.1.10562 WP_001220671.1.10566 WP_001220671.1.10595 WP_001220671.1.106 WP_001220671.1.10642 WP_001220671.1.10654 WP_001220671.1.10677 WP_001220671.1.10678 WP_001220671.1.10711 WP_001220671.1.10720 WP_001220671.1.10753 WP_001220671.1.10797 WP_001220671.1.10857 WP_001220671.1.10873 WP_001220671.1.10926 WP_001220671.1.10936 WP_001220671.1.10992 WP_001220671.1.11000 WP_001220671.1.11012 WP_001220671.1.11024 WP_001220671.1.11031 WP_001220671.1.11041 WP_001220671.1.11055 WP_001220671.1.11098 WP_001220671.1.1110 WP_001220671.1.11126 WP_001220671.1.11142 WP_001220671.1.11156 WP_001220671.1.11168 WP_001220671.1.11190 WP_001220671.1.11213 WP_001220671.1.11239 WP_001220671.1.11253 WP_001220671.1.11254 WP_001220671.1.11295 WP_001220671.1.113 WP_001220671.1.11304 WP_001220671.1.11314 WP_001220671.1.1135 WP_001220671.1.11362 WP_001220671.1.11369 WP_001220671.1.1137 WP_001220671.1.11385 WP_001220671.1.1142 WP_001220671.1.11426 WP_001220671.1.11429 WP_001220671.1.11444 WP_001220671.1.11455 WP_001220671.1.11458 WP_001220671.1.11479 WP_001220671.1.11511 WP_001220671.1.11518 WP_001220671.1.11532 WP_001220671.1.11543 WP_001220671.1.11557 WP_001220671.1.11567 WP_001220671.1.11588 WP_001220671.1.11603 WP_001220671.1.11621 WP_001220671.1.11638 WP_001220671.1.11677 WP_001220671.1.11681 WP_001220671.1.11687 WP_001220671.1.11735 WP_001220671.1.11763 WP_001220671.1.11772 WP_001220671.1.11810 WP_001220671.1.11834 WP_001220671.1.11865 WP_001220671.1.11868 WP_001220671.1.11875 WP_001220671.1.11883 WP_001220671.1.11897 WP_001220671.1.11908 WP_001220671.1.11914 WP_001220671.1.11936 WP_001220671.1.11938 WP_001220671.1.11964 WP_001220671.1.12007 WP_001220671.1.12017 WP_001220671.1.12025 WP_001220671.1.12040 WP_001220671.1.12047 WP_001220671.1.12059 WP_001220671.1.12061 WP_001220671.1.12063 WP_001220671.1.1207 WP_001220671.1.12114 WP_001220671.1.12141 WP_001220671.1.12144 WP_001220671.1.12159 WP_001220671.1.12160 WP_001220671.1.12172 WP_001220671.1.12192 WP_001220671.1.12210 WP_001220671.1.1224 WP_001220671.1.12244 WP_001220671.1.12280 WP_001220671.1.12282 WP_001220671.1.12308 WP_001220671.1.12351 WP_001220671.1.12364 WP_001220671.1.12370 WP_001220671.1.12396 WP_001220671.1.12397 WP_001220671.1.12398 WP_001220671.1.12441 WP_001220671.1.12456 WP_001220671.1.1246 WP_001220671.1.12472 WP_001220671.1.12484 WP_001220671.1.1250 WP_001220671.1.12517 WP_001220671.1.12546 WP_001220671.1.12581 WP_001220671.1.12584 WP_001220671.1.12620 WP_001220671.1.1264 WP_001220671.1.12648 WP_001220671.1.12650 WP_001220671.1.12683 WP_001220671.1.12701 WP_001220671.1.12718 WP_001220671.1.12726 WP_001220671.1.12727 WP_001220671.1.12728 WP_001220671.1.12741 WP_001220671.1.12834 WP_001220671.1.12864 WP_001220671.1.12865 WP_001220671.1.12877 WP_001220671.1.12879 WP_001220671.1.12936 WP_001220671.1.1299 WP_001220671.1.12995 WP_001220671.1.13027 WP_001220671.1.13101 WP_001220671.1.13106 WP_001220671.1.13108 WP_001220671.1.13130 WP_001220671.1.13161 WP_001220671.1.13207 WP_001220671.1.1321 WP_001220671.1.13262 WP_001220671.1.13268 WP_001220671.1.13291 WP_001220671.1.133 WP_001220671.1.13311 WP_001220671.1.13314 WP_001220671.1.13334 WP_001220671.1.13338 WP_001220671.1.13342 WP_001220671.1.13352 WP_001220671.1.13406 WP_001220671.1.13414 WP_001220671.1.13429 WP_001220671.1.13440 WP_001220671.1.13443 WP_001220671.1.13446 WP_001220671.1.13476 WP_001220671.1.13488 WP_001220671.1.13509 WP_001220671.1.13543 WP_001220671.1.13599 WP_001220671.1.13602 WP_001220671.1.13661 WP_001220671.1.13669 WP_001220671.1.13677 WP_001220671.1.13686 WP_001220671.1.13691 WP_001220671.1.1372 WP_001220671.1.13732 WP_001220671.1.13741 WP_001220671.1.13750 WP_001220671.1.13764 WP_001220671.1.13799 WP_001220671.1.13812 WP_001220671.1.1382 WP_001220671.1.13827 WP_001220671.1.13829 WP_001220671.1.13848 WP_001220671.1.13857 WP_001220671.1.1387 WP_001220671.1.13908 WP_001220671.1.13932 WP_001220671.1.13967 WP_001220671.1.13968 WP_001220671.1.1397 WP_001220671.1.13972 WP_001220671.1.140 WP_001220671.1.14001 WP_001220671.1.1401 WP_001220671.1.14011 WP_001220671.1.14041 WP_001220671.1.14050 WP_001220671.1.14056 WP_001220671.1.1408 WP_001220671.1.14089 WP_001220671.1.14099 WP_001220671.1.14111 WP_001220671.1.14120 WP_001220671.1.14123 WP_001220671.1.14150 WP_001220671.1.14151 WP_001220671.1.14191 WP_001220671.1.14197 WP_001220671.1.14212 WP_001220671.1.14239 WP_001220671.1.14280 WP_001220671.1.14286 WP_001220671.1.14296 WP_001220671.1.14320 WP_001220671.1.14333 WP_001220671.1.14369 WP_001220671.1.14379 WP_001220671.1.14399 WP_001220671.1.1440 WP_001220671.1.14406 WP_001220671.1.14410 WP_001220671.1.14436 WP_001220671.1.14444 WP_001220671.1.14446 WP_001220671.1.14458 WP_001220671.1.14466 WP_001220671.1.14467 WP_001220671.1.14474 WP_001220671.1.14495 WP_001220671.1.14500 WP_001220671.1.14505 WP_001220671.1.14516 WP_001220671.1.14524 WP_001220671.1.14526 WP_001220671.1.14528 WP_001220671.1.14550 WP_001220671.1.14554 WP_001220671.1.14575 WP_001220671.1.14618 WP_001220671.1.14688 WP_001220671.1.14701 WP_001220671.1.14703 WP_001220671.1.14719 WP_001220671.1.14725 WP_001220671.1.1473 WP_001220671.1.14737 WP_001220671.1.14765 WP_001220671.1.14789 WP_001220671.1.14810 WP_001220671.1.14852 WP_001220671.1.14876 WP_001220671.1.14877 WP_001220671.1.14884 WP_001220671.1.1489 WP_001220671.1.14894 WP_001220671.1.14917 WP_001220671.1.14927 WP_001220671.1.14930 WP_001220671.1.14932 WP_001220671.1.14936 WP_001220671.1.14947 WP_001220671.1.14948 WP_001220671.1.14964 WP_001220671.1.15011 WP_001220671.1.15046 WP_001220671.1.15054 WP_001220671.1.15055 WP_001220671.1.15059 WP_001220671.1.15079 WP_001220671.1.15100 WP_001220671.1.15102 WP_001220671.1.15124 WP_001220671.1.15184 WP_001220671.1.15223 WP_001220671.1.15226 WP_001220671.1.15244 WP_001220671.1.15265 WP_001220671.1.15316 WP_001220671.1.15353 WP_001220671.1.15362 WP_001220671.1.15369 WP_001220671.1.1540 WP_001220671.1.15415 WP_001220671.1.15423 WP_001220671.1.15433 WP_001220671.1.15439 WP_001220671.1.15468 WP_001220671.1.15479 WP_001220671.1.15486 WP_001220671.1.15487 WP_001220671.1.15508 WP_001220671.1.1551 WP_001220671.1.15535 WP_001220671.1.15581 WP_001220671.1.15586 WP_001220671.1.15597 WP_001220671.1.15612 WP_001220671.1.15616 WP_001220671.1.15627 WP_001220671.1.15637 WP_001220671.1.15644 WP_001220671.1.15710 WP_001220671.1.15717 WP_001220671.1.15784 WP_001220671.1.15795 WP_001220671.1.158 WP_001220671.1.15830 WP_001220671.1.15835 WP_001220671.1.15862 WP_001220671.1.15881 WP_001220671.1.15905 WP_001220671.1.15909 WP_001220671.1.15910 WP_001220671.1.15912 WP_001220671.1.1592 WP_001220671.1.15922 WP_001220671.1.15938 WP_001220671.1.15970 WP_001220671.1.15978 WP_001220671.1.15986 WP_001220671.1.15995 WP_001220671.1.16000 WP_001220671.1.16004 WP_001220671.1.16006 WP_001220671.1.1601 WP_001220671.1.16032 WP_001220671.1.16046 WP_001220671.1.16047 WP_001220671.1.16051 WP_001220671.1.16052 WP_001220671.1.16058 WP_001220671.1.16062 WP_001220671.1.16063 WP_001220671.1.16103 WP_001220671.1.1611 WP_001220671.1.16125 WP_001220671.1.16150 WP_001220671.1.16155 WP_001220671.1.16158 WP_001220671.1.16166 WP_001220671.1.16172 WP_001220671.1.16201 WP_001220671.1.16226 WP_001220671.1.16233 WP_001220671.1.16244 WP_001220671.1.1626 WP_001220671.1.16264 WP_001220671.1.16273 WP_001220671.1.16284 WP_001220671.1.16328 WP_001220671.1.16344 WP_001220671.1.1635 WP_001220671.1.16361 WP_001220671.1.16452 WP_001220671.1.16461 WP_001220671.1.16462 WP_001220671.1.16465 WP_001220671.1.16468 WP_001220671.1.16508 WP_001220671.1.16522 WP_001220671.1.16525 WP_001220671.1.16551 WP_001220671.1.16565 WP_001220671.1.16581 WP_001220671.1.16588 WP_001220671.1.16614 WP_001220671.1.16650 WP_001220671.1.16656 WP_001220671.1.16658 WP_001220671.1.16666 WP_001220671.1.16673 WP_001220671.1.1668 WP_001220671.1.16686 WP_001220671.1.16691 WP_001220671.1.167 WP_001220671.1.16710 WP_001220671.1.16732 WP_001220671.1.16735 WP_001220671.1.16736 WP_001220671.1.1674 WP_001220671.1.16767 WP_001220671.1.16781 WP_001220671.1.16786 WP_001220671.1.16804 WP_001220671.1.16817 WP_001220671.1.16819 WP_001220671.1.16826 WP_001220671.1.16846 WP_001220671.1.16855 WP_001220671.1.16858 WP_001220671.1.16873 WP_001220671.1.16879 WP_001220671.1.1689 WP_001220671.1.16893 WP_001220671.1.16896 WP_001220671.1.16903 WP_001220671.1.16905 WP_001220671.1.16910 WP_001220671.1.16942 WP_001220671.1.16944 WP_001220671.1.16948 WP_001220671.1.16965 WP_001220671.1.16998 WP_001220671.1.1700 WP_001220671.1.17031 WP_001220671.1.17049 WP_001220671.1.17058 WP_001220671.1.17078 WP_001220671.1.17093 WP_001220671.1.17098 WP_001220671.1.17188 WP_001220671.1.17202 WP_001220671.1.17219 WP_001220671.1.1722 WP_001220671.1.17270 WP_001220671.1.17302 WP_001220671.1.17307 WP_001220671.1.17308 WP_001220671.1.17368 WP_001220671.1.1737 WP_001220671.1.17390 WP_001220671.1.174 WP_001220671.1.17405 WP_001220671.1.17406 WP_001220671.1.17439 WP_001220671.1.17480 WP_001220671.1.1749 WP_001220671.1.17504 WP_001220671.1.17513 WP_001220671.1.17543 WP_001220671.1.17546 WP_001220671.1.17560 WP_001220671.1.17563 WP_001220671.1.1757 WP_001220671.1.17578 WP_001220671.1.17622 WP_001220671.1.17629 WP_001220671.1.17659 WP_001220671.1.17667 WP_001220671.1.17686 WP_001220671.1.17693 WP_001220671.1.17702 WP_001220671.1.17703 WP_001220671.1.17705 WP_001220671.1.17741 WP_001220671.1.17743 WP_001220671.1.17747 WP_001220671.1.17755 WP_001220671.1.17758 WP_001220671.1.17840 WP_001220671.1.17865 WP_001220671.1.17891 WP_001220671.1.17901 WP_001220671.1.17919 WP_001220671.1.17949 WP_001220671.1.17956 WP_001220671.1.1798 WP_001220671.1.18005 WP_001220671.1.1801 WP_001220671.1.18019 WP_001220671.1.18021 WP_001220671.1.18022 WP_001220671.1.1807 WP_001220671.1.18089 WP_001220671.1.18099 WP_001220671.1.18103 WP_001220671.1.18111 WP_001220671.1.18122 WP_001220671.1.18124 WP_001220671.1.1814 WP_001220671.1.18144 WP_001220671.1.18163 WP_001220671.1.18173 WP_001220671.1.18177 WP_001220671.1.18178 WP_001220671.1.1818 WP_001220671.1.18192 WP_001220671.1.18249 WP_001220671.1.1825 WP_001220671.1.18254 WP_001220671.1.18265 WP_001220671.1.18267 WP_001220671.1.18270 WP_001220671.1.18277 WP_001220671.1.18280 WP_001220671.1.18281 WP_001220671.1.18282 WP_001220671.1.18328 WP_001220671.1.18355 WP_001220671.1.18358 WP_001220671.1.18365 WP_001220671.1.18370 WP_001220671.1.18406 WP_001220671.1.18426 WP_001220671.1.18445 WP_001220671.1.18468 WP_001220671.1.18474 WP_001220671.1.18483 WP_001220671.1.18485 WP_001220671.1.18489 WP_001220671.1.18513 WP_001220671.1.18607 WP_001220671.1.18610 WP_001220671.1.18678 WP_001220671.1.18688 WP_001220671.1.18692 WP_001220671.1.18705 WP_001220671.1.18715 WP_001220671.1.18722 WP_001220671.1.18766 WP_001220671.1.18776 WP_001220671.1.1880 WP_001220671.1.18822 WP_001220671.1.1885 WP_001220671.1.18860 WP_001220671.1.18881 WP_001220671.1.18895 WP_001220671.1.18919 WP_001220671.1.18922 WP_001220671.1.18940 WP_001220671.1.18949 WP_001220671.1.18959 WP_001220671.1.18972 WP_001220671.1.19001 WP_001220671.1.19006 WP_001220671.1.19030 WP_001220671.1.19038 WP_001220671.1.19044 WP_001220671.1.19053 WP_001220671.1.19055 WP_001220671.1.19064 WP_001220671.1.19084 WP_001220671.1.19163 WP_001220671.1.19174 WP_001220671.1.19187 WP_001220671.1.19228 WP_001220671.1.19240 WP_001220671.1.19273 WP_001220671.1.19288 WP_001220671.1.19291 WP_001220671.1.19300 WP_001220671.1.19320 WP_001220671.1.19340 WP_001220671.1.19357 WP_001220671.1.1939 WP_001220671.1.19405 WP_001220671.1.19422 WP_001220671.1.19454 WP_001220671.1.19456 WP_001220671.1.19458 WP_001220671.1.19460 WP_001220671.1.19461 WP_001220671.1.19469 WP_001220671.1.19496 WP_001220671.1.19535 WP_001220671.1.19538 WP_001220671.1.1954 WP_001220671.1.19588 WP_001220671.1.19589 WP_001220671.1.19614 WP_001220671.1.19616 WP_001220671.1.19642 WP_001220671.1.19660 WP_001220671.1.19663 WP_001220671.1.1968 WP_001220671.1.19683 WP_001220671.1.19686 WP_001220671.1.19702 WP_001220671.1.19706 WP_001220671.1.19723 WP_001220671.1.19724 WP_001220671.1.19731 WP_001220671.1.19740 WP_001220671.1.19749 WP_001220671.1.19784 WP_001220671.1.19793 WP_001220671.1.19794 WP_001220671.1.19802 WP_001220671.1.19809 WP_001220671.1.19823 WP_001220671.1.19851 WP_001220671.1.19863 WP_001220671.1.19867 WP_001220671.1.19882 WP_001220671.1.19884 WP_001220671.1.1990 WP_001220671.1.1992 WP_001220671.1.19967 WP_001220671.1.19970 WP_001220671.1.19975 WP_001220671.1.1998 WP_001220671.1.19999 WP_001220671.1.20 WP_001220671.1.20023 WP_001220671.1.20034 WP_001220671.1.20081 WP_001220671.1.20091 WP_001220671.1.2010 WP_001220671.1.20119 WP_001220671.1.20212 WP_001220671.1.20218 WP_001220671.1.20254 WP_001220671.1.20255 WP_001220671.1.2026 WP_001220671.1.20266 WP_001220671.1.20271 WP_001220671.1.20296 WP_001220671.1.20330 WP_001220671.1.20339 WP_001220671.1.2036 WP_001220671.1.20362 WP_001220671.1.20364 WP_001220671.1.20376 WP_001220671.1.20415 WP_001220671.1.20418 WP_001220671.1.20419 WP_001220671.1.20443 WP_001220671.1.20446 WP_001220671.1.20465 WP_001220671.1.20488 WP_001220671.1.20492 WP_001220671.1.20503 WP_001220671.1.20525 WP_001220671.1.2053 WP_001220671.1.2054 WP_001220671.1.20553 WP_001220671.1.20564 WP_001220671.1.20573 WP_001220671.1.20614 WP_001220671.1.20626 WP_001220671.1.20631 WP_001220671.1.20635 WP_001220671.1.20646 WP_001220671.1.20700 WP_001220671.1.20718 WP_001220671.1.20721 WP_001220671.1.2073 WP_001220671.1.20740 WP_001220671.1.20760 WP_001220671.1.20787 WP_001220671.1.20789 WP_001220671.1.20795 WP_001220671.1.20810 WP_001220671.1.20828 WP_001220671.1.20839 WP_001220671.1.20862 WP_001220671.1.2087 WP_001220671.1.20883 WP_001220671.1.20886 WP_001220671.1.20900 WP_001220671.1.2091 WP_001220671.1.20947 WP_001220671.1.20953 WP_001220671.1.2101 WP_001220671.1.21010 WP_001220671.1.21049 WP_001220671.1.2106 WP_001220671.1.21062 WP_001220671.1.21075 WP_001220671.1.21086 WP_001220671.1.21089 WP_001220671.1.21136 WP_001220671.1.21144 WP_001220671.1.21146 WP_001220671.1.21162 WP_001220671.1.21165 WP_001220671.1.21181 WP_001220671.1.21184 WP_001220671.1.21185 WP_001220671.1.21245 WP_001220671.1.21246 WP_001220671.1.21260 WP_001220671.1.21269 WP_001220671.1.21286 WP_001220671.1.2130 WP_001220671.1.21309 WP_001220671.1.21326 WP_001220671.1.21351 WP_001220671.1.21362 WP_001220671.1.21366 WP_001220671.1.2139 WP_001220671.1.21399 WP_001220671.1.21400 WP_001220671.1.21404 WP_001220671.1.21423 WP_001220671.1.21443 WP_001220671.1.21453 WP_001220671.1.2146 WP_001220671.1.21473 WP_001220671.1.21492 WP_001220671.1.21497 WP_001220671.1.21499 WP_001220671.1.21534 WP_001220671.1.21548 WP_001220671.1.21603 WP_001220671.1.2166 WP_001220671.1.21674 WP_001220671.1.21692 WP_001220671.1.21728 WP_001220671.1.21730 WP_001220671.1.21750 WP_001220671.1.21751 WP_001220671.1.21757 WP_001220671.1.21825 WP_001220671.1.21877 WP_001220671.1.21886 WP_001220671.1.21910 WP_001220671.1.21940 WP_001220671.1.21946 WP_001220671.1.21966 WP_001220671.1.21981 WP_001220671.1.21991 WP_001220671.1.22019 WP_001220671.1.22024 WP_001220671.1.22030 WP_001220671.1.2205 WP_001220671.1.22062 WP_001220671.1.22064 WP_001220671.1.22067 WP_001220671.1.22069 WP_001220671.1.22117 WP_001220671.1.22118 WP_001220671.1.22126 WP_001220671.1.2216 WP_001220671.1.22169 WP_001220671.1.22205 