SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449764|ref|YP_005237123.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449764|ref|YP_005237123.1|
Domain Number 1 Region: 16-182
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0000000000086
Family TM1287-like 0.036
Further Details:      
 
Domain Number 2 Region: 211-255
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000112
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449764|ref|YP_005237123.1|
Sequence length 264
Comment putative regulatory protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MIGLRLDGYDPDLHHDAAVAFCIRARDDELFSPRHQHRKGQLILALHGAITCEVENAMWM
VPPQYAVWLPGSLPHSNHVTAGAELCFLFIEPAAVVMPERCCTLKISPLCRELILSLARR
TDPERAQMPTQRLIQVLFDELPQQPQEQLQLPVSGHPKIRQMVETMAQEPARWNTLGQWA
SVFAMSERNLARLVVKETGLSFRRWRHQLQLILALQALIAGRNVQQTAQMLGYDSTTAFI
TMFKKGLGQTPGQYLTGELLLPHN
Download sequence
Identical sequences A0A0D6GG84 A0A0F6B0K0 A0A0F7DIE5 A0A0G2NN59 A0A0H3NKH0 A0A0R9NVM1 A0A0U1FGA7 A0A0W4BNY8 A0A1C2ZUH0 A0A1R2S0M1 A0A1S1AGB1 A0A1Z3Q3C1 A0A221YK82 A0A249UZF5 A0A271CJQ6 A0A2C6EN13 A0A2D3TWS3 A0A2G1P2W5 A0A2H9YH60 A0A2I6N0F1 A0A2I6NEF2 A0A2I6NS45 A0A2I6P554 A0A2K3A6H0 B5RB27 E8XFK7 G5MJF0 G5RGM2 G5RW98 Q8ZPW8 S4HVC5
gi|378954820|ref|YP_005212307.1| gi|513549385|ref|YP_008119768.1| 391492 APC24420 gi|378449764|ref|YP_005237123.1| gi|207857219|ref|YP_002243870.1| gi|161614325|ref|YP_001588290.1| gi|409250425|ref|YP_006886236.1| gi|482903088|ref|YP_007901648.1| gi|529219526|ref|YP_008380513.1| gi|537436391|ref|YP_008480768.1| gi|378699168|ref|YP_005181125.1| gi|549479130|ref|YP_008613063.1| gi|549723917|ref|YP_008644107.1| gi|378988620|ref|YP_005251784.1| AE006468|CDS_1356188-1356982 AM933172|CDS_1882509-1881715 AM933173|CDS_1915281-1914487 CP000886|CDS_1766046-1765252 CP001363|CDS_1366163-1366957 FN424405|CDS_1352699-1353493 gi|526219980|ref|YP_008265477.1| 272994.SPAB_02071 550537.SEN1772 550538.SG1844 99287.STM1279 gi|383495994|ref|YP_005396683.1| gi|525838474|ref|YP_008255526.1| gi|513538099|ref|YP_008083622.1| NP_460245.1.58477 WP_000579793.1.100002 WP_000579793.1.100010 WP_000579793.1.100077 WP_000579793.1.100129 WP_000579793.1.100149 WP_000579793.1.100165 WP_000579793.1.100191 WP_000579793.1.100234 WP_000579793.1.100258 WP_000579793.1.100376 WP_000579793.1.100392 WP_000579793.1.100412 WP_000579793.1.100413 WP_000579793.1.100424 WP_000579793.1.100432 WP_000579793.1.100436 WP_000579793.1.100457 WP_000579793.1.100472 WP_000579793.1.100484 WP_000579793.1.100488 WP_000579793.1.100502 WP_000579793.1.100519 WP_000579793.1.100541 WP_000579793.1.100557 WP_000579793.1.100597 WP_000579793.1.100605 WP_000579793.1.100642 WP_000579793.1.100711 WP_000579793.1.100714 WP_000579793.1.10074 WP_000579793.1.10076 WP_000579793.1.100773 WP_000579793.1.100776 WP_000579793.1.100781 WP_000579793.1.100793 WP_000579793.1.10081 WP_000579793.1.100857 WP_000579793.1.100869 WP_000579793.1.100871 WP_000579793.1.100882 WP_000579793.1.100895 WP_000579793.1.100944 WP_000579793.1.101007 WP_000579793.1.101020 WP_000579793.1.101074 WP_000579793.1.101078 