WP_001220671.1.22208 WP_001220671.1.2221 WP_001220671.1.22235 WP_001220671.1.2224 WP_001220671.1.22240 WP_001220671.1.2227 WP_001220671.1.22270 WP_001220671.1.22303 WP_001220671.1.22323 WP_001220671.1.22337 WP_001220671.1.2235 WP_001220671.1.22373 WP_001220671.1.22379 WP_001220671.1.22388 WP_001220671.1.22427 WP_001220671.1.22451 WP_001220671.1.2246 WP_001220671.1.22476 WP_001220671.1.22485 WP_001220671.1.22537 WP_001220671.1.22565 WP_001220671.1.22566 WP_001220671.1.22575 WP_001220671.1.22582 WP_001220671.1.22614 WP_001220671.1.22620 WP_001220671.1.22623 WP_001220671.1.22645 WP_001220671.1.22652 WP_001220671.1.22676 WP_001220671.1.22683 WP_001220671.1.22692 WP_001220671.1.22758 WP_001220671.1.2283 WP_001220671.1.2284 WP_001220671.1.22845 WP_001220671.1.22855 WP_001220671.1.22864 WP_001220671.1.22870 WP_001220671.1.22895 WP_001220671.1.22926 WP_001220671.1.22943 WP_001220671.1.22966 WP_001220671.1.22967 WP_001220671.1.22979 WP_001220671.1.23010 WP_001220671.1.23040 WP_001220671.1.23041 WP_001220671.1.23053 WP_001220671.1.23058 WP_001220671.1.23080 WP_001220671.1.23102 WP_001220671.1.23114 WP_001220671.1.2314 WP_001220671.1.23148 WP_001220671.1.23155 WP_001220671.1.23169 WP_001220671.1.23172 WP_001220671.1.23175 WP_001220671.1.23192 WP_001220671.1.23201 WP_001220671.1.23218 WP_001220671.1.23246 WP_001220671.1.23258 WP_001220671.1.23259 WP_001220671.1.23274 WP_001220671.1.23279 WP_001220671.1.23309 WP_001220671.1.2331 WP_001220671.1.23311 WP_001220671.1.2332 WP_001220671.1.23340 WP_001220671.1.23341 WP_001220671.1.23343 WP_001220671.1.2336 WP_001220671.1.23365 WP_001220671.1.23379 WP_001220671.1.23409 WP_001220671.1.23412 WP_001220671.1.2342 WP_001220671.1.23426 WP_001220671.1.2343 WP_001220671.1.23444 WP_001220671.1.23460 WP_001220671.1.23466 WP_001220671.1.23472 WP_001220671.1.23482 WP_001220671.1.23485 WP_001220671.1.23492 WP_001220671.1.235 WP_001220671.1.23500 WP_001220671.1.23509 WP_001220671.1.23513 WP_001220671.1.23515 WP_001220671.1.23529 WP_001220671.1.23548 WP_001220671.1.23571 WP_001220671.1.23587 WP_001220671.1.23604 WP_001220671.1.23621 WP_001220671.1.23634 WP_001220671.1.23639 WP_001220671.1.2364 WP_001220671.1.23643 WP_001220671.1.23646 WP_001220671.1.23670 WP_001220671.1.23675 WP_001220671.1.23679 WP_001220671.1.23685 WP_001220671.1.237 WP_001220671.1.23707 WP_001220671.1.23720 WP_001220671.1.23728 WP_001220671.1.2375 WP_001220671.1.23755 WP_001220671.1.2376 WP_001220671.1.23783 WP_001220671.1.23786 WP_001220671.1.23787 WP_001220671.1.2380 WP_001220671.1.23801 WP_001220671.1.23819 WP_001220671.1.23932 WP_001220671.1.24017 WP_001220671.1.24028 WP_001220671.1.24061 WP_001220671.1.24082 WP_001220671.1.24083 WP_001220671.1.24117 WP_001220671.1.24125 WP_001220671.1.24138 WP_001220671.1.2415 WP_001220671.1.24153 WP_001220671.1.24158 WP_001220671.1.24206 WP_001220671.1.24259 WP_001220671.1.24291 WP_001220671.1.24303 WP_001220671.1.24308 WP_001220671.1.24322 WP_001220671.1.24325 WP_001220671.1.24355 WP_001220671.1.24375 WP_001220671.1.24376 WP_001220671.1.24392 WP_001220671.1.24394 WP_001220671.1.24400 WP_001220671.1.24412 WP_001220671.1.24419 WP_001220671.1.24420 WP_001220671.1.24444 WP_001220671.1.24450 WP_001220671.1.24521 WP_001220671.1.24555 WP_001220671.1.24567 WP_001220671.1.24578 WP_001220671.1.24619 WP_001220671.1.24643 WP_001220671.1.2467 WP_001220671.1.24686 WP_001220671.1.24688 WP_001220671.1.24689 WP_001220671.1.24696 WP_001220671.1.24716 WP_001220671.1.24723 WP_001220671.1.24727 WP_001220671.1.24737 WP_001220671.1.24779 WP_001220671.1.2481 WP_001220671.1.24832 WP_001220671.1.24837 WP_001220671.1.24839 WP_001220671.1.24964 WP_001220671.1.24995 WP_001220671.1.25008 WP_001220671.1.25015 WP_001220671.1.25017 WP_001220671.1.25032 WP_001220671.1.25036 WP_001220671.1.25041 WP_001220671.1.25053 WP_001220671.1.25064 WP_001220671.1.25072 WP_001220671.1.25119 WP_001220671.1.25130 WP_001220671.1.25140 WP_001220671.1.25185 WP_001220671.1.25196 WP_001220671.1.25205 WP_001220671.1.25206 WP_001220671.1.25210 WP_001220671.1.25217 WP_001220671.1.25219 WP_001220671.1.25229 WP_001220671.1.2525 WP_001220671.1.25297 WP_001220671.1.25304 WP_001220671.1.25374 WP_001220671.1.25397 WP_001220671.1.25405 WP_001220671.1.25454 WP_001220671.1.25475 WP_001220671.1.25490 WP_001220671.1.25493 WP_001220671.1.25498 WP_001220671.1.25508 WP_001220671.1.25512 WP_001220671.1.25514 WP_001220671.1.2554 WP_001220671.1.25546 WP_001220671.1.25564 WP_001220671.1.25596 WP_001220671.1.25603 WP_001220671.1.25607 WP_001220671.1.2562 WP_001220671.1.25666 WP_001220671.1.25668 WP_001220671.1.25690 WP_001220671.1.25692 WP_001220671.1.2570 WP_001220671.1.25700 WP_001220671.1.25703 WP_001220671.1.25708 WP_001220671.1.25740 WP_001220671.1.25793 WP_001220671.1.25807 WP_001220671.1.25809 WP_001220671.1.2581 WP_001220671.1.25814 WP_001220671.1.25821 WP_001220671.1.25825 WP_001220671.1.25833 WP_001220671.1.25835 WP_001220671.1.25846 WP_001220671.1.25882 WP_001220671.1.25911 WP_001220671.1.25928 WP_001220671.1.25932 WP_001220671.1.25944 WP_001220671.1.25962 WP_001220671.1.25963 WP_001220671.1.25988 WP_001220671.1.26001 WP_001220671.1.26027 WP_001220671.1.26030 WP_001220671.1.26034 WP_001220671.1.26075 WP_001220671.1.26093 WP_001220671.1.26107 WP_001220671.1.26122 WP_001220671.1.26123 WP_001220671.1.26129 WP_001220671.1.2615 WP_001220671.1.26199 WP_001220671.1.26213 WP_001220671.1.26217 WP_001220671.1.26224 WP_001220671.1.26230 WP_001220671.1.26232 WP_001220671.1.26272 WP_001220671.1.26282 WP_001220671.1.26286 WP_001220671.1.26288 WP_001220671.1.26311 WP_001220671.1.26319 WP_001220671.1.2634 WP_001220671.1.26384 WP_001220671.1.26394 WP_001220671.1.26429 WP_001220671.1.26440 WP_001220671.1.26491 WP_001220671.1.26493 WP_001220671.1.26512 WP_001220671.1.2654 WP_001220671.1.26551 WP_001220671.1.26554 WP_001220671.1.26563 WP_001220671.1.26567 WP_001220671.1.26582 WP_001220671.1.2660 WP_001220671.1.26636 WP_001220671.1.2667 WP_001220671.1.26689 WP_001220671.1.26709 WP_001220671.1.26741 WP_001220671.1.26750 WP_001220671.1.26758 WP_001220671.1.26787 WP_001220671.1.2679 WP_001220671.1.26833 WP_001220671.1.26856 WP_001220671.1.26882 WP_001220671.1.26883 WP_001220671.1.26892 WP_001220671.1.26908 WP_001220671.1.26919 WP_001220671.1.2692 WP_001220671.1.26924 WP_001220671.1.26928 WP_001220671.1.26980 WP_001220671.1.270 WP_001220671.1.27008 WP_001220671.1.27010 WP_001220671.1.27027 WP_001220671.1.27051 WP_001220671.1.27055 WP_001220671.1.27070 WP_001220671.1.27072 WP_001220671.1.27077 WP_001220671.1.27084 WP_001220671.1.27086 WP_001220671.1.27087 WP_001220671.1.27111 WP_001220671.1.27115 WP_001220671.1.27122 WP_001220671.1.2713 WP_001220671.1.27142 WP_001220671.1.27169 WP_001220671.1.2717 WP_001220671.1.27173 WP_001220671.1.272 WP_001220671.1.27206 WP_001220671.1.27223 WP_001220671.1.27228 WP_001220671.1.2723 WP_001220671.1.27255 WP_001220671.1.27279 WP_001220671.1.27282 WP_001220671.1.27285 WP_001220671.1.27309 WP_001220671.1.27329 WP_001220671.1.27342 WP_001220671.1.27361 WP_001220671.1.27423 WP_001220671.1.27452 WP_001220671.1.27513 WP_001220671.1.27522 WP_001220671.1.27523 WP_001220671.1.27535 WP_001220671.1.27544 WP_001220671.1.27556 WP_001220671.1.27561 WP_001220671.1.27565 WP_001220671.1.27595 WP_001220671.1.27598 WP_001220671.1.27616 WP_001220671.1.2763 WP_001220671.1.27655 WP_001220671.1.27665 WP_001220671.1.27679 WP_001220671.1.27706 WP_001220671.1.27707 WP_001220671.1.27713 WP_001220671.1.27755 WP_001220671.1.27761 WP_001220671.1.2777 WP_001220671.1.27775 WP_001220671.1.27776 WP_001220671.1.27785 WP_001220671.1.27798 WP_001220671.1.27815 WP_001220671.1.27857 WP_001220671.1.27900 WP_001220671.1.27928 WP_001220671.1.27945 WP_001220671.1.27969 WP_001220671.1.27977 WP_001220671.1.27997 WP_001220671.1.28002 WP_001220671.1.28004 WP_001220671.1.28032 WP_001220671.1.2806 WP_001220671.1.28073 WP_001220671.1.2809 WP_001220671.1.28094 WP_001220671.1.28116 WP_001220671.1.28126 WP_001220671.1.28155 WP_001220671.1.28170 WP_001220671.1.28174 WP_001220671.1.28198 WP_001220671.1.2822 WP_001220671.1.28225 WP_001220671.1.28229 WP_001220671.1.28235 WP_001220671.1.2825 WP_001220671.1.28267 WP_001220671.1.2829 WP_001220671.1.28301 WP_001220671.1.28302 WP_001220671.1.2835 WP_001220671.1.28370 WP_001220671.1.28384 WP_001220671.1.28386 WP_001220671.1.28393 WP_001220671.1.28395 WP_001220671.1.284 WP_001220671.1.2845 WP_001220671.1.28479 WP_001220671.1.28512 WP_001220671.1.28514 WP_001220671.1.28538 WP_001220671.1.28575 WP_001220671.1.28625 WP_001220671.1.28627 WP_001220671.1.28655 WP_001220671.1.28673 WP_001220671.1.28692 WP_001220671.1.28694 WP_001220671.1.287 WP_001220671.1.2873 WP_001220671.1.28775 WP_001220671.1.28776 WP_001220671.1.2879 WP_001220671.1.28811 WP_001220671.1.2890 WP_001220671.1.28902 WP_001220671.1.28917 WP_001220671.1.28921 WP_001220671.1.28938 WP_001220671.1.28946 WP_001220671.1.28948 WP_001220671.1.28962 WP_001220671.1.28963 WP_001220671.1.28977 WP_001220671.1.29006 WP_001220671.1.29010 WP_001220671.1.29023 WP_001220671.1.29042 WP_001220671.1.2905 WP_001220671.1.2907 WP_001220671.1.29081 WP_001220671.1.29089 WP_001220671.1.29099 WP_001220671.1.2910 WP_001220671.1.29113 WP_001220671.1.29130 WP_001220671.1.29153 WP_001220671.1.29174 WP_001220671.1.29190 WP_001220671.1.29203 WP_001220671.1.29237 WP_001220671.1.29248 WP_001220671.1.29255 WP_001220671.1.29265 WP_001220671.1.29288 WP_001220671.1.29349 WP_001220671.1.29389 WP_001220671.1.29439 WP_001220671.1.29454 WP_001220671.1.2946 WP_001220671.1.29462 WP_001220671.1.29509 WP_001220671.1.29530 WP_001220671.1.29563 WP_001220671.1.29588 WP_001220671.1.29593 WP_001220671.1.29601 WP_001220671.1.29606 WP_001220671.1.29615 WP_001220671.1.29619 WP_001220671.1.29682 WP_001220671.1.29704 WP_001220671.1.29727 WP_001220671.1.29732 WP_001220671.1.29743 WP_001220671.1.29768 WP_001220671.1.29774 WP_001220671.1.29775 WP_001220671.1.29782 WP_001220671.1.29827 WP_001220671.1.29833 WP_001220671.1.2984 WP_001220671.1.29845 WP_001220671.1.29851 WP_001220671.1.29865 WP_001220671.1.29886 WP_001220671.1.29898 WP_001220671.1.29919 WP_001220671.1.29923 WP_001220671.1.29924 WP_001220671.1.2994 WP_001220671.1.29964 WP_001220671.1.29983 WP_001220671.1.29990 WP_001220671.1.30006 WP_001220671.1.30009 WP_001220671.1.30013 WP_001220671.1.30018 WP_001220671.1.3002 WP_001220671.1.30022 WP_001220671.1.30027 WP_001220671.1.30034 WP_001220671.1.30049 WP_001220671.1.30058 WP_001220671.1.30086 WP_001220671.1.30093 WP_001220671.1.3017 WP_001220671.1.30170 WP_001220671.1.30172 WP_001220671.1.30179 WP_001220671.1.30180 WP_001220671.1.30185 WP_001220671.1.30195 WP_001220671.1.30202 WP_001220671.1.30213 WP_001220671.1.30225 WP_001220671.1.30238 WP_001220671.1.30246 WP_001220671.1.30331 WP_001220671.1.30354 WP_001220671.1.30356 WP_001220671.1.30357 WP_001220671.1.30362 WP_001220671.1.30386 WP_001220671.1.30389 WP_001220671.1.3042 WP_001220671.1.30421 WP_001220671.1.30425 WP_001220671.1.30437 WP_001220671.1.30440 WP_001220671.1.30448 WP_001220671.1.30469 WP_001220671.1.30489 WP_001220671.1.30505 WP_001220671.1.30507 WP_001220671.1.30517 WP_001220671.1.30535 WP_001220671.1.30542 WP_001220671.1.30544 WP_001220671.1.30547 WP_001220671.1.30555 WP_001220671.1.30556 WP_001220671.1.30572 WP_001220671.1.30573 WP_001220671.1.30585 WP_001220671.1.30602 WP_001220671.1.30618 WP_001220671.1.30619 WP_001220671.1.30635 WP_001220671.1.3066 WP_001220671.1.30664 WP_001220671.1.3068 WP_001220671.1.30688 WP_001220671.1.30696 WP_001220671.1.3076 WP_001220671.1.30794 WP_001220671.1.3080 WP_001220671.1.30802 WP_001220671.1.30803 WP_001220671.1.30806 WP_001220671.1.30819 WP_001220671.1.30823 WP_001220671.1.30833 WP_001220671.1.30835 WP_001220671.1.3089 WP_001220671.1.30934 WP_001220671.1.3095 WP_001220671.1.30951 WP_001220671.1.30967 WP_001220671.1.30972 WP_001220671.1.31 WP_001220671.1.31001 WP_001220671.1.31011 WP_001220671.1.31042 WP_001220671.1.31046 WP_001220671.1.31066 WP_001220671.1.31069 WP_001220671.1.31078 WP_001220671.1.31086 WP_001220671.1.31092 WP_001220671.1.31107 WP_001220671.1.31111 WP_001220671.1.3113 WP_001220671.1.31139 WP_001220671.1.3114 WP_001220671.1.31145 WP_001220671.1.31155 WP_001220671.1.31156 WP_001220671.1.31171 WP_001220671.1.31182 WP_001220671.1.31185 WP_001220671.1.3119 WP_001220671.1.31190 WP_001220671.1.31195 WP_001220671.1.31196 WP_001220671.1.31198 WP_001220671.1.31205 WP_001220671.1.3121 WP_001220671.1.31214 WP_001220671.1.31219 WP_001220671.1.31222 WP_001220671.1.31223 WP_001220671.1.3124 WP_001220671.1.31240 WP_001220671.1.31251 WP_001220671.1.31262 WP_001220671.1.3127 WP_001220671.1.31281 WP_001220671.1.31303 WP_001220671.1.3131 WP_001220671.1.31352 WP_001220671.1.31362 WP_001220671.1.31389 WP_001220671.1.31413 WP_001220671.1.31446 WP_001220671.1.31451 WP_001220671.1.31504 WP_001220671.1.31515 WP_001220671.1.31533 WP_001220671.1.31546 WP_001220671.1.31578 WP_001220671.1.31658 WP_001220671.1.31665 WP_001220671.1.3170 WP_001220671.1.31720 WP_001220671.1.31725 WP_001220671.1.31762 WP_001220671.1.31782 WP_001220671.1.31799 WP_001220671.1.31836 WP_001220671.1.31845 WP_001220671.1.3185 WP_001220671.1.31854 WP_001220671.1.31927 WP_001220671.1.31940 WP_001220671.1.31951 WP_001220671.1.31952 WP_001220671.1.31967 WP_001220671.1.31972 WP_001220671.1.32006 WP_001220671.1.32038 WP_001220671.1.32041 WP_001220671.1.32042 WP_001220671.1.32054 WP_001220671.1.32056 WP_001220671.1.3207 WP_001220671.1.32170 WP_001220671.1.32189 WP_001220671.1.32192 WP_001220671.1.32202 WP_001220671.1.32204 WP_001220671.1.32206 WP_001220671.1.32260 WP_001220671.1.32263 WP_001220671.1.32275 WP_001220671.1.32277 WP_001220671.1.32293 WP_001220671.1.32299 WP_001220671.1.32357 WP_001220671.1.32368 WP_001220671.1.32408 WP_001220671.1.32422 WP_001220671.1.32424 WP_001220671.1.32425 WP_001220671.1.32434 WP_001220671.1.32438 WP_001220671.1.32458 WP_001220671.1.32459 WP_001220671.1.32460 WP_001220671.1.32491 WP_001220671.1.32493 WP_001220671.1.32515 WP_001220671.1.32527 WP_001220671.1.32529 WP_001220671.1.32545 WP_001220671.1.32563 WP_001220671.1.32578 WP_001220671.1.32617 WP_001220671.1.32624 WP_001220671.1.32629 WP_001220671.1.32643 WP_001220671.1.32660 WP_001220671.1.3270 WP_001220671.1.32702 WP_001220671.1.32714 WP_001220671.1.32725 WP_001220671.1.32747 WP_001220671.1.32750 WP_001220671.1.3278 WP_001220671.1.32786 WP_001220671.1.32804 WP_001220671.1.32838 WP_001220671.1.32848 WP_001220671.1.32860 WP_001220671.1.32868 WP_001220671.1.329 WP_001220671.1.3290 WP_001220671.1.32902 WP_001220671.1.32907 WP_001220671.1.32930 WP_001220671.1.32940 WP_001220671.1.3296 WP_001220671.1.32961 WP_001220671.1.32966 WP_001220671.1.32985 WP_001220671.1.33010 WP_001220671.1.33030 WP_001220671.1.33037 WP_001220671.1.3304 WP_001220671.1.3305 WP_001220671.1.33051 WP_001220671.1.33065 WP_001220671.1.33068 WP_001220671.1.33078 WP_001220671.1.3310 WP_001220671.1.33106 WP_001220671.1.33114 WP_001220671.1.33122 WP_001220671.1.33127 WP_001220671.1.33134 WP_001220671.1.33143 WP_001220671.1.33144 WP_001220671.1.3315 WP_001220671.1.33160 WP_001220671.1.33208 WP_001220671.1.33214 WP_001220671.1.33247 WP_001220671.1.33248 WP_001220671.1.33261 WP_001220671.1.33280 WP_001220671.1.33283 WP_001220671.1.333 WP_001220671.1.33313 WP_001220671.1.33339 WP_001220671.1.33343 WP_001220671.1.33382 WP_001220671.1.33392 WP_001220671.1.33420 WP_001220671.1.33486 WP_001220671.1.33490 WP_001220671.1.33492 WP_001220671.1.33499 WP_001220671.1.33501 WP_001220671.1.33504 WP_001220671.1.33529 WP_001220671.1.33553 WP_001220671.1.33580 WP_001220671.1.33592 WP_001220671.1.33609 WP_001220671.1.33629 WP_001220671.1.33659 WP_001220671.1.33689 WP_001220671.1.33693 WP_001220671.1.3370 WP_001220671.1.33730 WP_001220671.1.33741 WP_001220671.1.33786 WP_001220671.1.33817 WP_001220671.1.33825 WP_001220671.1.33840 WP_001220671.1.33870 WP_001220671.1.33894 WP_001220671.1.3392 WP_001220671.1.33926 WP_001220671.1.3394 WP_001220671.1.3395 WP_001220671.1.33957 WP_001220671.1.33969 WP_001220671.1.33986 WP_001220671.1.34001 WP_001220671.1.34022 WP_001220671.1.34043 WP_001220671.1.34059 WP_001220671.1.34075 WP_001220671.1.34081 WP_001220671.1.34084 WP_001220671.1.34107 WP_001220671.1.34118 WP_001220671.1.34184 WP_001220671.1.34211 WP_001220671.1.34214 WP_001220671.1.34234 WP_001220671.1.34257 WP_001220671.1.34259 WP_001220671.1.34279 WP_001220671.1.34284 WP_001220671.1.34304 WP_001220671.1.34319 WP_001220671.1.34330 WP_001220671.1.34376 WP_001220671.1.34382 WP_001220671.1.34417 WP_001220671.1.34424 WP_001220671.1.3445 WP_001220671.1.34453 WP_001220671.1.34458 WP_001220671.1.34484 WP_001220671.1.34496 WP_001220671.1.34517 WP_001220671.1.34530 WP_001220671.1.34610 WP_001220671.1.34647 WP_001220671.1.34659 WP_001220671.1.34665 WP_001220671.1.34667 WP_001220671.1.34694 WP_001220671.1.34703 WP_001220671.1.34704 WP_001220671.1.34707 WP_001220671.1.34745 WP_001220671.1.34751 WP_001220671.1.3476 WP_001220671.1.34801 WP_001220671.1.34808 WP_001220671.1.34817 WP_001220671.1.34824 WP_001220671.1.34834 WP_001220671.1.34854 WP_001220671.1.34856 WP_001220671.1.34881 WP_001220671.1.3489 WP_001220671.1.34932 WP_001220671.1.34962 WP_001220671.1.34972 WP_001220671.1.34975 WP_001220671.1.34977 WP_001220671.1.35001 WP_001220671.1.35035 WP_001220671.1.35040 WP_001220671.1.35045 WP_001220671.1.35074 WP_001220671.1.35075 WP_001220671.1.35125 WP_001220671.1.35129 WP_001220671.1.35175 WP_001220671.1.35184 WP_001220671.1.35193 WP_001220671.1.35240 WP_001220671.1.35274 WP_001220671.1.35294 WP_001220671.1.35331 WP_001220671.1.35371 WP_001220671.1.35404 WP_001220671.1.35408 WP_001220671.1.3541 WP_001220671.1.35429 WP_001220671.1.35446 WP_001220671.1.35460 WP_001220671.1.35463 WP_001220671.1.35494 WP_001220671.1.35503 WP_001220671.1.35507 WP_001220671.1.35509 WP_001220671.1.35532 WP_001220671.1.3556 WP_001220671.1.35560 WP_001220671.1.3557 WP_001220671.1.35575 WP_001220671.1.35590 WP_001220671.1.35628 WP_001220671.1.35648 WP_001220671.1.3566 WP_001220671.1.3570 WP_001220671.1.35712 WP_001220671.1.35713 WP_001220671.1.35736 WP_001220671.1.35777 WP_001220671.1.35791 WP_001220671.1.35795 WP_001220671.1.35809 WP_001220671.1.35835 WP_001220671.1.35868 WP_001220671.1.35870 WP_001220671.1.35892 WP_001220671.1.35916 WP_001220671.1.35938 WP_001220671.1.35940 WP_001220671.1.35966 WP_001220671.1.35993 WP_001220671.1.36000 WP_001220671.1.36003 WP_001220671.1.3601 WP_001220671.1.36011 WP_001220671.1.36017 WP_001220671.1.36034 WP_001220671.1.36036 WP_001220671.1.36057 WP_001220671.1.36069 WP_001220671.1.3610 WP_001220671.1.36172 WP_001220671.1.36229 WP_001220671.1.36232 WP_001220671.1.36236 WP_001220671.1.36286 WP_001220671.1.36291 WP_001220671.1.36298 WP_001220671.1.36308 WP_001220671.1.36323 WP_001220671.1.36343 WP_001220671.1.36425 WP_001220671.1.36460 WP_001220671.1.3649 WP_001220671.1.36495 WP_001220671.1.36512 WP_001220671.1.36526 WP_001220671.1.36542 WP_001220671.1.36547 WP_001220671.1.36564 WP_001220671.1.36567 WP_001220671.1.36579 WP_001220671.1.36586 WP_001220671.1.36609 WP_001220671.1.36617 WP_001220671.1.36618 WP_001220671.1.36643 WP_001220671.1.36652 WP_001220671.1.36663 WP_001220671.1.36690 WP_001220671.1.3670 WP_001220671.1.36701 WP_001220671.1.36705 WP_001220671.1.36725 WP_001220671.1.36765 WP_001220671.1.36779 WP_001220671.1.36792 WP_001220671.1.36798 WP_001220671.1.36802 WP_001220671.1.36821 WP_001220671.1.36839 WP_001220671.1.36853 WP_001220671.1.36875 WP_001220671.1.3688 WP_001220671.1.36885 WP_001220671.1.36899 WP_001220671.1.36918 WP_001220671.1.36931 WP_001220671.1.36948 WP_001220671.1.36950 WP_001220671.1.36978 WP_001220671.1.37013 WP_001220671.1.37014 WP_001220671.1.37021 WP_001220671.1.37028 WP_001220671.1.37063 WP_001220671.1.37073 WP_001220671.1.37100 WP_001220671.1.37111 WP_001220671.1.37112 WP_001220671.1.37119 WP_001220671.1.37133 WP_001220671.1.37147 WP_001220671.1.37158 WP_001220671.1.37176 WP_001220671.1.37190 WP_001220671.1.37199 WP_001220671.1.37200 WP_001220671.1.37256 WP_001220671.1.37258 WP_001220671.1.37267 WP_001220671.1.3728 WP_001220671.1.37293 WP_001220671.1.37303 WP_001220671.1.37320 WP_001220671.1.3734 WP_001220671.1.37351 WP_001220671.1.37363 WP_001220671.1.37370 WP_001220671.1.37376 WP_001220671.1.3741 WP_001220671.1.3744 WP_001220671.1.37478 WP_001220671.1.37498 WP_001220671.1.37504 WP_001220671.1.3751 WP_001220671.1.37513 WP_001220671.1.37521 WP_001220671.1.3756 WP_001220671.1.37584 WP_001220671.1.37590 WP_001220671.1.37593 WP_001220671.1.37600 WP_001220671.1.37610 WP_001220671.1.37613 WP_001220671.1.37618 WP_001220671.1.37659 WP_001220671.1.37662 WP_001220671.1.37666 WP_001220671.1.37675 WP_001220671.1.37687 WP_001220671.1.37691 WP_001220671.1.37719 WP_001220671.1.37761 WP_001220671.1.37775 WP_001220671.1.37777 WP_001220671.1.378 WP_001220671.1.37808 WP_001220671.1.37848 WP_001220671.1.379 WP_001220671.1.37911 WP_001220671.1.37941 WP_001220671.1.37965 WP_001220671.1.37968 WP_001220671.1.37978 WP_001220671.1.37985 WP_001220671.1.38001 WP_001220671.1.38026 WP_001220671.1.38055 WP_001220671.1.38061 WP_001220671.1.38064 WP_001220671.1.38108 WP_001220671.1.38113 WP_001220671.1.38125 WP_001220671.1.38145 WP_001220671.1.3816 WP_001220671.1.38207 WP_001220671.1.38261 WP_001220671.1.38266 WP_001220671.1.38273 WP_001220671.1.3828 WP_001220671.1.383 WP_001220671.1.38310 WP_001220671.1.38322 WP_001220671.1.3834 WP_001220671.1.38341 WP_001220671.1.38349 WP_001220671.1.38351 WP_001220671.1.3838 WP_001220671.1.38381 WP_001220671.1.38393 WP_001220671.1.38408 WP_001220671.1.38440 WP_001220671.1.38452 WP_001220671.1.3848 WP_001220671.1.38486 WP_001220671.1.38512 WP_001220671.1.38515 WP_001220671.1.38569 WP_001220671.1.38595 WP_001220671.1.3860 WP_001220671.1.38609 WP_001220671.1.38613 WP_001220671.1.38620 WP_001220671.1.38622 WP_001220671.1.38642 WP_001220671.1.38673 WP_001220671.1.3869 WP_001220671.1.38693 WP_001220671.1.38734 WP_001220671.1.38740 WP_001220671.1.38773 WP_001220671.1.38781 WP_001220671.1.38797 WP_001220671.1.38830 WP_001220671.1.38857 WP_001220671.1.38877 WP_001220671.1.38881 WP_001220671.1.38882 WP_001220671.1.38886 WP_001220671.1.38895 WP_001220671.1.38898 WP_001220671.1.3891 WP_001220671.1.38913 WP_001220671.1.38942 WP_001220671.1.38983 WP_001220671.1.38995 WP_001220671.1.38996 WP_001220671.1.39003 WP_001220671.1.39038 WP_001220671.1.39056 WP_001220671.1.39059 WP_001220671.1.3907 WP_001220671.1.39075 WP_001220671.1.39082 WP_001220671.1.39105 WP_001220671.1.39112 WP_001220671.1.39113 WP_001220671.1.39128 WP_001220671.1.39136 WP_001220671.1.3914 WP_001220671.1.39140 WP_001220671.1.39146 WP_001220671.1.39147 WP_001220671.1.39161 WP_001220671.1.39183 WP_001220671.1.39197 WP_001220671.1.39210 WP_001220671.1.39229 WP_001220671.1.39235 WP_001220671.1.39265 WP_001220671.1.39275 WP_001220671.1.3931 WP_001220671.1.39311 WP_001220671.1.39385 WP_001220671.1.39405 WP_001220671.1.39420 WP_001220671.1.39435 WP_001220671.1.39449 WP_001220671.1.39466 WP_001220671.1.39471 WP_001220671.1.39484 WP_001220671.1.39497 WP_001220671.1.39502 WP_001220671.1.39503 WP_001220671.1.39512 WP_001220671.1.39530 WP_001220671.1.39553 WP_001220671.1.39556 WP_001220671.1.39576 WP_001220671.1.39584 WP_001220671.1.39609 WP_001220671.1.39619 WP_001220671.1.39620 WP_001220671.1.39624 WP_001220671.1.39629 WP_001220671.1.39632 WP_001220671.1.39659 WP_001220671.1.39667 WP_001220671.1.39722 WP_001220671.1.39723 WP_001220671.1.39724 WP_001220671.1.39763 WP_001220671.1.39775 WP_001220671.1.39808 WP_001220671.1.39862 WP_001220671.1.39879 WP_001220671.1.39890 WP_001220671.1.39921 WP_001220671.1.39923 WP_001220671.1.39941 WP_001220671.1.39945 WP_001220671.1.39947 WP_001220671.1.39953 WP_001220671.1.40008 WP_001220671.1.40017 WP_001220671.1.40025 WP_001220671.1.40031 WP_001220671.1.40072 WP_001220671.1.40073 WP_001220671.1.40095 WP_001220671.1.40097 WP_001220671.1.401 WP_001220671.1.4011 WP_001220671.1.40111 WP_001220671.1.40155 WP_001220671.1.40160 WP_001220671.1.40167 WP_001220671.1.40170 WP_001220671.1.40171 WP_001220671.1.40205 WP_001220671.1.40208 WP_001220671.1.40224 WP_001220671.1.40229 WP_001220671.1.40240 WP_001220671.1.40254 WP_001220671.1.40257 WP_001220671.1.40258 WP_001220671.1.40259 WP_001220671.1.40279 WP_001220671.1.40292 WP_001220671.1.40305 WP_001220671.1.40311 WP_001220671.1.40341 WP_001220671.1.40361 WP_001220671.1.4037 WP_001220671.1.40374 WP_001220671.1.40380 WP_001220671.1.40395 WP_001220671.1.4042 WP_001220671.1.40465 WP_001220671.1.40467 WP_001220671.1.40492 WP_001220671.1.40496 WP_001220671.1.40508 WP_001220671.1.40517 WP_001220671.1.40528 WP_001220671.1.40583 WP_001220671.1.40605 WP_001220671.1.40648 WP_001220671.1.40688 WP_001220671.1.40693 WP_001220671.1.40698 WP_001220671.1.40710 WP_001220671.1.40722 WP_001220671.1.4075 WP_001220671.1.40750 WP_001220671.1.40763 WP_001220671.1.40771 WP_001220671.1.40788 WP_001220671.1.40854 WP_001220671.1.4087 WP_001220671.1.40877 WP_001220671.1.4088 WP_001220671.1.4089 WP_001220671.1.40910 WP_001220671.1.40924 WP_001220671.1.40932 WP_001220671.1.40935 WP_001220671.1.40946 WP_001220671.1.40979 WP_001220671.1.40996 WP_001220671.1.41004 WP_001220671.1.41017 WP_001220671.1.41018 WP_001220671.1.41048 WP_001220671.1.41050 WP_001220671.1.4106 WP_001220671.1.41070 WP_001220671.1.41074 WP_001220671.1.41075 WP_001220671.1.41086 WP_001220671.1.4109 WP_001220671.1.41091 WP_001220671.1.41097 WP_001220671.1.41132 WP_001220671.1.41176 WP_001220671.1.41225 WP_001220671.1.41226 WP_001220671.1.41251 WP_001220671.1.41258 WP_001220671.1.41265 WP_001220671.1.41279 WP_001220671.1.41299 WP_001220671.1.41305 WP_001220671.1.41308 WP_001220671.1.41310 WP_001220671.1.41321 WP_001220671.1.41333 WP_001220671.1.41335 WP_001220671.1.41345 WP_001220671.1.4136 WP_001220671.1.41375 WP_001220671.1.41415 WP_001220671.1.41440 WP_001220671.1.41459 WP_001220671.1.41468 WP_001220671.1.41498 WP_001220671.1.41516 WP_001220671.1.41519 WP_001220671.1.41524 WP_001220671.1.41554 WP_001220671.1.41572 WP_001220671.1.41591 WP_001220671.1.41593 WP_001220671.1.41628 WP_001220671.1.41631 WP_001220671.1.41658 WP_001220671.1.41659 WP_001220671.1.41662 WP_001220671.1.41708 WP_001220671.1.41716 WP_001220671.1.41724 WP_001220671.1.41735 WP_001220671.1.41746 WP_001220671.1.41761 WP_001220671.1.4178 WP_001220671.1.41789 WP_001220671.1.41824 WP_001220671.1.41825 WP_001220671.1.41836 WP_001220671.1.4184 WP_001220671.1.41859 WP_001220671.1.41862 WP_001220671.1.41877 WP_001220671.1.41882 WP_001220671.1.41894 WP_001220671.1.41897 WP_001220671.1.41904 WP_001220671.1.41919 WP_001220671.1.41929 WP_001220671.1.41931 WP_001220671.1.41938 WP_001220671.1.4194 WP_001220671.1.41979 WP_001220671.1.41985 WP_001220671.1.41994 WP_001220671.1.41998 WP_001220671.1.42009 WP_001220671.1.42069 WP_001220671.1.42081 WP_001220671.1.42090 WP_001220671.1.42098 WP_001220671.1.42104 WP_001220671.1.42109 WP_001220671.1.42111 WP_001220671.1.42156 WP_001220671.1.42187 WP_001220671.1.42200 WP_001220671.1.42219 WP_001220671.1.4222 WP_001220671.1.42238 WP_001220671.1.42243 WP_001220671.1.42244 WP_001220671.1.42248 WP_001220671.1.42257 WP_001220671.1.42261 WP_001220671.1.42262 WP_001220671.1.42276 WP_001220671.1.4229 WP_001220671.1.42320 WP_001220671.1.42328 WP_001220671.1.42342 WP_001220671.1.42349 WP_001220671.1.42356 WP_001220671.1.42364 WP_001220671.1.42371 WP_001220671.1.42372 WP_001220671.1.42379 WP_001220671.1.4239 WP_001220671.1.42391 WP_001220671.1.42394 WP_001220671.1.42399 WP_001220671.1.42404 WP_001220671.1.42422 WP_001220671.1.42433 WP_001220671.1.42444 WP_001220671.1.42453 WP_001220671.1.42489 WP_001220671.1.42491 WP_001220671.1.42539 WP_001220671.1.4254 WP_001220671.1.4257 WP_001220671.1.42603 WP_001220671.1.42605 WP_001220671.1.42650 WP_001220671.1.42655 WP_001220671.1.4267 WP_001220671.1.42676 WP_001220671.1.42685 WP_001220671.1.42701 WP_001220671.1.42707 WP_001220671.1.4276 WP_001220671.1.42767 WP_001220671.1.42794 WP_001220671.1.42805 WP_001220671.1.42815 WP_001220671.1.42859 WP_001220671.1.42861 WP_001220671.1.42864 WP_001220671.1.4288 WP_001220671.1.4289 WP_001220671.1.42923 WP_001220671.1.42957 WP_001220671.1.42978 WP_001220671.1.4298 WP_001220671.1.42981 WP_001220671.1.43008 WP_001220671.1.43016 WP_001220671.1.43018 WP_001220671.1.43019 WP_001220671.1.43041 WP_001220671.1.43065 WP_001220671.1.43068 WP_001220671.1.43069 WP_001220671.1.43070 WP_001220671.1.43077 WP_001220671.1.43086 WP_001220671.1.43089 WP_001220671.1.43126 WP_001220671.1.43128 WP_001220671.1.43141 WP_001220671.1.43149 WP_001220671.1.43157 WP_001220671.1.43160 WP_001220671.1.43161 WP_001220671.1.43190 WP_001220671.1.43198 WP_001220671.1.43244 WP_001220671.1.43258 WP_001220671.1.4326 WP_001220671.1.43272 WP_001220671.1.43276 WP_001220671.1.43290 WP_001220671.1.43292 WP_001220671.1.43299 WP_001220671.1.43307 WP_001220671.1.43312 WP_001220671.1.4332 WP_001220671.1.43334 WP_001220671.1.43339 WP_001220671.1.43351 WP_001220671.1.43371 WP_001220671.1.43437 WP_001220671.1.43438 WP_001220671.1.43441 WP_001220671.1.43476 WP_001220671.1.43508 WP_001220671.1.43513 WP_001220671.1.43520 WP_001220671.1.43522 WP_001220671.1.43528 WP_001220671.1.43535 WP_001220671.1.43606 WP_001220671.1.43613 WP_001220671.1.43633 WP_001220671.1.43637 WP_001220671.1.43651 WP_001220671.1.43654 WP_001220671.1.43668 WP_001220671.1.43676 WP_001220671.1.43710 WP_001220671.1.43722 WP_001220671.1.4373 WP_001220671.1.43763 WP_001220671.1.43778 WP_001220671.1.43782 WP_001220671.1.43801 WP_001220671.1.43812 WP_001220671.1.43828 WP_001220671.1.43839 WP_001220671.1.43864 WP_001220671.1.43873 WP_001220671.1.43878 WP_001220671.1.43886 WP_001220671.1.43888 WP_001220671.1.43919 WP_001220671.1.43951 WP_001220671.1.43954 WP_001220671.1.43974 WP_001220671.1.4404 WP_001220671.1.44043 WP_001220671.1.44049 WP_001220671.1.44063 WP_001220671.1.44099 WP_001220671.1.44101 WP_001220671.1.44113 WP_001220671.1.44121 WP_001220671.1.44132 WP_001220671.1.44144 WP_001220671.1.44160 WP_001220671.1.44180 WP_001220671.1.44191 WP_001220671.1.44196 WP_001220671.1.44208 WP_001220671.1.4422 WP_001220671.1.4423 WP_001220671.1.44248 WP_001220671.1.44250 WP_001220671.1.44262 WP_001220671.1.44268 WP_001220671.1.4427 WP_001220671.1.44291 WP_001220671.1.44296 WP_001220671.1.44300 WP_001220671.1.44310 WP_001220671.1.44339 WP_001220671.1.44343 WP_001220671.1.44351 WP_001220671.1.44359 WP_001220671.1.44360 WP_001220671.1.44380 WP_001220671.1.44386 WP_001220671.1.4440 WP_001220671.1.44416 WP_001220671.1.44431 WP_001220671.1.44433 WP_001220671.1.44437 