WP_000579793.1.101091 WP_000579793.1.101112 WP_000579793.1.101123 WP_000579793.1.101126 WP_000579793.1.101147 WP_000579793.1.101180 WP_000579793.1.101259 WP_000579793.1.101284 WP_000579793.1.101291 WP_000579793.1.101320 WP_000579793.1.101353 WP_000579793.1.101386 WP_000579793.1.101404 WP_000579793.1.101420 WP_000579793.1.101425 WP_000579793.1.101454 WP_000579793.1.101519 WP_000579793.1.101520 WP_000579793.1.101541 WP_000579793.1.101589 WP_000579793.1.101634 WP_000579793.1.101636 WP_000579793.1.10164 WP_000579793.1.101674 WP_000579793.1.101707 WP_000579793.1.101724 WP_000579793.1.101734 WP_000579793.1.101740 WP_000579793.1.10177 WP_000579793.1.101776 WP_000579793.1.101832 WP_000579793.1.101839 WP_000579793.1.101841 WP_000579793.1.101878 WP_000579793.1.10191 WP_000579793.1.101917 WP_000579793.1.101949 WP_000579793.1.101953 WP_000579793.1.101975 WP_000579793.1.102111 WP_000579793.1.10220 WP_000579793.1.10237 WP_000579793.1.10266 WP_000579793.1.10276 WP_000579793.1.10300 WP_000579793.1.10429 WP_000579793.1.10439 WP_000579793.1.10463 WP_000579793.1.10498 WP_000579793.1.10521 WP_000579793.1.10568 WP_000579793.1.106 WP_000579793.1.10631 WP_000579793.1.10675 WP_000579793.1.10678 WP_000579793.1.10711 WP_000579793.1.10753 WP_000579793.1.10755 WP_000579793.1.10868 WP_000579793.1.10898 WP_000579793.1.10992 WP_000579793.1.11000 WP_000579793.1.11024 WP_000579793.1.11031 WP_000579793.1.11098 WP_000579793.1.11119 WP_000579793.1.11168 WP_000579793.1.11190 WP_000579793.1.11216 WP_000579793.1.11295 WP_000579793.1.11405 WP_000579793.1.11455 WP_000579793.1.11458 WP_000579793.1.11479 WP_000579793.1.1150 WP_000579793.1.11511 WP_000579793.1.11518 WP_000579793.1.11526 WP_000579793.1.11528 WP_000579793.1.11532 WP_000579793.1.11543 WP_000579793.1.11544 WP_000579793.1.1156 WP_000579793.1.11603 WP_000579793.1.1169 WP_000579793.1.1174 WP_000579793.1.11763 WP_000579793.1.11772 WP_000579793.1.11824 WP_000579793.1.11841 WP_000579793.1.11897 WP_000579793.1.11900 WP_000579793.1.11964 WP_000579793.1.11978 WP_000579793.1.12025 WP_000579793.1.12027 WP_000579793.1.12106 WP_000579793.1.12114 WP_000579793.1.1215 WP_000579793.1.12159 WP_000579793.1.12160 WP_000579793.1.12168 WP_000579793.1.12280 WP_000579793.1.12282 WP_000579793.1.12340 WP_000579793.1.12351 WP_000579793.1.12370 WP_000579793.1.12374 WP_000579793.1.12456 WP_000579793.1.1246 WP_000579793.1.12472 WP_000579793.1.12485 WP_000579793.1.12546 WP_000579793.1.12568 WP_000579793.1.12569 WP_000579793.1.12585 WP_000579793.1.1264 WP_000579793.1.12696 WP_000579793.1.12701 WP_000579793.1.12728 WP_000579793.1.12864 WP_000579793.1.12879 WP_000579793.1.12936 WP_000579793.1.1299 WP_000579793.1.12995 WP_000579793.1.1300 WP_000579793.1.13027 WP_000579793.1.13076 WP_000579793.1.13102 WP_000579793.1.13106 WP_000579793.1.13130 WP_000579793.1.13247 WP_000579793.1.1326 WP_000579793.1.13274 WP_000579793.1.13334 WP_000579793.1.13367 WP_000579793.1.13391 WP_000579793.1.13414 WP_000579793.1.1346 WP_000579793.1.13488 WP_000579793.1.13509 WP_000579793.1.13528 WP_000579793.1.13543 