WP_001220671.1.44438 WP_001220671.1.44443 WP_001220671.1.44453 WP_001220671.1.44479 WP_001220671.1.44546 WP_001220671.1.44549 WP_001220671.1.44578 WP_001220671.1.44593 WP_001220671.1.44606 WP_001220671.1.44607 WP_001220671.1.44633 WP_001220671.1.44636 WP_001220671.1.44640 WP_001220671.1.4467 WP_001220671.1.44678 WP_001220671.1.4468 WP_001220671.1.44687 WP_001220671.1.44702 WP_001220671.1.44747 WP_001220671.1.44762 WP_001220671.1.44781 WP_001220671.1.44791 WP_001220671.1.44795 WP_001220671.1.44815 WP_001220671.1.44828 WP_001220671.1.44833 WP_001220671.1.4485 WP_001220671.1.44877 WP_001220671.1.44879 WP_001220671.1.44887 WP_001220671.1.44917 WP_001220671.1.44927 WP_001220671.1.44933 WP_001220671.1.44943 WP_001220671.1.44950 WP_001220671.1.44971 WP_001220671.1.44985 WP_001220671.1.44996 WP_001220671.1.44998 WP_001220671.1.4501 WP_001220671.1.45027 WP_001220671.1.45038 WP_001220671.1.45045 WP_001220671.1.4505 WP_001220671.1.45067 WP_001220671.1.45072 WP_001220671.1.45074 WP_001220671.1.45079 WP_001220671.1.45093 WP_001220671.1.45098 WP_001220671.1.45123 WP_001220671.1.45134 WP_001220671.1.45136 WP_001220671.1.45138 WP_001220671.1.45145 WP_001220671.1.45154 WP_001220671.1.45177 WP_001220671.1.45184 WP_001220671.1.45229 WP_001220671.1.45241 WP_001220671.1.45251 WP_001220671.1.45259 WP_001220671.1.45268 WP_001220671.1.45322 WP_001220671.1.45344 WP_001220671.1.45349 WP_001220671.1.45365 WP_001220671.1.4540 WP_001220671.1.45402 WP_001220671.1.45434 WP_001220671.1.45435 WP_001220671.1.45462 WP_001220671.1.45468 WP_001220671.1.45522 WP_001220671.1.45523 WP_001220671.1.45535 WP_001220671.1.45544 WP_001220671.1.45550 WP_001220671.1.45566 WP_001220671.1.45582 WP_001220671.1.45585 WP_001220671.1.45596 WP_001220671.1.45622 WP_001220671.1.45648 WP_001220671.1.45660 WP_001220671.1.45690 WP_001220671.1.45781 WP_001220671.1.45797 WP_001220671.1.458 WP_001220671.1.45829 WP_001220671.1.45871 WP_001220671.1.45943 WP_001220671.1.45984 WP_001220671.1.46011 WP_001220671.1.46028 WP_001220671.1.46030 WP_001220671.1.46069 WP_001220671.1.46077 WP_001220671.1.46091 WP_001220671.1.46112 WP_001220671.1.46124 WP_001220671.1.46169 WP_001220671.1.46173 WP_001220671.1.46174 WP_001220671.1.46187 WP_001220671.1.46203 WP_001220671.1.46205 WP_001220671.1.46225 WP_001220671.1.46232 WP_001220671.1.46241 WP_001220671.1.46243 WP_001220671.1.46278 WP_001220671.1.46286 WP_001220671.1.46299 WP_001220671.1.46303 WP_001220671.1.46307 WP_001220671.1.46322 WP_001220671.1.46323 WP_001220671.1.46345 WP_001220671.1.46355 WP_001220671.1.46358 WP_001220671.1.464 WP_001220671.1.46406 WP_001220671.1.46434 WP_001220671.1.46444 WP_001220671.1.46454 WP_001220671.1.46461 WP_001220671.1.46499 WP_001220671.1.46504 WP_001220671.1.46505 WP_001220671.1.46551 WP_001220671.1.46559 WP_001220671.1.46572 WP_001220671.1.46574 WP_001220671.1.46595 WP_001220671.1.46620 WP_001220671.1.46637 WP_001220671.1.46666 WP_001220671.1.46675 WP_001220671.1.46689 WP_001220671.1.46693 WP_001220671.1.46701 WP_001220671.1.4671 WP_001220671.1.46732 WP_001220671.1.46749 WP_001220671.1.46781 WP_001220671.1.46803 WP_001220671.1.46816 WP_001220671.1.46842 WP_001220671.1.4690 WP_001220671.1.46920 WP_001220671.1.46930 WP_001220671.1.46945 WP_001220671.1.46975 WP_001220671.1.47005 WP_001220671.1.47008 WP_001220671.1.47014 WP_001220671.1.47023 WP_001220671.1.47036 WP_001220671.1.47037 WP_001220671.1.47042 WP_001220671.1.47057 WP_001220671.1.47058 WP_001220671.1.47059 WP_001220671.1.47061 WP_001220671.1.47067 WP_001220671.1.47085 WP_001220671.1.47123 WP_001220671.1.47214 WP_001220671.1.47215 WP_001220671.1.47243 WP_001220671.1.47245 WP_001220671.1.47257 WP_001220671.1.47389 WP_001220671.1.47429 WP_001220671.1.47442 WP_001220671.1.47448 WP_001220671.1.47460 WP_001220671.1.4747 WP_001220671.1.47472 WP_001220671.1.47478 WP_001220671.1.47482 WP_001220671.1.47492 WP_001220671.1.47506 WP_001220671.1.47523 WP_001220671.1.47531 WP_001220671.1.47532 WP_001220671.1.47542 WP_001220671.1.47579 WP_001220671.1.47587 WP_001220671.1.47605 WP_001220671.1.47614 WP_001220671.1.47621 WP_001220671.1.47630 WP_001220671.1.47649 WP_001220671.1.47660 WP_001220671.1.4769 WP_001220671.1.4770 WP_001220671.1.47714 WP_001220671.1.4774 WP_001220671.1.4775 WP_001220671.1.47756 WP_001220671.1.47767 WP_001220671.1.47799 WP_001220671.1.4781 WP_001220671.1.47814 WP_001220671.1.47817 WP_001220671.1.47849 WP_001220671.1.47886 WP_001220671.1.47898 WP_001220671.1.47928 WP_001220671.1.47992 WP_001220671.1.48019 WP_001220671.1.48033 WP_001220671.1.48100 WP_001220671.1.48114 WP_001220671.1.48124 WP_001220671.1.48132 WP_001220671.1.48134 WP_001220671.1.48139 WP_001220671.1.48190 WP_001220671.1.48209 WP_001220671.1.48215 WP_001220671.1.48218 WP_001220671.1.48242 WP_001220671.1.48247 WP_001220671.1.48253 WP_001220671.1.48262 WP_001220671.1.48292 WP_001220671.1.483 WP_001220671.1.48324 WP_001220671.1.48342 WP_001220671.1.48367 WP_001220671.1.48377 WP_001220671.1.48399 WP_001220671.1.48426 WP_001220671.1.48430 WP_001220671.1.48436 WP_001220671.1.48455 WP_001220671.1.48493 WP_001220671.1.48510 WP_001220671.1.4853 WP_001220671.1.48570 WP_001220671.1.48586 WP_001220671.1.4859 WP_001220671.1.48591 WP_001220671.1.48610 WP_001220671.1.48631 WP_001220671.1.48647 WP_001220671.1.48651 WP_001220671.1.48663 WP_001220671.1.48690 WP_001220671.1.48734 WP_001220671.1.48751 WP_001220671.1.48755 WP_001220671.1.48756 WP_001220671.1.48768 WP_001220671.1.48774 WP_001220671.1.48778 WP_001220671.1.48788 WP_001220671.1.48841 WP_001220671.1.48849 WP_001220671.1.4885 WP_001220671.1.48855 WP_001220671.1.48876 WP_001220671.1.48886 WP_001220671.1.48894 WP_001220671.1.48896 WP_001220671.1.48908 WP_001220671.1.48918 WP_001220671.1.48919 WP_001220671.1.48931 WP_001220671.1.48955 WP_001220671.1.48963 WP_001220671.1.48973 WP_001220671.1.48985 WP_001220671.1.49004 WP_001220671.1.49005 WP_001220671.1.49012 WP_001220671.1.49084 WP_001220671.1.49090 WP_001220671.1.49106 WP_001220671.1.49113 WP_001220671.1.49117 WP_001220671.1.49121 WP_001220671.1.4914 WP_001220671.1.49140 WP_001220671.1.49153 WP_001220671.1.49155 WP_001220671.1.49162 WP_001220671.1.49166 WP_001220671.1.49175 WP_001220671.1.49204 WP_001220671.1.49214 WP_001220671.1.49239 WP_001220671.1.49256 WP_001220671.1.49262 WP_001220671.1.49276 WP_001220671.1.49290 WP_001220671.1.49304 WP_001220671.1.49309 WP_001220671.1.49340 WP_001220671.1.49355 WP_001220671.1.49358 WP_001220671.1.49366 WP_001220671.1.49429 WP_001220671.1.49430 WP_001220671.1.49434 WP_001220671.1.49443 WP_001220671.1.49450 WP_001220671.1.49472 WP_001220671.1.49490 WP_001220671.1.49494 WP_001220671.1.495 WP_001220671.1.49515 WP_001220671.1.49534 WP_001220671.1.49545 WP_001220671.1.49550 WP_001220671.1.49572 WP_001220671.1.49574 WP_001220671.1.49590 WP_001220671.1.49602 WP_001220671.1.49630 WP_001220671.1.49647 WP_001220671.1.49650 WP_001220671.1.49686 WP_001220671.1.49703 WP_001220671.1.49710 WP_001220671.1.49769 WP_001220671.1.49778 WP_001220671.1.49780 WP_001220671.1.4979 WP_001220671.1.49790 WP_001220671.1.49803 WP_001220671.1.49805 WP_001220671.1.49827 WP_001220671.1.49846 WP_001220671.1.49848 WP_001220671.1.4991 WP_001220671.1.49929 WP_001220671.1.49947 WP_001220671.1.49959 WP_001220671.1.49997 WP_001220671.1.50 WP_001220671.1.50003 WP_001220671.1.50014 WP_001220671.1.50030 WP_001220671.1.50043 WP_001220671.1.50080 WP_001220671.1.50103 WP_001220671.1.50153 WP_001220671.1.50158 WP_001220671.1.50161 WP_001220671.1.50198 WP_001220671.1.50211 WP_001220671.1.50238 WP_001220671.1.50239 WP_001220671.1.50247 WP_001220671.1.50251 WP_001220671.1.50285 WP_001220671.1.50308 WP_001220671.1.50309 WP_001220671.1.50349 WP_001220671.1.50374 WP_001220671.1.50376 WP_001220671.1.50386 WP_001220671.1.50387 WP_001220671.1.50389 WP_001220671.1.50404 WP_001220671.1.50406 WP_001220671.1.50413 WP_001220671.1.50468 WP_001220671.1.50469 WP_001220671.1.50478 WP_001220671.1.50480 WP_001220671.1.50497 WP_001220671.1.5051 WP_001220671.1.50517 WP_001220671.1.50529 WP_001220671.1.50563 WP_001220671.1.50565 WP_001220671.1.50566 WP_001220671.1.50570 WP_001220671.1.50576 WP_001220671.1.5058 WP_001220671.1.50593 WP_001220671.1.50626 WP_001220671.1.50676 WP_001220671.1.50726 WP_001220671.1.50750 WP_001220671.1.50769 WP_001220671.1.50771 WP_001220671.1.50774 WP_001220671.1.50777 WP_001220671.1.50782 WP_001220671.1.50800 WP_001220671.1.50804 WP_001220671.1.50808 WP_001220671.1.50811 WP_001220671.1.50875 WP_001220671.1.5088 WP_001220671.1.50885 WP_001220671.1.50893 WP_001220671.1.509 WP_001220671.1.50908 WP_001220671.1.50929 WP_001220671.1.50941 WP_001220671.1.50954 WP_001220671.1.50970 WP_001220671.1.50999 WP_001220671.1.51014 WP_001220671.1.51022 WP_001220671.1.51025 WP_001220671.1.51036 WP_001220671.1.51040 WP_001220671.1.51048 WP_001220671.1.51066 WP_001220671.1.51100 WP_001220671.1.51117 WP_001220671.1.51134 WP_001220671.1.51139 WP_001220671.1.5114 WP_001220671.1.51178 WP_001220671.1.51179 WP_001220671.1.51182 WP_001220671.1.51186 WP_001220671.1.51224 WP_001220671.1.51227 WP_001220671.1.5125 WP_001220671.1.5127 WP_001220671.1.51285 WP_001220671.1.51305 WP_001220671.1.51308 WP_001220671.1.51315 WP_001220671.1.51331 WP_001220671.1.51338 WP_001220671.1.5136 WP_001220671.1.5138 WP_001220671.1.51394 WP_001220671.1.51414 WP_001220671.1.51419 WP_001220671.1.51464 WP_001220671.1.51474 WP_001220671.1.51487 WP_001220671.1.51488 WP_001220671.1.51506 WP_001220671.1.51514 WP_001220671.1.51519 WP_001220671.1.51555 WP_001220671.1.51594 WP_001220671.1.51598 WP_001220671.1.51613 WP_001220671.1.51615 WP_001220671.1.51634 WP_001220671.1.51644 WP_001220671.1.51649 WP_001220671.1.51686 WP_001220671.1.51700 WP_001220671.1.51704 WP_001220671.1.51724 WP_001220671.1.51734 WP_001220671.1.51756 WP_001220671.1.51831 WP_001220671.1.51838 WP_001220671.1.51841 WP_001220671.1.5185 WP_001220671.1.51863 WP_001220671.1.51900 WP_001220671.1.51910 WP_001220671.1.51911 WP_001220671.1.51914 WP_001220671.1.51915 WP_001220671.1.51932 WP_001220671.1.51935 WP_001220671.1.51989 WP_001220671.1.52047 WP_001220671.1.52057 WP_001220671.1.52101 WP_001220671.1.52114 WP_001220671.1.52121 WP_001220671.1.52123 WP_001220671.1.52129 WP_001220671.1.52148 WP_001220671.1.5216 WP_001220671.1.52161 WP_001220671.1.52170 WP_001220671.1.52191 WP_001220671.1.52202 WP_001220671.1.52209 WP_001220671.1.52255 WP_001220671.1.52336 WP_001220671.1.52339 WP_001220671.1.52346 WP_001220671.1.52353 WP_001220671.1.52356 WP_001220671.1.52361 WP_001220671.1.52438 WP_001220671.1.52456 WP_001220671.1.52469 WP_001220671.1.52527 WP_001220671.1.52528 WP_001220671.1.52571 WP_001220671.1.526 WP_001220671.1.52608 WP_001220671.1.52647 WP_001220671.1.52653 WP_001220671.1.52656 WP_001220671.1.52675 WP_001220671.1.52692 WP_001220671.1.5273 WP_001220671.1.52738 WP_001220671.1.52742 WP_001220671.1.52743 WP_001220671.1.52744 WP_001220671.1.52748 WP_001220671.1.52773 WP_001220671.1.52795 WP_001220671.1.52807 WP_001220671.1.52824 WP_001220671.1.52851 WP_001220671.1.52857 WP_001220671.1.52858 WP_001220671.1.52866 WP_001220671.1.52887 WP_001220671.1.52898 WP_001220671.1.52910 WP_001220671.1.52915 WP_001220671.1.52924 WP_001220671.1.52949 WP_001220671.1.52985 WP_001220671.1.5301 WP_001220671.1.53016 WP_001220671.1.53092 WP_001220671.1.53100 WP_001220671.1.53141 WP_001220671.1.53151 WP_001220671.1.53154 WP_001220671.1.53158 WP_001220671.1.53159 WP_001220671.1.5316 WP_001220671.1.53179 WP_001220671.1.53190 WP_001220671.1.53203 WP_001220671.1.53210 WP_001220671.1.53233 WP_001220671.1.53272 WP_001220671.1.53274 WP_001220671.1.53286 WP_001220671.1.53307 WP_001220671.1.53315 WP_001220671.1.53316 WP_001220671.1.53321 WP_001220671.1.53328 WP_001220671.1.5333 WP_001220671.1.53368 WP_001220671.1.53375 WP_001220671.1.53406 WP_001220671.1.53436 WP_001220671.1.53450 WP_001220671.1.53454 WP_001220671.1.53466 WP_001220671.1.5349 WP_001220671.1.53529 WP_001220671.1.53534 WP_001220671.1.53540 WP_001220671.1.53543 WP_001220671.1.53555 WP_001220671.1.53559 WP_001220671.1.5356 WP_001220671.1.53571 WP_001220671.1.5358 WP_001220671.1.53675 WP_001220671.1.53688 WP_001220671.1.53692 WP_001220671.1.53723 WP_001220671.1.5374 WP_001220671.1.53750 WP_001220671.1.53757 WP_001220671.1.53790 WP_001220671.1.53800 WP_001220671.1.53812 WP_001220671.1.53814 WP_001220671.1.53815 WP_001220671.1.53839 WP_001220671.1.53892 WP_001220671.1.53898 WP_001220671.1.53902 WP_001220671.1.53905 WP_001220671.1.5392 WP_001220671.1.53935 WP_001220671.1.53958 WP_001220671.1.53981 WP_001220671.1.53984 WP_001220671.1.54033 WP_001220671.1.54075 WP_001220671.1.54085 WP_001220671.1.54132 WP_001220671.1.54136 WP_001220671.1.5415 WP_001220671.1.54159 WP_001220671.1.54170 WP_001220671.1.54175 WP_001220671.1.54196 WP_001220671.1.542 WP_001220671.1.54203 WP_001220671.1.54209 WP_001220671.1.54259 WP_001220671.1.54271 WP_001220671.1.54273 WP_001220671.1.54274 WP_001220671.1.5430 WP_001220671.1.54319 WP_001220671.1.54324 WP_001220671.1.54333 WP_001220671.1.54340 WP_001220671.1.54364 WP_001220671.1.54371 WP_001220671.1.54400 WP_001220671.1.54431 WP_001220671.1.54442 WP_001220671.1.54482 WP_001220671.1.54500 WP_001220671.1.54522 WP_001220671.1.54526 WP_001220671.1.54558 WP_001220671.1.5456 WP_001220671.1.54569 WP_001220671.1.54589 WP_001220671.1.5459 WP_001220671.1.54607 WP_001220671.1.5462 WP_001220671.1.54644 WP_001220671.1.54662 WP_001220671.1.54667 WP_001220671.1.54678 WP_001220671.1.54681 WP_001220671.1.54694 WP_001220671.1.54722 WP_001220671.1.54748 WP_001220671.1.54749 WP_001220671.1.54764 WP_001220671.1.54774 WP_001220671.1.5481 WP_001220671.1.54814 WP_001220671.1.54822 WP_001220671.1.54827 WP_001220671.1.54845 WP_001220671.1.5485 WP_001220671.1.54865 WP_001220671.1.5493 WP_001220671.1.54935 WP_001220671.1.54979 WP_001220671.1.54984 WP_001220671.1.54992 WP_001220671.1.55008 WP_001220671.1.55010 WP_001220671.1.55034 WP_001220671.1.55073 WP_001220671.1.55152 WP_001220671.1.55156 WP_001220671.1.55163 WP_001220671.1.55165 WP_001220671.1.55166 WP_001220671.1.55178 WP_001220671.1.55200 WP_001220671.1.55215 WP_001220671.1.55223 WP_001220671.1.55224 WP_001220671.1.5523 WP_001220671.1.5525 WP_001220671.1.5527 WP_001220671.1.55285 WP_001220671.1.55290 WP_001220671.1.55310 WP_001220671.1.55317 WP_001220671.1.55325 WP_001220671.1.55361 WP_001220671.1.55379 WP_001220671.1.5539 WP_001220671.1.55418 WP_001220671.1.55430 WP_001220671.1.55461 WP_001220671.1.55468 WP_001220671.1.55475 WP_001220671.1.55477 WP_001220671.1.55496 WP_001220671.1.55506 WP_001220671.1.55545 WP_001220671.1.5555 WP_001220671.1.55554 WP_001220671.1.55557 WP_001220671.1.5560 WP_001220671.1.55604 WP_001220671.1.55614 WP_001220671.1.55623 WP_001220671.1.55639 WP_001220671.1.55647 WP_001220671.1.55672 WP_001220671.1.55680 WP_001220671.1.55699 WP_001220671.1.55706 WP_001220671.1.55718 WP_001220671.1.55725 WP_001220671.1.55743 WP_001220671.1.55768 WP_001220671.1.55780 WP_001220671.1.55782 WP_001220671.1.55796 WP_001220671.1.55803 WP_001220671.1.55967 WP_001220671.1.55973 WP_001220671.1.55993 WP_001220671.1.56002 WP_001220671.1.56004 WP_001220671.1.56012 WP_001220671.1.56026 WP_001220671.1.56059 WP_001220671.1.56069 WP_001220671.1.56070 WP_001220671.1.56082 WP_001220671.1.56097 WP_001220671.1.56100 WP_001220671.1.56105 WP_001220671.1.56130 WP_001220671.1.56144 WP_001220671.1.56152 WP_001220671.1.56172 WP_001220671.1.5621 WP_001220671.1.56222 WP_001220671.1.56226 WP_001220671.1.56238 WP_001220671.1.56244 WP_001220671.1.56286 WP_001220671.1.56303 WP_001220671.1.56304 WP_001220671.1.56305 WP_001220671.1.56311 WP_001220671.1.56354 WP_001220671.1.56368 WP_001220671.1.56370 WP_001220671.1.56374 WP_001220671.1.56385 WP_001220671.1.56396 WP_001220671.1.56413 WP_001220671.1.56414 WP_001220671.1.56419 WP_001220671.1.56420 WP_001220671.1.56423 WP_001220671.1.56438 WP_001220671.1.56468 WP_001220671.1.56512 WP_001220671.1.56514 WP_001220671.1.56535 WP_001220671.1.56559 WP_001220671.1.56560 WP_001220671.1.56585 WP_001220671.1.56597 WP_001220671.1.56601 WP_001220671.1.56614 WP_001220671.1.56615 WP_001220671.1.56640 WP_001220671.1.56642 WP_001220671.1.56647 WP_001220671.1.56651 WP_001220671.1.56660 WP_001220671.1.56671 WP_001220671.1.56682 WP_001220671.1.56724 WP_001220671.1.56791 WP_001220671.1.56824 WP_001220671.1.56825 WP_001220671.1.56853 WP_001220671.1.56875 WP_001220671.1.56877 WP_001220671.1.56887 WP_001220671.1.56889 WP_001220671.1.56893 WP_001220671.1.56905 WP_001220671.1.56942 WP_001220671.1.56981 WP_001220671.1.57000 WP_001220671.1.57076 WP_001220671.1.57084 WP_001220671.1.57101 WP_001220671.1.57125 WP_001220671.1.57137 WP_001220671.1.57147 WP_001220671.1.57168 WP_001220671.1.57179 WP_001220671.1.57186 WP_001220671.1.57187 WP_001220671.1.57232 WP_001220671.1.57233 WP_001220671.1.57244 WP_001220671.1.57307 WP_001220671.1.57342 WP_001220671.1.57344 WP_001220671.1.57356 WP_001220671.1.57377 WP_001220671.1.57399 WP_001220671.1.57418 WP_001220671.1.57433 WP_001220671.1.57494 WP_001220671.1.57495 WP_001220671.1.57510 WP_001220671.1.57515 WP_001220671.1.57521 WP_001220671.1.57529 WP_001220671.1.5753 WP_001220671.1.57534 WP_001220671.1.57555 WP_001220671.1.57576 WP_001220671.1.57601 WP_001220671.1.57607 WP_001220671.1.5761 WP_001220671.1.57684 WP_001220671.1.57699 WP_001220671.1.57709 WP_001220671.1.57710 WP_001220671.1.57735 WP_001220671.1.5774 WP_001220671.1.57763 WP_001220671.1.57778 WP_001220671.1.57781 WP_001220671.1.57785 WP_001220671.1.57797 WP_001220671.1.57800 WP_001220671.1.5781 WP_001220671.1.57857 WP_001220671.1.57862 WP_001220671.1.57873 WP_001220671.1.57890 WP_001220671.1.57891 WP_001220671.1.57902 WP_001220671.1.57965 WP_001220671.1.57972 WP_001220671.1.57978 WP_001220671.1.58008 WP_001220671.1.5801 WP_001220671.1.58040 WP_001220671.1.58041 WP_001220671.1.58044 WP_001220671.1.58081 WP_001220671.1.5809 WP_001220671.1.58131 WP_001220671.1.58132 WP_001220671.1.58144 WP_001220671.1.58153 WP_001220671.1.58157 WP_001220671.1.58173 WP_001220671.1.58191 WP_001220671.1.58194 WP_001220671.1.58239 WP_001220671.1.58251 WP_001220671.1.58252 WP_001220671.1.58261 WP_001220671.1.58274 WP_001220671.1.58282 WP_001220671.1.58324 WP_001220671.1.58326 WP_001220671.1.58334 WP_001220671.1.58357 WP_001220671.1.58358 WP_001220671.1.5836 WP_001220671.1.58372 WP_001220671.1.58407 WP_001220671.1.58416 WP_001220671.1.58442 WP_001220671.1.58451 WP_001220671.1.5846 WP_001220671.1.58467 WP_001220671.1.58485 WP_001220671.1.58537 WP_001220671.1.5854 WP_001220671.1.58548 WP_001220671.1.58564 WP_001220671.1.58568 WP_001220671.1.5858 WP_001220671.1.58583 WP_001220671.1.58633 WP_001220671.1.58652 WP_001220671.1.58662 WP_001220671.1.58663 WP_001220671.1.58669 WP_001220671.1.58698 WP_001220671.1.58724 WP_001220671.1.58729 WP_001220671.1.58745 WP_001220671.1.5875 WP_001220671.1.5878 WP_001220671.1.58796 WP_001220671.1.58803 WP_001220671.1.58807 WP_001220671.1.58831 WP_001220671.1.58834 WP_001220671.1.58836 WP_001220671.1.58847 WP_001220671.1.5886 WP_001220671.1.58861 WP_001220671.1.58883 WP_001220671.1.58898 WP_001220671.1.58949 WP_001220671.1.58963 WP_001220671.1.58970 WP_001220671.1.58974 WP_001220671.1.59006 WP_001220671.1.59012 WP_001220671.1.59020 WP_001220671.1.59043 WP_001220671.1.59056 WP_001220671.1.59061 WP_001220671.1.59064 WP_001220671.1.59068 WP_001220671.1.59084 WP_001220671.1.59094 WP_001220671.1.59097 WP_001220671.1.59125 WP_001220671.1.59136 WP_001220671.1.59148 WP_001220671.1.59224 WP_001220671.1.59236 WP_001220671.1.59276 WP_001220671.1.59282 WP_001220671.1.5929 WP_001220671.1.59294 WP_001220671.1.59295 WP_001220671.1.59299 WP_001220671.1.59313 WP_001220671.1.59321 WP_001220671.1.59336 WP_001220671.1.59375 WP_001220671.1.59381 WP_001220671.1.59412 WP_001220671.1.59420 WP_001220671.1.59439 WP_001220671.1.59458 WP_001220671.1.59486 WP_001220671.1.5949 WP_001220671.1.59490 WP_001220671.1.59501 WP_001220671.1.59508 WP_001220671.1.59510 WP_001220671.1.59512 WP_001220671.1.59521 WP_001220671.1.5953 WP_001220671.1.59562 WP_001220671.1.59587 WP_001220671.1.59604 WP_001220671.1.59636 WP_001220671.1.59641 WP_001220671.1.59648 WP_001220671.1.59684 WP_001220671.1.5969 WP_001220671.1.59694 WP_001220671.1.59710 WP_001220671.1.59751 WP_001220671.1.59755 WP_001220671.1.59771 WP_001220671.1.5979 WP_001220671.1.59827 WP_001220671.1.59829 WP_001220671.1.59830 WP_001220671.1.59847 WP_001220671.1.59863 WP_001220671.1.5993 WP_001220671.1.59933 WP_001220671.1.59953 WP_001220671.1.59969 WP_001220671.1.59979 WP_001220671.1.59994 WP_001220671.1.60008 WP_001220671.1.60015 WP_001220671.1.60021 WP_001220671.1.60045 WP_001220671.1.60052 WP_001220671.1.60069 WP_001220671.1.60076 WP_001220671.1.60106 WP_001220671.1.60114 WP_001220671.1.60140 WP_001220671.1.60154 WP_001220671.1.60155 WP_001220671.1.60168 WP_001220671.1.60192 WP_001220671.1.60199 WP_001220671.1.60209 WP_001220671.1.60212 WP_001220671.1.60213 WP_001220671.1.60226 WP_001220671.1.60231 WP_001220671.1.60253 WP_001220671.1.60285 WP_001220671.1.60322 WP_001220671.1.60324 WP_001220671.1.60330 WP_001220671.1.60356 WP_001220671.1.60370 WP_001220671.1.60379 WP_001220671.1.6038 WP_001220671.1.60380 WP_001220671.1.6041 WP_001220671.1.60424 WP_001220671.1.60464 WP_001220671.1.60469 WP_001220671.1.60481 WP_001220671.1.60486 WP_001220671.1.605 WP_001220671.1.60503 WP_001220671.1.60507 WP_001220671.1.6052 WP_001220671.1.60545 WP_001220671.1.60561 WP_001220671.1.6058 WP_001220671.1.60584 WP_001220671.1.60597 WP_001220671.1.6060 WP_001220671.1.60608 WP_001220671.1.60622 WP_001220671.1.60643 WP_001220671.1.60661 WP_001220671.1.60676 WP_001220671.1.60708 WP_001220671.1.60725 WP_001220671.1.60760 WP_001220671.1.60772 WP_001220671.1.60783 WP_001220671.1.60792 WP_001220671.1.60794 WP_001220671.1.60807 WP_001220671.1.60809 WP_001220671.1.60851 WP_001220671.1.60855 WP_001220671.1.60857 WP_001220671.1.6086 WP_001220671.1.60863 WP_001220671.1.60874 WP_001220671.1.60882 WP_001220671.1.60889 WP_001220671.1.6090 WP_001220671.1.60918 WP_001220671.1.60919 WP_001220671.1.60926 WP_001220671.1.60941 WP_001220671.1.60950 WP_001220671.1.60976 WP_001220671.1.60988 WP_001220671.1.60990 WP_001220671.1.6104 WP_001220671.1.61044 WP_001220671.1.61045 WP_001220671.1.61076 WP_001220671.1.61078 WP_001220671.1.6108 WP_001220671.1.61087 WP_001220671.1.61114 WP_001220671.1.61123 WP_001220671.1.6114 WP_001220671.1.61146 WP_001220671.1.61147 WP_001220671.1.61168 WP_001220671.1.61184 WP_001220671.1.61200 WP_001220671.1.61201 WP_001220671.1.61210 WP_001220671.1.61218 WP_001220671.1.61232 WP_001220671.1.6129 WP_001220671.1.61296 WP_001220671.1.61309 WP_001220671.1.61345 WP_001220671.1.61357 WP_001220671.1.61417 WP_001220671.1.6143 WP_001220671.1.61434 WP_001220671.1.61497 WP_001220671.1.61509 WP_001220671.1.61511 WP_001220671.1.61539 WP_001220671.1.61542 WP_001220671.1.61553 WP_001220671.1.61574 WP_001220671.1.61582 WP_001220671.1.61609 WP_001220671.1.6164 WP_001220671.1.61649 WP_001220671.1.61652 WP_001220671.1.61662 WP_001220671.1.61667 WP_001220671.1.61694 WP_001220671.1.61697 WP_001220671.1.61712 WP_001220671.1.61714 WP_001220671.1.61730 WP_001220671.1.61732 WP_001220671.1.61737 WP_001220671.1.61743 WP_001220671.1.61783 WP_001220671.1.61809 WP_001220671.1.61857 WP_001220671.1.61877 WP_001220671.1.6190 WP_001220671.1.61918 WP_001220671.1.61920 WP_001220671.1.61922 WP_001220671.1.61924 WP_001220671.1.61952 WP_001220671.1.61968 WP_001220671.1.62007 WP_001220671.1.62020 WP_001220671.1.62025 WP_001220671.1.62063 WP_001220671.1.62076 WP_001220671.1.6209 WP_001220671.1.62108 WP_001220671.1.62120 WP_001220671.1.62122 WP_001220671.1.62124 WP_001220671.1.62142 WP_001220671.1.62144 WP_001220671.1.62184 WP_001220671.1.62195 WP_001220671.1.62199 WP_001220671.1.62204 WP_001220671.1.62222 WP_001220671.1.62223 WP_001220671.1.62241 WP_001220671.1.62257 WP_001220671.1.62271 WP_001220671.1.62302 WP_001220671.1.62304 WP_001220671.1.62310 WP_001220671.1.62314 WP_001220671.1.62323 WP_001220671.1.62333 WP_001220671.1.62338 WP_001220671.1.62339 WP_001220671.1.62344 WP_001220671.1.62361 WP_001220671.1.62364 WP_001220671.1.62374 WP_001220671.1.62380 WP_001220671.1.62403 WP_001220671.1.62404 WP_001220671.1.62411 WP_001220671.1.62436 WP_001220671.1.62442 WP_001220671.1.62475 WP_001220671.1.62486 WP_001220671.1.62488 WP_001220671.1.62504 WP_001220671.1.62522 WP_001220671.1.6253 WP_001220671.1.62536 WP_001220671.1.62564 WP_001220671.1.62570 WP_001220671.1.62619 WP_001220671.1.62640 WP_001220671.1.62648 WP_001220671.1.62677 WP_001220671.1.62686 WP_001220671.1.62693 WP_001220671.1.62725 WP_001220671.1.62751 WP_001220671.1.62798 WP_001220671.1.62825 WP_001220671.1.62828 WP_001220671.1.62853 WP_001220671.1.62910 WP_001220671.1.62913 WP_001220671.1.62932 WP_001220671.1.62955 WP_001220671.1.62960 WP_001220671.1.62976 WP_001220671.1.63016 WP_001220671.1.63025 WP_001220671.1.63063 WP_001220671.1.63069 WP_001220671.1.63087 WP_001220671.1.63118 WP_001220671.1.63129 WP_001220671.1.63135 WP_001220671.1.63150 WP_001220671.1.63155 WP_001220671.1.63169 WP_001220671.1.63181 WP_001220671.1.63186 WP_001220671.1.63203 WP_001220671.1.63243 WP_001220671.1.63250 WP_001220671.1.63256 WP_001220671.1.63290 WP_001220671.1.63297 WP_001220671.1.63382 WP_001220671.1.63422 WP_001220671.1.63432 WP_001220671.1.63448 WP_001220671.1.63455 WP_001220671.1.63461 WP_001220671.1.63479 WP_001220671.1.63499 WP_001220671.1.63513 WP_001220671.1.63514 WP_001220671.1.63532 WP_001220671.1.63568 WP_001220671.1.6357 WP_001220671.1.63577 WP_001220671.1.63583 WP_001220671.1.63592 WP_001220671.1.63663 WP_001220671.1.63664 WP_001220671.1.6367 WP_001220671.1.63677 WP_001220671.1.63690 WP_001220671.1.63718 WP_001220671.1.63736 WP_001220671.1.6375 WP_001220671.1.63757 WP_001220671.1.63766 WP_001220671.1.63781 WP_001220671.1.63782 WP_001220671.1.63797 WP_001220671.1.63816 WP_001220671.1.63831 WP_001220671.1.63834 WP_001220671.1.6384 WP_001220671.1.63860 WP_001220671.1.63864 WP_001220671.1.63866 WP_001220671.1.63876 WP_001220671.1.6389 WP_001220671.1.63901 WP_001220671.1.63903 WP_001220671.1.63912 WP_001220671.1.63934 WP_001220671.1.63955 WP_001220671.1.63958 WP_001220671.1.63963 WP_001220671.1.63977 WP_001220671.1.6399 WP_001220671.1.64007 WP_001220671.1.64018 WP_001220671.1.64032 WP_001220671.1.64034 WP_001220671.1.64046 WP_001220671.1.64072 WP_001220671.1.64087 WP_001220671.1.6415 WP_001220671.1.64176 WP_001220671.1.64208 WP_001220671.1.64217 WP_001220671.1.6423 WP_001220671.1.64244 WP_001220671.1.64266 WP_001220671.1.64293 WP_001220671.1.64294 WP_001220671.1.64332 WP_001220671.1.6437 WP_001220671.1.64374 WP_001220671.1.64376 WP_001220671.1.64387 WP_001220671.1.64389 WP_001220671.1.644 WP_001220671.1.64403 WP_001220671.1.64471 WP_001220671.1.64501 WP_001220671.1.6451 WP_001220671.1.64538 WP_001220671.1.64569 WP_001220671.1.64632 WP_001220671.1.64645 WP_001220671.1.64648 WP_001220671.1.64649 WP_001220671.1.64654 WP_001220671.1.64662 WP_001220671.1.64663 WP_001220671.1.64667 WP_001220671.1.64674 WP_001220671.1.64690 WP_001220671.1.64702 WP_001220671.1.64709 WP_001220671.1.64710 WP_001220671.1.64721 WP_001220671.1.64744 WP_001220671.1.64757 WP_001220671.1.64758 WP_001220671.1.64763 WP_001220671.1.64771 WP_001220671.1.64781 WP_001220671.1.64798 WP_001220671.1.64817 WP_001220671.1.64831 WP_001220671.1.64847 WP_001220671.1.6487 WP_001220671.1.6489 WP_001220671.1.64891 WP_001220671.1.64894 WP_001220671.1.64919 WP_001220671.1.64920 WP_001220671.1.64944 WP_001220671.1.64972 WP_001220671.1.64974 WP_001220671.1.64977 WP_001220671.1.65016 WP_001220671.1.65018 WP_001220671.1.65022 WP_001220671.1.65027 WP_001220671.1.65028 WP_001220671.1.65052 WP_001220671.1.65054 WP_001220671.1.65075 WP_001220671.1.6514 WP_001220671.1.65163 WP_001220671.1.65168 WP_001220671.1.65171 WP_001220671.1.65172 WP_001220671.1.65185 WP_001220671.1.65191 WP_001220671.1.65200 WP_001220671.1.65211 WP_001220671.1.65218 WP_001220671.1.65226 WP_001220671.1.65238 WP_001220671.1.65248 WP_001220671.1.65249 WP_001220671.1.6525 WP_001220671.1.65266 WP_001220671.1.65269 WP_001220671.1.65295 WP_001220671.1.65348 WP_001220671.1.6535 WP_001220671.1.65363 WP_001220671.1.65394 WP_001220671.1.65395 WP_001220671.1.65437 WP_001220671.1.65459 WP_001220671.1.65463 WP_001220671.1.65471 WP_001220671.1.65474 WP_001220671.1.65475 WP_001220671.1.65487 WP_001220671.1.6549 WP_001220671.1.65499 WP_001220671.1.6550 WP_001220671.1.65508 WP_001220671.1.65538 WP_001220671.1.6554 WP_001220671.1.65558 WP_001220671.1.65572 WP_001220671.1.6560 WP_001220671.1.6561 WP_001220671.1.65620 WP_001220671.1.65633 WP_001220671.1.6565 WP_001220671.1.65650 WP_001220671.1.65687 WP_001220671.1.65696 WP_001220671.1.65697 WP_001220671.1.65699 WP_001220671.1.6572 WP_001220671.1.65737 WP_001220671.1.6575 WP_001220671.1.65755 WP_001220671.1.65782 WP_001220671.1.65790 WP_001220671.1.65795 WP_001220671.1.65812 WP_001220671.1.65818 WP_001220671.1.65846 WP_001220671.1.65849 WP_001220671.1.65863 WP_001220671.1.65876 WP_001220671.1.6594 WP_001220671.1.65940 WP_001220671.1.65945 WP_001220671.1.65956 WP_001220671.1.65968 WP_001220671.1.65985 WP_001220671.1.66021 WP_001220671.1.66031 WP_001220671.1.66049 WP_001220671.1.66052 WP_001220671.1.66064 WP_001220671.1.66085 WP_001220671.1.66109 WP_001220671.1.66129 WP_001220671.1.66145 WP_001220671.1.66183 WP_001220671.1.6620 WP_001220671.1.66216 WP_001220671.1.66234 WP_001220671.1.66250 WP_001220671.1.66270 WP_001220671.1.66272 WP_001220671.1.66273 WP_001220671.1.6630 WP_001220671.1.66314 WP_001220671.1.66324 WP_001220671.1.66330 WP_001220671.1.6634 WP_001220671.1.66358 WP_001220671.1.66361 WP_001220671.1.66362 WP_001220671.1.66365 WP_001220671.1.66368 WP_001220671.1.6638 WP_001220671.1.6640 WP_001220671.1.66462 WP_001220671.1.6647 WP_001220671.1.66480 WP_001220671.1.66492 WP_001220671.1.66506 WP_001220671.1.66600 WP_001220671.1.66630 WP_001220671.1.66665 WP_001220671.1.66678 WP_001220671.1.66681 WP_001220671.1.66684 WP_001220671.1.66698 WP_001220671.1.66702 WP_001220671.1.66755 WP_001220671.1.66759 WP_001220671.1.66779 WP_001220671.1.6680 WP_001220671.1.66800 WP_001220671.1.66801 WP_001220671.1.66807 WP_001220671.1.66820 WP_001220671.1.66824 WP_001220671.1.66825 WP_001220671.1.66834 WP_001220671.1.66860 WP_001220671.1.66901 WP_001220671.1.66953 WP_001220671.1.66955 WP_001220671.1.66962 WP_001220671.1.66981 WP_001220671.1.67 WP_001220671.1.67024 WP_001220671.1.67037 WP_001220671.1.67042 WP_001220671.1.67045 WP_001220671.1.67100 WP_001220671.1.67101 WP_001220671.1.67143 WP_001220671.1.67175 WP_001220671.1.67181 WP_001220671.1.67201 WP_001220671.1.67211 WP_001220671.1.67228 WP_001220671.1.67235 WP_001220671.1.67237 WP_001220671.1.67268 WP_001220671.1.67288 WP_001220671.1.67336 WP_001220671.1.67339 WP_001220671.1.67347 WP_001220671.1.67387 WP_001220671.1.6739 WP_001220671.1.67394 WP_001220671.1.67397 WP_001220671.1.67403 WP_001220671.1.67424 WP_001220671.1.67430 WP_001220671.1.67442 WP_001220671.1.67465 WP_001220671.1.67539 WP_001220671.1.67552 WP_001220671.1.67556 WP_001220671.1.67576 WP_001220671.1.67603 WP_001220671.1.67604 WP_001220671.1.67617 WP_001220671.1.67619 WP_001220671.1.67625 WP_001220671.1.67627 WP_001220671.1.67633 WP_001220671.1.67641 WP_001220671.1.67657 WP_001220671.1.67673 WP_001220671.1.67682 WP_001220671.1.67700 WP_001220671.1.67707 WP_001220671.1.67718 WP_001220671.1.67729 WP_001220671.1.67731 WP_001220671.1.67772 WP_001220671.1.67774 WP_001220671.1.67776 WP_001220671.1.67803 WP_001220671.1.67814 WP_001220671.1.67820 WP_001220671.1.67825 WP_001220671.1.67827 WP_001220671.1.67829 WP_001220671.1.67887 WP_001220671.1.67905 WP_001220671.1.67910 WP_001220671.1.67924 WP_001220671.1.67942 WP_001220671.1.67954 WP_001220671.1.67969 WP_001220671.1.67970 WP_001220671.1.67988 WP_001220671.1.68 WP_001220671.1.68036 WP_001220671.1.68043 WP_001220671.1.68073 WP_001220671.1.68075 WP_001220671.1.6809 WP_001220671.1.68105 WP_001220671.1.68113 WP_001220671.1.68115 WP_001220671.1.68131 WP_001220671.1.68147 WP_001220671.1.68167 WP_001220671.1.68182 WP_001220671.1.6819 WP_001220671.1.68201 WP_001220671.1.68206 WP_001220671.1.6827 WP_001220671.1.68275 WP_001220671.1.68285 WP_001220671.1.6833 WP_001220671.1.68359 WP_001220671.1.68401 WP_001220671.1.68420 WP_001220671.1.68477 WP_001220671.1.68478 WP_001220671.1.6849 WP_001220671.1.685 WP_001220671.1.68514 WP_001220671.1.68532 WP_001220671.1.68547 WP_001220671.1.68564 WP_001220671.1.6858 WP_001220671.1.68589 WP_001220671.1.68591 WP_001220671.1.68629 WP_001220671.1.68655 WP_001220671.1.68656 WP_001220671.1.68688 WP_001220671.1.6869 WP_001220671.1.68690 WP_001220671.1.68742 WP_001220671.1.6875 WP_001220671.1.68770 WP_001220671.1.68778 WP_001220671.1.68787 WP_001220671.1.6879 WP_001220671.1.68809 WP_001220671.1.68816 WP_001220671.1.6882 WP_001220671.1.6883 WP_001220671.1.68894 WP_001220671.1.68914 WP_001220671.1.68928 WP_001220671.1.68958 WP_001220671.1.68975 WP_001220671.1.68999 WP_001220671.1.69001 WP_001220671.1.69006 WP_001220671.1.69011 WP_001220671.1.69029 WP_001220671.1.6904 WP_001220671.1.69042 WP_001220671.1.6905 WP_001220671.1.69053 WP_001220671.1.69058 WP_001220671.1.6907 WP_001220671.1.6913 WP_001220671.1.69139 WP_001220671.1.69146 WP_001220671.1.69151 WP_001220671.1.69170 WP_001220671.1.69210 WP_001220671.1.69255 WP_001220671.1.69270 WP_001220671.1.69282 WP_001220671.1.69296 WP_001220671.1.69320 WP_001220671.1.69346 WP_001220671.1.69359 WP_001220671.1.69371 WP_001220671.1.69376 WP_001220671.1.69385 WP_001220671.1.69396 WP_001220671.1.69397 WP_001220671.1.69433 WP_001220671.1.69465 WP_001220671.1.69466 WP_001220671.1.69515 WP_001220671.1.6954 WP_001220671.1.69554 WP_001220671.1.69564 WP_001220671.1.69588 WP_001220671.1.69592 WP_001220671.1.69597 WP_001220671.1.69611 WP_001220671.1.69636 WP_001220671.1.69642 WP_001220671.1.69644 WP_001220671.1.69656 WP_001220671.1.69657 WP_001220671.1.69690 WP_001220671.1.69696 WP_001220671.1.69704 WP_001220671.1.69710 WP_001220671.1.69754 WP_001220671.1.69758 WP_001220671.1.69760 WP_001220671.1.69785 WP_001220671.1.69787 WP_001220671.1.69790 WP_001220671.1.69807 WP_001220671.1.69808 WP_001220671.1.69817 WP_001220671.1.69839 WP_001220671.1.69848 WP_001220671.1.69923 WP_001220671.1.69948 WP_001220671.1.69953 WP_001220671.1.69975 WP_001220671.1.69982 WP_001220671.1.70003 WP_001220671.1.70010 WP_001220671.1.70047 WP_001220671.1.70049 WP_001220671.1.70058 WP_001220671.1.70061 WP_001220671.1.70087 WP_001220671.1.7010 WP_001220671.1.7016 WP_001220671.1.70169 WP_001220671.1.70183 WP_001220671.1.70205 WP_001220671.1.7021 WP_001220671.1.70240 WP_001220671.1.70241 WP_001220671.1.70248 WP_001220671.1.70249 WP_001220671.1.70261 WP_001220671.1.70269 WP_001220671.1.70281 WP_001220671.1.70289 WP_001220671.1.70290 WP_001220671.1.70314 WP_001220671.1.70321 WP_001220671.1.70327 WP_001220671.1.7033 WP_001220671.1.70355 WP_001220671.1.70427 WP_001220671.1.70433 WP_001220671.1.7044 WP_001220671.1.70447 WP_001220671.1.70485 WP_001220671.1.70488 WP_001220671.1.70491 WP_001220671.1.70545 WP_001220671.1.7055 WP_001220671.1.70580 WP_001220671.1.7060 WP_001220671.1.70623 WP_001220671.1.70643 WP_001220671.1.70644 WP_001220671.1.70662 WP_001220671.1.70671 WP_001220671.1.70679 WP_001220671.1.70683 WP_001220671.1.70685 WP_001220671.1.70708 WP_001220671.1.70712 WP_001220671.1.70717 WP_001220671.1.70731 WP_001220671.1.70732 WP_001220671.1.70733 WP_001220671.1.70761 WP_001220671.1.70772 WP_001220671.1.70792 WP_001220671.1.70797 WP_001220671.1.70845 WP_001220671.1.70846 WP_001220671.1.70869 WP_001220671.1.70883 WP_001220671.1.70899 WP_001220671.1.70914 WP_001220671.1.70922 WP_001220671.1.7093 WP_001220671.1.70948 WP_001220671.1.70959 WP_001220671.1.70969 WP_001220671.1.70981 WP_001220671.1.70986 WP_001220671.1.70995 WP_001220671.1.71007 WP_001220671.1.71010 WP_001220671.1.71023 WP_001220671.1.71039 WP_001220671.1.71057 WP_001220671.1.71069 WP_001220671.1.71081 WP_001220671.1.71088 WP_001220671.1.7110 WP_001220671.1.71116 WP_001220671.1.71117 WP_001220671.1.71120 WP_001220671.1.71146 WP_001220671.1.71150 WP_001220671.1.71165 WP_001220671.1.71171 WP_001220671.1.71186 WP_001220671.1.71188 WP_001220671.1.71202 WP_001220671.1.71243 WP_001220671.1.71245 WP_001220671.1.71248 WP_001220671.1.71268 WP_001220671.1.71299 WP_001220671.1.71306 WP_001220671.1.71337 WP_001220671.1.7134 WP_001220671.1.71363 WP_001220671.1.71368 WP_001220671.1.71378 WP_001220671.1.714 WP_001220671.1.71401 WP_001220671.1.71407 WP_001220671.1.71418 WP_001220671.1.7142 WP_001220671.1.71446 WP_001220671.1.71450 WP_001220671.1.71452 WP_001220671.1.71455 WP_001220671.1.71456 WP_001220671.1.71481 WP_001220671.1.71487 WP_001220671.1.71500 WP_001220671.1.71523 WP_001220671.1.71542 WP_001220671.1.71566 WP_001220671.1.71583 WP_001220671.1.71636 WP_001220671.1.71640 WP_001220671.1.71651 WP_001220671.1.71653 WP_001220671.1.71656 WP_001220671.1.71667 WP_001220671.1.71691 WP_001220671.1.71702 WP_001220671.1.71716 WP_001220671.1.7174 WP_001220671.1.71746 WP_001220671.1.71750 WP_001220671.1.71756 WP_001220671.1.71793 WP_001220671.1.71798 WP_001220671.1.71845 WP_001220671.1.71848 WP_001220671.1.71872 WP_001220671.1.71881 WP_001220671.1.71908 WP_001220671.1.71923 WP_001220671.1.71929 WP_001220671.1.71941 WP_001220671.1.71950 WP_001220671.1.71952 WP_001220671.1.71954 WP_001220671.1.71973 WP_001220671.1.71985 WP_001220671.1.72003 WP_001220671.1.72065 WP_001220671.1.72073 WP_001220671.1.72105 WP_001220671.1.72107 WP_001220671.1.72119 WP_001220671.1.72121 WP_001220671.1.72188 WP_001220671.1.72203 WP_001220671.1.72220 WP_001220671.1.72226 WP_001220671.1.72243 WP_001220671.1.72254 WP_001220671.1.72269 WP_001220671.1.72277 WP_001220671.1.72281 WP_001220671.1.72283 WP_001220671.1.72307 WP_001220671.1.72350 WP_001220671.1.72351 WP_001220671.1.72372 WP_001220671.1.72376 WP_001220671.1.72382 WP_001220671.1.72383 WP_001220671.1.72399 WP_001220671.1.72403 WP_001220671.1.72412 WP_001220671.1.7243 WP_001220671.1.72438 WP_001220671.1.72461 WP_001220671.1.72527 WP_001220671.1.7255 WP_001220671.1.72594 WP_001220671.1.72631 WP_001220671.1.72638 WP_001220671.1.72642 WP_001220671.1.72667 WP_001220671.1.72671 WP_001220671.1.72674 WP_001220671.1.72689 WP_001220671.1.72724 WP_001220671.1.72728 WP_001220671.1.72789 WP_001220671.1.72793 WP_001220671.1.72797 WP_001220671.1.72827 WP_001220671.1.72828 WP_001220671.1.72843 WP_001220671.1.72850 WP_001220671.1.72871 WP_001220671.1.72872 WP_001220671.1.72887 WP_001220671.1.72892 WP_001220671.1.72894 WP_001220671.1.72896 WP_001220671.1.72897 WP_001220671.1.72944 WP_001220671.1.72946 WP_001220671.1.72968 WP_001220671.1.72969 WP_001220671.1.72975 WP_001220671.1.72987 WP_001220671.1.7304 WP_001220671.1.73052 WP_001220671.1.73062 WP_001220671.1.73102 WP_001220671.1.7311 WP_001220671.1.73114 WP_001220671.1.73125 WP_001220671.1.7315 WP_001220671.1.7316 WP_001220671.1.73164 WP_001220671.1.73177 WP_001220671.1.73180 WP_001220671.1.73200 WP_001220671.1.73258 WP_001220671.1.73270 WP_001220671.1.73285 WP_001220671.1.7332 WP_001220671.1.73328 WP_001220671.1.7333 WP_001220671.1.7334 WP_001220671.1.73352 WP_001220671.1.73362 WP_001220671.1.73377 WP_001220671.1.73379 WP_001220671.1.73389 WP_001220671.1.7341 WP_001220671.1.73425 WP_001220671.1.73461 WP_001220671.1.73481 WP_001220671.1.73488 WP_001220671.1.73504 WP_001220671.1.73512 WP_001220671.1.7353 WP_001220671.1.73535 WP_001220671.1.73544 WP_001220671.1.7356 WP_001220671.1.73561 WP_001220671.1.73581 WP_001220671.1.73596 WP_001220671.1.73598 WP_001220671.1.7361 WP_001220671.1.73617 WP_001220671.1.73648 WP_001220671.1.73667 WP_001220671.1.73669 WP_001220671.1.73701 WP_001220671.1.7374 WP_001220671.1.73753 WP_001220671.1.73758 WP_001220671.1.73768 WP_001220671.1.73794 WP_001220671.1.73804 WP_001220671.1.73831 WP_001220671.1.73847 WP_001220671.1.73849 WP_001220671.1.7386 WP_001220671.1.7387 WP_001220671.1.73901 WP_001220671.1.73924 WP_001220671.1.73926 WP_001220671.1.7394 WP_001220671.1.73945 WP_001220671.1.73948 WP_001220671.1.73956 WP_001220671.1.73958 WP_001220671.1.73965 WP_001220671.1.73999 WP_001220671.1.74024 WP_001220671.1.74028 WP_001220671.1.74029 WP_001220671.1.74030 WP_001220671.1.74038 WP_001220671.1.74040 WP_001220671.1.74043 WP_001220671.1.74049 WP_001220671.1.7405 WP_001220671.1.74058 WP_001220671.1.74070 WP_001220671.1.74077 WP_001220671.1.74089 WP_001220671.1.74117 WP_001220671.1.74135 WP_001220671.1.74163 WP_001220671.1.74181 WP_001220671.1.74191 WP_001220671.1.74214 WP_001220671.1.74228 WP_001220671.1.74241 WP_001220671.1.74285 WP_001220671.1.7430 WP_001220671.1.74317 WP_001220671.1.7433 WP_001220671.1.74379 WP_001220671.1.74410 WP_001220671.1.74414 WP_001220671.1.74415 WP_001220671.1.74418 WP_001220671.1.74422 WP_001220671.1.74428 WP_001220671.1.7444 WP_001220671.1.74454 WP_001220671.1.74466 WP_001220671.1.74469 WP_001220671.1.74481 WP_001220671.1.745 WP_001220671.1.74500 WP_001220671.1.74529 WP_001220671.1.74545 WP_001220671.1.74570 WP_001220671.1.7458 WP_001220671.1.74616 WP_001220671.1.74620 WP_001220671.1.74621 WP_001220671.1.74632 WP_001220671.1.74639 WP_001220671.1.74644 WP_001220671.1.74647 WP_001220671.1.74661 WP_001220671.1.74677 WP_001220671.1.74699 WP_001220671.1.74702 WP_001220671.1.74741 WP_001220671.1.74745 WP_001220671.1.74757 WP_001220671.1.74806 WP_001220671.1.74807 WP_001220671.1.74826 WP_001220671.1.74831 WP_001220671.1.74876 WP_001220671.1.74884 WP_001220671.1.74894 WP_001220671.1.7491 WP_001220671.1.74929 WP_001220671.1.74939 WP_001220671.1.74946 WP_001220671.1.74973 WP_001220671.1.74992 WP_001220671.1.75009 WP_001220671.1.75058 WP_001220671.1.7507 WP_001220671.1.75089 WP_001220671.1.75114 WP_001220671.1.75116 WP_001220671.1.75129 WP_001220671.1.75134 WP_001220671.1.75168 WP_001220671.1.75177 WP_001220671.1.75180 WP_001220671.1.75187 WP_001220671.1.75237 WP_001220671.1.75273 WP_001220671.1.75288 WP_001220671.1.75296 WP_001220671.1.75301 WP_001220671.1.7531 WP_001220671.1.75334 WP_001220671.1.75362 WP_001220671.1.75371 WP_001220671.1.75385 WP_001220671.1.75392 WP_001220671.1.75402 WP_001220671.1.75413 WP_001220671.1.7543 WP_001220671.1.75433 WP_001220671.1.75494 WP_001220671.1.75532 WP_001220671.1.75565 WP_001220671.1.75585 WP_001220671.1.75593 WP_001220671.1.75609 WP_001220671.1.75610 WP_001220671.1.75626 WP_001220671.1.75633 WP_001220671.1.75664 WP_001220671.1.75718 WP_001220671.1.75740 WP_001220671.1.75745 WP_001220671.1.75760 WP_001220671.1.75764 WP_001220671.1.75828 WP_001220671.1.75837 WP_001220671.1.75844 WP_001220671.1.75873 WP_001220671.1.75874 WP_001220671.1.75884 WP_001220671.1.75886 WP_001220671.1.75898 WP_001220671.1.75932 WP_001220671.1.75945 WP_001220671.1.75957 WP_001220671.1.75997 WP_001220671.1.76 WP_001220671.1.76020 WP_001220671.1.76024 WP_001220671.1.76055 WP_001220671.1.76081 WP_001220671.1.76097 WP_001220671.1.76102 WP_001220671.1.76115 WP_001220671.1.76116 WP_001220671.1.76122 WP_001220671.1.76156 WP_001220671.1.76162 WP_001220671.1.76164 WP_001220671.1.76170 WP_001220671.1.76186 WP_001220671.1.76197 WP_001220671.1.76252 WP_001220671.1.76256 WP_001220671.1.7629 WP_001220671.1.76301 WP_001220671.1.76327 WP_001220671.1.7633 WP_001220671.1.76339 WP_001220671.1.7634 WP_001220671.1.76346 WP_001220671.1.76364 WP_001220671.1.76366 WP_001220671.1.76417 WP_001220671.1.76434 WP_001220671.1.76445 WP_001220671.1.7646 WP_001220671.1.76471 WP_001220671.1.76510 WP_001220671.1.76529 WP_001220671.1.76532 WP_001220671.1.76548 WP_001220671.1.7655 WP_001220671.1.76558 WP_001220671.1.7657 WP_001220671.1.76572 WP_001220671.1.76576 WP_001220671.1.7660 WP_001220671.1.76611 WP_001220671.1.76641 WP_001220671.1.76651 WP_001220671.1.76653 WP_001220671.1.76673 WP_001220671.1.76706 WP_001220671.1.7672 WP_001220671.1.76721 WP_001220671.1.76724 WP_001220671.1.76738 WP_001220671.1.76756 WP_001220671.1.76760 WP_001220671.1.76788 WP_001220671.1.76799 WP_001220671.1.76806 WP_001220671.1.7684 WP_001220671.1.76854 WP_001220671.1.76875 WP_001220671.1.76880 WP_001220671.1.76899 WP_001220671.1.76916 WP_001220671.1.76932 WP_001220671.1.76973 WP_001220671.1.76988 WP_001220671.1.77016 WP_001220671.1.77017 WP_001220671.1.77033 WP_001220671.1.77038 WP_001220671.1.77047 WP_001220671.1.77080 WP_001220671.1.77087 WP_001220671.1.77090 WP_001220671.1.77111 WP_001220671.1.7712 WP_001220671.1.77177 WP_001220671.1.77180 WP_001220671.1.77184 WP_001220671.1.77193 WP_001220671.1.77241 WP_001220671.1.77244 WP_001220671.1.77267 WP_001220671.1.77271 WP_001220671.1.77292 WP_001220671.1.77299 WP_001220671.1.77313 WP_001220671.1.77349 WP_001220671.1.77384 WP_001220671.1.77390 WP_001220671.1.77414 WP_001220671.1.77431 WP_001220671.1.77436 WP_001220671.1.77440 WP_001220671.1.77501 WP_001220671.1.77512 WP_001220671.1.77513 WP_001220671.1.77514 WP_001220671.1.77529 WP_001220671.1.77549 WP_001220671.1.77555 WP_001220671.1.77563 WP_001220671.1.77575 WP_001220671.1.77596 WP_001220671.1.77629 WP_001220671.1.77646 WP_001220671.1.77653 WP_001220671.1.77692 WP_001220671.1.77702 WP_001220671.1.77710 WP_001220671.1.77713 WP_001220671.1.7772 WP_001220671.1.77729 WP_001220671.1.77754 WP_001220671.1.77761 WP_001220671.1.7782 WP_001220671.1.77825 WP_001220671.1.77837 WP_001220671.1.7784 WP_001220671.1.77846 WP_001220671.1.77851 WP_001220671.1.77871 WP_001220671.1.77898 WP_001220671.1.77900 WP_001220671.1.77918 WP_001220671.1.77923 WP_001220671.1.77960 WP_001220671.1.77971 WP_001220671.1.77975 WP_001220671.1.77987 WP_001220671.1.78 WP_001220671.1.78016 WP_001220671.1.78026 WP_001220671.1.78033 WP_001220671.1.78035 WP_001220671.1.78048 WP_001220671.1.78053 WP_001220671.1.78076 WP_001220671.1.78096 WP_001220671.1.78100 WP_001220671.1.78107 WP_001220671.1.78110 WP_001220671.1.78120 WP_001220671.1.7814 WP_001220671.1.78166 WP_001220671.1.78168 WP_001220671.1.78170 WP_001220671.1.78180 WP_001220671.1.78192 WP_001220671.1.78195 WP_001220671.1.78201 WP_001220671.1.78245 WP_001220671.1.78259 WP_001220671.1.78291 WP_001220671.1.78301 WP_001220671.1.78309 WP_001220671.1.78320 WP_001220671.1.78339 WP_001220671.1.78352 WP_001220671.1.78366 WP_001220671.1.78372 WP_001220671.1.78382 WP_001220671.1.78383 WP_001220671.1.78388 WP_001220671.1.78407 WP_001220671.1.78410 WP_001220671.1.78495 WP_001220671.1.78496 WP_001220671.1.78502 WP_001220671.1.7861 WP_001220671.1.78618 WP_001220671.1.7862 WP_001220671.1.78626 WP_001220671.1.78661 WP_001220671.1.78673 WP_001220671.1.78674 WP_001220671.1.78676 WP_001220671.1.78715 WP_001220671.1.78735 WP_001220671.1.78738 WP_001220671.1.78761 WP_001220671.1.78771 WP_001220671.1.78789 WP_001220671.1.78802 WP_001220671.1.78830 WP_001220671.1.78835 WP_001220671.1.78838 WP_001220671.1.78862 WP_001220671.1.78871 WP_001220671.1.78874 WP_001220671.1.78881 WP_001220671.1.789 WP_001220671.1.7891 WP_001220671.1.78913 WP_001220671.1.78918 WP_001220671.1.78928 WP_001220671.1.7893 WP_001220671.1.78930 WP_001220671.1.78951 WP_001220671.1.78959 WP_001220671.1.78993 WP_001220671.1.79011 WP_001220671.1.79012 WP_001220671.1.79032 WP_001220671.1.79069 WP_001220671.1.79074 WP_001220671.1.79081 WP_001220671.1.79098 WP_001220671.1.79140 WP_001220671.1.79151 WP_001220671.1.79155 WP_001220671.1.79164 WP_001220671.1.79167 WP_001220671.1.79189 WP_001220671.1.79203 WP_001220671.1.79204 WP_001220671.1.79235 WP_001220671.1.79280 WP_001220671.1.79297 WP_001220671.1.79302 WP_001220671.1.79335 WP_001220671.1.79370 WP_001220671.1.79397 WP_001220671.1.79427 WP_001220671.1.79456 WP_001220671.1.79462 WP_001220671.1.79472 WP_001220671.1.79490 WP_001220671.1.79495 WP_001220671.1.79529 WP_001220671.1.79531 WP_001220671.1.79532 WP_001220671.1.79547 WP_001220671.1.7956 WP_001220671.1.79570 WP_001220671.1.7964 WP_001220671.1.79642 WP_001220671.1.79645 WP_001220671.1.79654 WP_001220671.1.79659 WP_001220671.1.79668 WP_001220671.1.7970 WP_001220671.1.79708 WP_001220671.1.7972 WP_001220671.1.79722 WP_001220671.1.79734 WP_001220671.1.79772 WP_001220671.1.79778 WP_001220671.1.7979 WP_001220671.1.79832 WP_001220671.1.79845 WP_001220671.1.79867 WP_001220671.1.79880 WP_001220671.1.79892 WP_001220671.1.79914 WP_001220671.1.79916 WP_001220671.1.79929 WP_001220671.1.79934 WP_001220671.1.79942 WP_001220671.1.79945 WP_001220671.1.79951 WP_001220671.1.79966 WP_001220671.1.79974 WP_001220671.1.79977 WP_001220671.1.79996 WP_001220671.1.80065 WP_001220671.1.80077 WP_001220671.1.80103 WP_001220671.1.80137 WP_001220671.1.80149 WP_001220671.1.80182 WP_001220671.1.80229 WP_001220671.1.80236 WP_001220671.1.8024 WP_001220671.1.80250 WP_001220671.1.80273 WP_001220671.1.80282 WP_001220671.1.80293 WP_001220671.1.80296 WP_001220671.1.80307 WP_001220671.1.80333 WP_001220671.1.80354 WP_001220671.1.80366 WP_001220671.1.80368 WP_001220671.1.80386 WP_001220671.1.80400 WP_001220671.1.80441 WP_001220671.1.80443 WP_001220671.1.80462 WP_001220671.1.80473 WP_001220671.1.80479 WP_001220671.1.80480 WP_001220671.1.8049 WP_001220671.1.80492 WP_001220671.1.80496 WP_001220671.1.80529 WP_001220671.1.80542 WP_001220671.1.80569 WP_001220671.1.80586 WP_001220671.1.80629 WP_001220671.1.80638 WP_001220671.1.80651 WP_001220671.1.80664 WP_001220671.1.80667 WP_001220671.1.80674 WP_001220671.1.80696 WP_001220671.1.80707 WP_001220671.1.80723 WP_001220671.1.80725 WP_001220671.1.80741 WP_001220671.1.80750 WP_001220671.1.80780 WP_001220671.1.80803 WP_001220671.1.80819 WP_001220671.1.80827 WP_001220671.1.80831 WP_001220671.1.80840 WP_001220671.1.80850 WP_001220671.1.80857 WP_001220671.1.80868 WP_001220671.1.80881 WP_001220671.1.80913 WP_001220671.1.80927 WP_001220671.1.80939 WP_001220671.1.80959 WP_001220671.1.8096 WP_001220671.1.80973 WP_001220671.1.80984 WP_001220671.1.81037 WP_001220671.1.81041 WP_001220671.1.81062 WP_001220671.1.81067 WP_001220671.1.81069 WP_001220671.1.81084 WP_001220671.1.81107 WP_001220671.1.81118 WP_001220671.1.81131 WP_001220671.1.81149 WP_001220671.1.81175 WP_001220671.1.81187 WP_001220671.1.8119 WP_001220671.1.81193 WP_001220671.1.81231 WP_001220671.1.81262 WP_001220671.1.81268 WP_001220671.1.81269 WP_001220671.1.8127 WP_001220671.1.81271 WP_001220671.1.81275 WP_001220671.1.81302 WP_001220671.1.81305 WP_001220671.1.8131 WP_001220671.1.81320 WP_001220671.1.81321 WP_001220671.1.81328 WP_001220671.1.81333 WP_001220671.1.81342 WP_001220671.1.81354 WP_001220671.1.81364 WP_001220671.1.81404 WP_001220671.1.81409 WP_001220671.1.81410 WP_001220671.1.81425 WP_001220671.1.81472 WP_001220671.1.81494 WP_001220671.1.81504 WP_001220671.1.81528 WP_001220671.1.81548 WP_001220671.1.81557 WP_001220671.1.81568 WP_001220671.1.81676 WP_001220671.1.8168 WP_001220671.1.81681 WP_001220671.1.8170 WP_001220671.1.81727 WP_001220671.1.81735 WP_001220671.1.81736 WP_001220671.1.81743 WP_001220671.1.81746 WP_001220671.1.81750 WP_001220671.1.81760 WP_001220671.1.81763 WP_001220671.1.81785 WP_001220671.1.81795 WP_001220671.1.81798 WP_001220671.1.81855 WP_001220671.1.81902 WP_001220671.1.81921 WP_001220671.1.81931 WP_001220671.1.81936 WP_001220671.1.81941 WP_001220671.1.81949 WP_001220671.1.8196 WP_001220671.1.81965 WP_001220671.1.81974 WP_001220671.1.81977 WP_001220671.1.81995 WP_001220671.1.82037 WP_001220671.1.82070 WP_001220671.1.82076 WP_001220671.1.82099 WP_001220671.1.82131 WP_001220671.1.82141 WP_001220671.1.82144 WP_001220671.1.82156 WP_001220671.1.8218 WP_001220671.1.82180 WP_001220671.1.82192 WP_001220671.1.82201 WP_001220671.1.82214 WP_001220671.1.82225 WP_001220671.1.82232 WP_001220671.1.82258 WP_001220671.1.82269 WP_001220671.1.82337 WP_001220671.1.82347 WP_001220671.1.82352 WP_001220671.1.8236 WP_001220671.1.82369 WP_001220671.1.82395 WP_001220671.1.8240 WP_001220671.1.82408 WP_001220671.1.82416 WP_001220671.1.8242 WP_001220671.1.82456 WP_001220671.1.82464 WP_001220671.1.82465 WP_001220671.1.82473 WP_001220671.1.82479 WP_001220671.1.82503 WP_001220671.1.82515 WP_001220671.1.82529 WP_001220671.1.82530 WP_001220671.1.82553 WP_001220671.1.82562 WP_001220671.1.82570 WP_001220671.1.82584 WP_001220671.1.82636 WP_001220671.1.82637 WP_001220671.1.82646 WP_001220671.1.82670 WP_001220671.1.82676 WP_001220671.1.82692 WP_001220671.1.82731 WP_001220671.1.82761 WP_001220671.1.82763 WP_001220671.1.82812 WP_001220671.1.8282 WP_001220671.1.82841 WP_001220671.1.82843 WP_001220671.1.82850 WP_001220671.1.82865 WP_001220671.1.82867 WP_001220671.1.82872 WP_001220671.1.82886 WP_001220671.1.82899 WP_001220671.1.82908 WP_001220671.1.82937 WP_001220671.1.8294 WP_001220671.1.82944 WP_001220671.1.82946 WP_001220671.1.82956 WP_001220671.1.82959 WP_001220671.1.82964 WP_001220671.1.82992 WP_001220671.1.83007 WP_001220671.1.8304 WP_001220671.1.83092 WP_001220671.1.83119 WP_001220671.1.83128 WP_001220671.1.83139 WP_001220671.1.83163 WP_001220671.1.83180 WP_001220671.1.8322 WP_001220671.1.83221 WP_001220671.1.83229 WP_001220671.1.83235 WP_001220671.1.83247 WP_001220671.1.83252 WP_001220671.1.83258 WP_001220671.1.83280 WP_001220671.1.83290 WP_001220671.1.83301 WP_001220671.1.83305 WP_001220671.1.83333 WP_001220671.1.83360 WP_001220671.1.83365 WP_001220671.1.83378 WP_001220671.1.83382 WP_001220671.1.83388 WP_001220671.1.83407 WP_001220671.1.83413 WP_001220671.1.83491 WP_001220671.1.83510 WP_001220671.1.83516 WP_001220671.1.83523 WP_001220671.1.8354 WP_001220671.1.83572 WP_001220671.1.83598 WP_001220671.1.83650 WP_001220671.1.83651 WP_001220671.1.83657 WP_001220671.1.83677 WP_001220671.1.83710 WP_001220671.1.83721 WP_001220671.1.83739 WP_001220671.1.8375 WP_001220671.1.83759 WP_001220671.1.83760 WP_001220671.1.83806 WP_001220671.1.83854 WP_001220671.1.83897 WP_001220671.1.83923 WP_001220671.1.83960 WP_001220671.1.83979 WP_001220671.1.83994 WP_001220671.1.83995 WP_001220671.1.84 WP_001220671.1.84001 WP_001220671.1.84031 WP_001220671.1.8406 WP_001220671.1.84076 WP_001220671.1.84077 WP_001220671.1.84100 WP_001220671.1.84103 WP_001220671.1.84106 WP_001220671.1.84110 WP_001220671.1.84115 WP_001220671.1.84127 WP_001220671.1.84150 WP_001220671.1.84168 WP_001220671.1.84179 WP_001220671.1.84198 WP_001220671.1.84205 WP_001220671.1.84209 WP_001220671.1.84229 WP_001220671.1.84230 WP_001220671.1.84252 WP_001220671.1.84283 WP_001220671.1.84291 WP_001220671.1.8431 WP_001220671.1.84325 WP_001220671.1.84345 WP_001220671.1.84355 WP_001220671.1.84369 WP_001220671.1.84392 WP_001220671.1.84397 WP_001220671.1.84401 WP_001220671.1.84403 WP_001220671.1.8441 WP_001220671.1.84435 WP_001220671.1.84461 WP_001220671.1.84475 WP_001220671.1.84523 WP_001220671.1.84532 WP_001220671.1.84551 WP_001220671.1.84554 WP_001220671.1.84567 WP_001220671.1.84631 WP_001220671.1.84644 WP_001220671.1.84659 WP_001220671.1.84683 WP_001220671.1.84693 WP_001220671.1.84711 WP_001220671.1.84721 WP_001220671.1.84727 WP_001220671.1.84744 WP_001220671.1.84745 WP_001220671.1.84773 WP_001220671.1.84814 WP_001220671.1.84872 WP_001220671.1.84879 WP_001220671.1.84899 WP_001220671.1.849 WP_001220671.1.84945 WP_001220671.1.84967 WP_001220671.1.8497 WP_001220671.1.850 WP_001220671.1.85004 WP_001220671.1.85014 WP_001220671.1.8502 WP_001220671.1.85031 WP_001220671.1.85039 WP_001220671.1.85040 WP_001220671.1.85094 WP_001220671.1.85134 WP_001220671.1.85147 WP_001220671.1.85153 WP_001220671.1.85178 WP_001220671.1.85180 WP_001220671.1.85190 WP_001220671.1.85217 WP_001220671.1.85273 WP_001220671.1.8533 WP_001220671.1.85338 WP_001220671.1.85339 WP_001220671.1.8537 WP_001220671.1.85408 WP_001220671.1.85433 WP_001220671.1.8545 WP_001220671.1.85456 WP_001220671.1.85469 WP_001220671.1.85481 WP_001220671.1.85483 WP_001220671.1.85511 WP_001220671.1.85512 WP_001220671.1.85541 WP_001220671.1.8556 WP_001220671.1.85568 WP_001220671.1.8557 WP_001220671.1.85606 WP_001220671.1.85615 WP_001220671.1.85617 WP_001220671.1.85635 WP_001220671.1.85646 WP_001220671.1.85654 WP_001220671.1.85663 WP_001220671.1.85665 WP_001220671.1.85669 WP_001220671.1.85671 WP_001220671.1.85672 WP_001220671.1.85675 WP_001220671.1.85688 WP_001220671.1.85703 WP_001220671.1.85728 WP_001220671.1.85742 WP_001220671.1.85746 WP_001220671.1.85777 WP_001220671.1.85780 WP_001220671.1.85784 WP_001220671.1.85791 WP_001220671.1.85797 WP_001220671.1.85811 WP_001220671.1.85854 WP_001220671.1.85855 WP_001220671.1.85864 WP_001220671.1.85886 WP_001220671.1.859 WP_001220671.1.85900 WP_001220671.1.85904 WP_001220671.1.8591 WP_001220671.1.85917 WP_001220671.1.8594 WP_001220671.1.85943 WP_001220671.1.85976 WP_001220671.1.85977 WP_001220671.1.860 WP_001220671.1.86007 WP_001220671.1.86010 WP_001220671.1.86017 WP_001220671.1.86043 WP_001220671.1.8605 WP_001220671.1.86084 WP_001220671.1.86092 WP_001220671.1.8610 WP_001220671.1.86120 WP_001220671.1.86126 WP_001220671.1.8614 WP_001220671.1.86156 WP_001220671.1.86173 WP_001220671.1.86206 WP_001220671.1.86224 WP_001220671.1.86259 WP_001220671.1.86284 WP_001220671.1.86285 WP_001220671.1.86306 WP_001220671.1.86310 WP_001220671.1.86323 WP_001220671.1.86335 WP_001220671.1.86342 WP_001220671.1.86356 WP_001220671.1.86389 WP_001220671.1.8640 WP_001220671.1.8642 WP_001220671.1.86426 WP_001220671.1.86442 WP_001220671.1.86450 WP_001220671.1.86453 WP_001220671.1.86466 WP_001220671.1.86469 WP_001220671.1.86489 WP_001220671.1.86530 WP_001220671.1.86580 WP_001220671.1.86588 WP_001220671.1.86601 WP_001220671.1.86634 WP_001220671.1.86656 WP_001220671.1.86658 WP_001220671.1.86661 WP_001220671.1.86663 WP_001220671.1.86676 WP_001220671.1.86699 WP_001220671.1.8671 WP_001220671.1.8672 WP_001220671.1.86735 WP_001220671.1.86744 WP_001220671.1.86770 WP_001220671.1.8678 WP_001220671.1.86794 WP_001220671.1.86800 WP_001220671.1.86807 WP_001220671.1.86810 WP_001220671.1.86811 WP_001220671.1.86815 WP_001220671.1.8684 WP_001220671.1.86860 WP_001220671.1.86895 WP_001220671.1.86902 WP_001220671.1.86906 WP_001220671.1.8691 WP_001220671.1.86921 WP_001220671.1.86945 WP_001220671.1.86989 WP_001220671.1.87023 WP_001220671.1.87034 WP_001220671.1.87041 WP_001220671.1.87051 WP_001220671.1.87095 WP_001220671.1.87136 WP_001220671.1.87143 WP_001220671.1.87148 WP_001220671.1.87155 WP_001220671.1.87219 WP_001220671.1.8722 WP_001220671.1.87220 WP_001220671.1.87258 WP_001220671.1.87276 WP_001220671.1.87282 WP_001220671.1.87283 WP_001220671.1.87293 WP_001220671.1.87323 WP_001220671.1.87346 WP_001220671.1.8736 WP_001220671.1.87370 WP_001220671.1.87376 WP_001220671.1.87420 WP_001220671.1.87460 WP_001220671.1.87493 WP_001220671.1.87528 WP_001220671.1.87552 WP_001220671.1.87560 WP_001220671.1.87584 WP_001220671.1.8760 WP_001220671.1.87600 WP_001220671.1.87609 WP_001220671.1.87612 WP_001220671.1.87615 WP_001220671.1.87618 WP_001220671.1.87626 WP_001220671.1.87651 WP_001220671.1.87653 WP_001220671.1.87659 WP_001220671.1.8767 WP_001220671.1.87687 WP_001220671.1.87695 WP_001220671.1.87698 WP_001220671.1.87706 WP_001220671.1.87739 WP_001220671.1.87741 WP_001220671.1.87742 WP_001220671.1.87779 WP_001220671.1.87813 WP_001220671.1.87852 WP_001220671.1.87875 WP_001220671.1.87891 WP_001220671.1.87899 WP_001220671.1.8792 WP_001220671.1.87933 WP_001220671.1.87945 WP_001220671.1.87949 WP_001220671.1.87999 WP_001220671.1.8800 WP_001220671.1.88014 WP_001220671.1.88019 WP_001220671.1.88025 WP_001220671.1.88026 WP_001220671.1.8805 WP_001220671.1.8806 WP_001220671.1.88073 WP_001220671.1.8809 WP_001220671.1.881 WP_001220671.1.88136 WP_001220671.1.88145 WP_001220671.1.88165 WP_001220671.1.88174 WP_001220671.1.88199 WP_001220671.1.88214 WP_001220671.1.88222 WP_001220671.1.88244 WP_001220671.1.88264 WP_001220671.1.88291 WP_001220671.1.88293 WP_001220671.1.88299 WP_001220671.1.88303 WP_001220671.1.88313 WP_001220671.1.88359 WP_001220671.1.8837 WP_001220671.1.88393 WP_001220671.1.88407 WP_001220671.1.88414 WP_001220671.1.88423 WP_001220671.1.88444 WP_001220671.1.88446 WP_001220671.1.88458 WP_001220671.1.88483 WP_001220671.1.8849 WP_001220671.1.88501 WP_001220671.1.88538 WP_001220671.1.88547 WP_001220671.1.88597 WP_001220671.1.886 WP_001220671.1.88609 WP_001220671.1.88620 WP_001220671.1.88624 WP_001220671.1.88647 WP_001220671.1.88648 WP_001220671.1.88651 WP_001220671.1.88675 WP_001220671.1.88683 WP_001220671.1.88692 WP_001220671.1.88698 WP_001220671.1.88703 WP_001220671.1.88707 WP_001220671.1.88727 WP_001220671.1.88762 WP_001220671.1.88772 WP_001220671.1.88776 WP_001220671.1.88792 WP_001220671.1.88817 WP_001220671.1.88845 WP_001220671.1.88850 WP_001220671.1.8889 WP_001220671.1.88892 WP_001220671.1.88894 WP_001220671.1.88902 WP_001220671.1.8891 WP_001220671.1.88942 WP_001220671.1.88957 WP_001220671.1.88967 WP_001220671.1.88970 WP_001220671.1.88980 WP_001220671.1.88981 WP_001220671.1.88995 WP_001220671.1.89008 WP_001220671.1.89054 WP_001220671.1.89114 WP_001220671.1.89116 WP_001220671.1.89119 WP_001220671.1.89138 WP_001220671.1.89169 WP_001220671.1.89174 WP_001220671.1.89182 WP_001220671.1.89188 WP_001220671.1.89215 WP_001220671.1.89291 WP_001220671.1.89298 WP_001220671.1.89304 WP_001220671.1.89308 WP_001220671.1.89311 WP_001220671.1.89314 WP_001220671.1.89328 WP_001220671.1.89332 WP_001220671.1.89343 WP_001220671.1.89354 WP_001220671.1.89355 WP_001220671.1.89395 WP_001220671.1.8940 WP_001220671.1.89449 WP_001220671.1.89452 WP_001220671.1.89462 WP_001220671.1.8947 WP_001220671.1.89503 WP_001220671.1.89512 WP_001220671.1.89527 WP_001220671.1.89570 WP_001220671.1.8958 WP_001220671.1.89580 WP_001220671.1.89591 WP_001220671.1.89604 WP_001220671.1.89612 WP_001220671.1.89622 WP_001220671.1.89632 WP_001220671.1.89636 WP_001220671.1.89647 WP_001220671.1.89657 WP_001220671.1.89659 WP_001220671.1.89668 WP_001220671.1.89706 WP_001220671.1.89713 WP_001220671.1.89733 WP_001220671.1.89746 WP_001220671.1.89764 WP_001220671.1.89765 WP_001220671.1.89777 WP_001220671.1.89789 WP_001220671.1.89796 WP_001220671.1.89804 WP_001220671.1.89815 WP_001220671.1.89817 WP_001220671.1.89845 WP_001220671.1.89854 WP_001220671.1.89870 WP_001220671.1.89888 WP_001220671.1.89902 WP_001220671.1.89911 WP_001220671.1.89914 WP_001220671.1.89940 WP_001220671.1.8995 WP_001220671.1.89952 WP_001220671.1.8996 WP_001220671.1.89965 WP_001220671.1.89975 WP_001220671.1.90007 WP_001220671.1.9002 WP_001220671.1.90033 WP_001220671.1.90084 WP_001220671.1.90097 WP_001220671.1.90108 WP_001220671.1.9011 WP_001220671.1.90196 WP_001220671.1.90211 WP_001220671.1.90220 WP_001220671.1.90240 WP_001220671.1.90248 WP_001220671.1.90252 WP_001220671.1.90274 WP_001220671.1.90280 WP_001220671.1.90293 WP_001220671.1.90311 WP_001220671.1.90330 WP_001220671.1.90338 WP_001220671.1.90348 WP_001220671.1.90363 WP_001220671.1.90365 WP_001220671.1.90409 WP_001220671.1.90417 WP_001220671.1.90428 WP_001220671.1.90440 WP_001220671.1.90453 WP_001220671.1.90458 WP_001220671.1.90472 WP_001220671.1.90489 WP_001220671.1.90513 WP_001220671.1.90521 WP_001220671.1.90557 WP_001220671.1.90566 WP_001220671.1.90582 WP_001220671.1.90585 WP_001220671.1.90620 WP_001220671.1.90625 WP_001220671.1.9064 WP_001220671.1.90641 WP_001220671.1.90686 WP_001220671.1.90713 WP_001220671.1.90734 WP_001220671.1.90792 WP_001220671.1.90794 WP_001220671.1.90796 WP_001220671.1.90811 WP_001220671.1.90866 WP_001220671.1.90876 WP_001220671.1.90878 WP_001220671.1.9089 WP_001220671.1.9091 WP_001220671.1.90984 WP_001220671.1.90991 WP_001220671.1.91003 WP_001220671.1.91023 WP_001220671.1.91042 WP_001220671.1.91049 WP_001220671.1.91056 WP_001220671.1.91067 WP_001220671.1.91069 WP_001220671.1.91107 WP_001220671.1.91156 WP_001220671.1.91164 WP_001220671.1.91179 WP_001220671.1.91205 WP_001220671.1.91239 WP_001220671.1.91278 WP_001220671.1.91282 WP_001220671.1.91291 WP_001220671.1.9131 WP_001220671.1.91312 WP_001220671.1.91313 WP_001220671.1.91331 WP_001220671.1.91334 WP_001220671.1.9135 WP_001220671.1.91381 WP_001220671.1.91405 WP_001220671.1.91453 WP_001220671.1.91459 WP_001220671.1.91470 WP_001220671.1.91473 WP_001220671.1.91493 WP_001220671.1.91506 WP_001220671.1.91512 WP_001220671.1.91524 WP_001220671.1.91557 WP_001220671.1.91564 WP_001220671.1.91579 WP_001220671.1.91580 WP_001220671.1.91597 WP_001220671.1.91621 WP_001220671.1.91625 WP_001220671.1.91628 WP_001220671.1.91655 WP_001220671.1.9166 WP_001220671.1.91702 WP_001220671.1.91715 WP_001220671.1.91724 WP_001220671.1.91732 WP_001220671.1.91736 WP_001220671.1.91788 WP_001220671.1.91806 WP_001220671.1.91864 WP_001220671.1.9187 WP_001220671.1.91870 WP_001220671.1.91903 WP_001220671.1.91914 WP_001220671.1.91984 WP_001220671.1.92013 WP_001220671.1.92018 WP_001220671.1.92039 WP_001220671.1.92044 WP_001220671.1.92060 WP_001220671.1.92067 WP_001220671.1.92068 WP_001220671.1.92087 WP_001220671.1.92093 WP_001220671.1.92098 WP_001220671.1.92099 WP_001220671.1.92108 WP_001220671.1.92149 WP_001220671.1.92156 WP_001220671.1.92165 WP_001220671.1.92171 WP_001220671.1.92172 WP_001220671.1.92183 WP_001220671.1.92208 WP_001220671.1.92213 WP_001220671.1.92240 WP_001220671.1.92243 WP_001220671.1.92268 WP_001220671.1.92270 WP_001220671.1.92299 WP_001220671.1.92310 WP_001220671.1.92318 WP_001220671.1.92327 WP_001220671.1.92375 WP_001220671.1.92394 WP_001220671.1.92396 WP_001220671.1.92399 WP_001220671.1.92408 WP_001220671.1.92411 WP_001220671.1.92443 WP_001220671.1.92470 WP_001220671.1.92477 WP_001220671.1.92482 WP_001220671.1.92529 WP_001220671.1.9253 WP_001220671.1.92531 WP_001220671.1.92545 WP_001220671.1.92562 WP_001220671.1.92570 WP_001220671.1.92575 WP_001220671.1.92588 WP_001220671.1.926 WP_001220671.1.92633 WP_001220671.1.92646 WP_001220671.1.92649 WP_001220671.1.92659 WP_001220671.1.92669 WP_001220671.1.92671 WP_001220671.1.92676 WP_001220671.1.92705 WP_001220671.1.9271 WP_001220671.1.92729 WP_001220671.1.92734 WP_001220671.1.92738 WP_001220671.1.92758 WP_001220671.1.92786 WP_001220671.1.92810 WP_001220671.1.92823 WP_001220671.1.92827 WP_001220671.1.92832 WP_001220671.1.92836 WP_001220671.1.92842 WP_001220671.1.92843 WP_001220671.1.92875 WP_001220671.1.92879 WP_001220671.1.92883 WP_001220671.1.92893 WP_001220671.1.92895 WP_001220671.1.92926 WP_001220671.1.92936 WP_001220671.1.92939 WP_001220671.1.92947 WP_001220671.1.92975 WP_001220671.1.92987 WP_001220671.1.92988 WP_001220671.1.93007 WP_001220671.1.93022 WP_001220671.1.93059 WP_001220671.1.93061 WP_001220671.1.93086 WP_001220671.1.93101 WP_001220671.1.93103 WP_001220671.1.93105 WP_001220671.1.93111 WP_001220671.1.93118 WP_001220671.1.93121 WP_001220671.1.93136 WP_001220671.1.93155 WP_001220671.1.93168 WP_001220671.1.93184 WP_001220671.1.93213 WP_001220671.1.93221 WP_001220671.1.93223 WP_001220671.1.93239 WP_001220671.1.93275 WP_001220671.1.93302 WP_001220671.1.93322 WP_001220671.1.93339 WP_001220671.1.9336 WP_001220671.1.93365 WP_001220671.1.93376 WP_001220671.1.93387 WP_001220671.1.93469 WP_001220671.1.93511 WP_001220671.1.93512 WP_001220671.1.93543 WP_001220671.1.93604 WP_001220671.1.93635 WP_001220671.1.93648 WP_001220671.1.93650 WP_001220671.1.93656 WP_001220671.1.93657 WP_001220671.1.93662 WP_001220671.1.93671 WP_001220671.1.93691 WP_001220671.1.937 WP_001220671.1.93705 WP_001220671.1.9374 WP_001220671.1.93741 WP_001220671.1.9375 WP_001220671.1.93754 WP_001220671.1.93761 WP_001220671.1.93767 WP_001220671.1.93780 WP_001220671.1.93803 WP_001220671.1.93804 WP_001220671.1.93828 WP_001220671.1.93837 WP_001220671.1.93842 WP_001220671.1.93843 WP_001220671.1.93875 WP_001220671.1.9389 WP_001220671.1.93909 WP_001220671.1.93919 WP_001220671.1.93937 WP_001220671.1.93938 WP_001220671.1.9394 WP_001220671.1.93956 WP_001220671.1.93984 WP_001220671.1.93986 WP_001220671.1.9399 WP_001220671.1.93994 WP_001220671.1.94017 WP_001220671.1.94039 WP_001220671.1.94064 WP_001220671.1.94070 WP_001220671.1.94071 WP_001220671.1.94072 WP_001220671.1.94079 WP_001220671.1.94097 WP_001220671.1.94107 WP_001220671.1.94132 WP_001220671.1.94142 WP_001220671.1.94162 WP_001220671.1.94167 WP_001220671.1.94168 WP_001220671.1.94181 WP_001220671.1.94198 WP_001220671.1.94215 WP_001220671.1.94303 WP_001220671.1.9432 WP_001220671.1.94352 WP_001220671.1.94354 WP_001220671.1.94365 WP_001220671.1.94379 WP_001220671.1.94380 WP_001220671.1.94383 WP_001220671.1.94390 WP_001220671.1.94412 WP_001220671.1.94415 WP_001220671.1.94458 WP_001220671.1.94492 WP_001220671.1.94510 WP_001220671.1.94527 WP_001220671.1.94557 WP_001220671.1.94562 WP_001220671.1.94565 WP_001220671.1.94573 WP_001220671.1.94579 WP_001220671.1.94584 WP_001220671.1.94586 WP_001220671.1.94588 WP_001220671.1.94593 WP_001220671.1.94650 WP_001220671.1.94655 WP_001220671.1.94659 WP_001220671.1.94662 WP_001220671.1.94669 WP_001220671.1.94674 WP_001220671.1.94700 WP_001220671.1.94717 WP_001220671.1.94722 WP_001220671.1.94745 WP_001220671.1.94782 WP_001220671.1.94796 WP_001220671.1.94798 WP_001220671.1.9481 WP_001220671.1.94815 WP_001220671.1.94820 WP_001220671.1.94849 WP_001220671.1.94850 WP_001220671.1.94851 WP_001220671.1.94862 WP_001220671.1.94864 WP_001220671.1.94921 WP_001220671.1.94947 WP_001220671.1.94952 WP_001220671.1.94959 WP_001220671.1.94967 WP_001220671.1.94971 WP_001220671.1.94982 WP_001220671.1.94986 WP_001220671.1.94987 WP_001220671.1.95006 WP_001220671.1.95051 WP_001220671.1.95055 WP_001220671.1.95076 WP_001220671.1.95085 WP_001220671.1.95094 WP_001220671.1.95099 WP_001220671.1.95121 WP_001220671.1.95133 WP_001220671.1.95152 WP_001220671.1.95165 WP_001220671.1.95171 WP_001220671.1.95235 WP_001220671.1.95239 WP_001220671.1.95246 WP_001220671.1.95248 WP_001220671.1.95249 WP_001220671.1.9525 WP_001220671.1.95255 WP_001220671.1.95265 WP_001220671.1.95277 WP_001220671.1.95282 WP_001220671.1.95289 WP_001220671.1.95298 WP_001220671.1.9530 WP_001220671.1.95320 WP_001220671.1.95338 WP_001220671.1.95388 WP_001220671.1.95404 WP_001220671.1.95412 WP_001220671.1.95465 WP_001220671.1.95530 WP_001220671.1.95546 WP_001220671.1.95547 WP_001220671.1.95579 WP_001220671.1.95590 WP_001220671.1.95623 WP_001220671.1.95625 WP_001220671.1.95630 WP_001220671.1.95641 WP_001220671.1.95670 WP_001220671.1.95675 WP_001220671.1.95691 WP_001220671.1.95701 WP_001220671.1.95703 WP_001220671.1.95716 WP_001220671.1.95729 WP_001220671.1.9574 WP_001220671.1.95744 WP_001220671.1.95776 WP_001220671.1.95803 WP_001220671.1.95805 WP_001220671.1.95826 WP_001220671.1.95840 WP_001220671.1.95884 WP_001220671.1.95890 WP_001220671.1.95901 WP_001220671.1.95906 WP_001220671.1.95911 WP_001220671.1.95939 WP_001220671.1.95940 WP_001220671.1.96004 WP_001220671.1.96025 WP_001220671.1.96042 WP_001220671.1.96044 WP_001220671.1.96045 WP_001220671.1.96054 WP_001220671.1.9609 WP_001220671.1.96094 WP_001220671.1.96127 WP_001220671.1.96139 WP_001220671.1.96141 WP_001220671.1.96144 WP_001220671.1.96162 WP_001220671.1.96172 WP_001220671.1.96188 WP_001220671.1.96190 WP_001220671.1.96203 WP_001220671.1.96206 WP_001220671.1.96211 WP_001220671.1.96212 WP_001220671.1.9627 WP_001220671.1.9628 WP_001220671.1.96317 WP_001220671.1.96319 WP_001220671.1.9633 WP_001220671.1.96335 WP_001220671.1.96343 WP_001220671.1.96359 WP_001220671.1.96404 WP_001220671.1.96429 WP_001220671.1.9644 WP_001220671.1.96469 WP_001220671.1.96497 WP_001220671.1.96500 WP_001220671.1.96533 WP_001220671.1.96539 WP_001220671.1.96552 WP_001220671.1.96555 WP_001220671.1.96563 WP_001220671.1.96590 WP_001220671.1.96600 WP_001220671.1.96610 WP_001220671.1.96625 WP_001220671.1.96635 WP_001220671.1.9664 WP_001220671.1.96640 WP_001220671.1.96642 WP_001220671.1.96662 WP_001220671.1.96675 WP_001220671.1.9670 WP_001220671.1.96721 WP_001220671.1.96731 WP_001220671.1.96732 WP_001220671.1.9674 WP_001220671.1.96750 WP_001220671.1.96758 WP_001220671.1.96761 WP_001220671.1.96771 WP_001220671.1.96792 WP_001220671.1.96801 WP_001220671.1.96803 WP_001220671.1.96810 WP_001220671.1.9686 WP_001220671.1.96890 WP_001220671.1.96902 WP_001220671.1.96917 WP_001220671.1.96925 WP_001220671.1.96938 WP_001220671.1.96946 WP_001220671.1.96957 WP_001220671.1.96978 WP_001220671.1.97005 WP_001220671.1.97015 WP_001220671.1.97026 WP_001220671.1.97028 WP_001220671.1.97043 WP_001220671.1.97047 WP_001220671.1.97079 WP_001220671.1.97089 WP_001220671.1.97109 WP_001220671.1.97143 WP_001220671.1.97145 WP_001220671.1.97154 WP_001220671.1.97184 WP_001220671.1.97185 WP_001220671.1.97190 WP_001220671.1.97224 WP_001220671.1.97260 WP_001220671.1.97287 WP_001220671.1.97291 WP_001220671.1.97297 WP_001220671.1.97318 WP_001220671.1.97337 WP_001220671.1.97368 WP_001220671.1.97369 WP_001220671.1.97386 WP_001220671.1.97413 WP_001220671.1.97422 WP_001220671.1.97441 WP_001220671.1.97477 WP_001220671.1.97480 WP_001220671.1.97487 WP_001220671.1.97496 WP_001220671.1.97497 WP_001220671.1.97505 WP_001220671.1.97594 WP_001220671.1.97597 WP_001220671.1.97599 WP_001220671.1.97606 WP_001220671.1.97613 WP_001220671.1.97615 WP_001220671.1.97620 WP_001220671.1.97626 WP_001220671.1.97628 WP_001220671.1.97631 WP_001220671.1.97646 WP_001220671.1.97690 WP_001220671.1.97691 WP_001220671.1.97693 WP_001220671.1.97725 WP_001220671.1.97726 WP_001220671.1.97727 WP_001220671.1.97732 WP_001220671.1.97736 WP_001220671.1.9775 WP_001220671.1.97768 WP_001220671.1.97772 WP_001220671.1.97819 WP_001220671.1.97840 WP_001220671.1.97846 WP_001220671.1.97873 WP_001220671.1.97938 WP_001220671.1.97983 WP_001220671.1.97986 WP_001220671.1.9799 WP_001220671.1.98006 WP_001220671.1.98019 WP_001220671.1.98022 WP_001220671.1.98036 WP_001220671.1.9805 WP_001220671.1.98080 WP_001220671.1.98086 WP_001220671.1.98107 WP_001220671.1.9811 WP_001220671.1.98110 WP_001220671.1.98124 WP_001220671.1.98146 WP_001220671.1.98158 WP_001220671.1.98170 WP_001220671.1.98201 WP_001220671.1.98219 WP_001220671.1.98236 WP_001220671.1.98250 WP_001220671.1.9826 WP_001220671.1.98263 WP_001220671.1.98314 WP_001220671.1.98392 WP_001220671.1.98402 WP_001220671.1.98403 WP_001220671.1.9841 WP_001220671.1.98418 WP_001220671.1.98438 WP_001220671.1.98446 WP_001220671.1.98448 WP_001220671.1.98457 WP_001220671.1.98483 WP_001220671.1.98495 WP_001220671.1.9850 WP_001220671.1.98502 WP_001220671.1.98531 WP_001220671.1.98551 WP_001220671.1.98577 WP_001220671.1.98607 WP_001220671.1.98608 WP_001220671.1.98627 WP_001220671.1.9863 WP_001220671.1.98634 WP_001220671.1.98676 WP_001220671.1.98677 WP_001220671.1.98731 WP_001220671.1.98751 WP_001220671.1.98760 WP_001220671.1.98762 WP_001220671.1.98763 WP_001220671.1.9877 WP_001220671.1.98779 WP_001220671.1.98801 WP_001220671.1.98818 WP_001220671.1.98843 WP_001220671.1.9887 WP_001220671.1.98899 WP_001220671.1.98931 WP_001220671.1.98947 WP_001220671.1.9898 WP_001220671.1.99040 WP_001220671.1.99071 WP_001220671.1.99072 WP_001220671.1.99073 WP_001220671.1.99083 WP_001220671.1.99098 WP_001220671.1.99107 WP_001220671.1.99163 WP_001220671.1.99184 WP_001220671.1.9919 WP_001220671.1.99197 WP_001220671.1.99198 WP_001220671.1.99219 WP_001220671.1.99255 WP_001220671.1.99267 WP_001220671.1.99276 WP_001220671.1.99278 WP_001220671.1.99320 WP_001220671.1.99327 WP_001220671.1.99335 WP_001220671.1.99339 WP_001220671.1.99350 WP_001220671.1.99360 WP_001220671.1.99363 WP_001220671.1.99369 WP_001220671.1.99370 WP_001220671.1.99388 WP_001220671.1.99397 WP_001220671.1.99426 WP_001220671.1.99463 WP_001220671.1.99469 WP_001220671.1.99483 WP_001220671.1.99531 WP_001220671.1.9954 WP_001220671.1.99546 WP_001220671.1.99561 WP_001220671.1.99579 WP_001220671.1.99595 WP_001220671.1.99626 WP_001220671.1.99637 WP_001220671.1.99646 WP_001220671.1.99657 WP_001220671.1.99660 WP_001220671.1.99671 WP_001220671.1.99676 WP_001220671.1.99712 WP_001220671.1.99725 WP_001220671.1.99747 WP_001220671.1.99764 WP_001220671.1.99783 WP_001220671.1.99813 WP_001220671.1.99824 WP_001220671.1.99829 WP_001220671.1.99837 WP_001220671.1.99841 WP_001220671.1.99858 WP_001220671.1.99889 WP_001220671.1.9992 WP_001220671.1.99958 WP_001220671.1.99996 gi|56413944|ref|YP_151019.1| gi|526219800|ref|YP_008265261.1| gi|16764418|ref|NP_460033.1| ABAK02000001|CDS_461785-462327 ABAM02000001|CDS_1557551-1558093 ABAO01000024|CDS_57201-57743 ABEH02000007|CDS_332213-332755 ABEI01000017|CDS_36200-36742 ABEJ01000009|CDS_31428-31970 ABEL01000010|CDS_80247-80789 ABEW01000012|CDS_13081-13623 ABFF01000016|CDS_11451-10909 ABFG01000025|CDS_12691-12149 ABFH02000002|CDS_999227-998685 AE006468|CDS_1148137-1148679 AE017220|CDS_1128751-1129293 CP000026|CDS_1850186-1849644 CP000857|CDS_2727131-2726589 CP000886|CDS_2059901-2059359 CP001120|CDS_1152862-1153404 CP001127|CDS_1107025-1107567 CP001138|CDS_1017687-1018229 CP001363|CDS_1106482-1107024 FM200053|CDS_1845369-1844827 FN424405|CDS_1144827-1145369 NZ_ACBF01000022|CDS_5984-5442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]