WP_000579793.1.13573 WP_000579793.1.13625 WP_000579793.1.13669 WP_000579793.1.13691 WP_000579793.1.13741 WP_000579793.1.13764 WP_000579793.1.13819 WP_000579793.1.13827 WP_000579793.1.13848 WP_000579793.1.13857 WP_000579793.1.1387 WP_000579793.1.13908 WP_000579793.1.13932 WP_000579793.1.13968 WP_000579793.1.14001 WP_000579793.1.14011 WP_000579793.1.14050 WP_000579793.1.14056 WP_000579793.1.1412 WP_000579793.1.14151 WP_000579793.1.14239 WP_000579793.1.14296 WP_000579793.1.14320 WP_000579793.1.14369 WP_000579793.1.14379 WP_000579793.1.14406 WP_000579793.1.14410 WP_000579793.1.14466 WP_000579793.1.14495 WP_000579793.1.14524 WP_000579793.1.14554 WP_000579793.1.146 WP_000579793.1.14706 WP_000579793.1.14708 WP_000579793.1.14725 WP_000579793.1.14793 WP_000579793.1.14808 WP_000579793.1.14819 WP_000579793.1.14852 WP_000579793.1.14876 WP_000579793.1.14884 WP_000579793.1.1489 WP_000579793.1.14913 WP_000579793.1.14932 WP_000579793.1.14964 WP_000579793.1.15054 WP_000579793.1.15055 WP_000579793.1.15067 WP_000579793.1.15124 WP_000579793.1.15223 WP_000579793.1.15226 WP_000579793.1.15276 WP_000579793.1.15316 WP_000579793.1.15318 WP_000579793.1.15353 WP_000579793.1.15369 WP_000579793.1.1540 WP_000579793.1.15483 WP_000579793.1.15508 WP_000579793.1.15585 WP_000579793.1.15616 WP_000579793.1.15625 WP_000579793.1.15627 WP_000579793.1.15644 WP_000579793.1.1568 WP_000579793.1.15708 WP_000579793.1.15775 WP_000579793.1.15777 WP_000579793.1.15784 WP_000579793.1.15795 WP_000579793.1.158 WP_000579793.1.15830 WP_000579793.1.15835 WP_000579793.1.15881 WP_000579793.1.16000 WP_000579793.1.16006 WP_000579793.1.1601 WP_000579793.1.16062 WP_000579793.1.16063 WP_000579793.1.16103 WP_000579793.1.16125 WP_000579793.1.16166 WP_000579793.1.16226 WP_000579793.1.16233 WP_000579793.1.16244 WP_000579793.1.16284 WP_000579793.1.16331 WP_000579793.1.1635 WP_000579793.1.16363 WP_000579793.1.16365 WP_000579793.1.16366 WP_000579793.1.16394 WP_000579793.1.16453 WP_000579793.1.16468 WP_000579793.1.16474 WP_000579793.1.16551 WP_000579793.1.16565 WP_000579793.1.16614 WP_000579793.1.16650 WP_000579793.1.16686 WP_000579793.1.16691 WP_000579793.1.167 WP_000579793.1.16729 WP_000579793.1.16732 WP_000579793.1.16735 WP_000579793.1.16786 WP_000579793.1.16804 WP_000579793.1.16846 WP_000579793.1.16858 WP_000579793.1.16896 WP_000579793.1.16916 WP_000579793.1.16941 WP_000579793.1.16949 WP_000579793.1.16965 WP_000579793.1.16972 WP_000579793.1.16998 WP_000579793.1.1700 WP_000579793.1.17060 WP_000579793.1.17096 WP_000579793.1.17098 WP_000579793.1.17105 WP_000579793.1.17270 WP_000579793.1.17285 WP_000579793.1.17307 WP_000579793.1.1733 WP_000579793.1.174 WP_000579793.1.17447 WP_000579793.1.17480 WP_000579793.1.17482 WP_000579793.1.1749 WP_000579793.1.17525 WP_000579793.1.17546 WP_000579793.1.1757 WP_000579793.1.17583 WP_000579793.1.17702 WP_000579793.1.17705 WP_000579793.1.17732 WP_000579793.1.17747 WP_000579793.1.17886 WP_000579793.1.17914 WP_000579793.1.17936 WP_000579793.1.17991 WP_000579793.1.18019 WP_000579793.1.18056 WP_000579793.1.18061 WP_000579793.1.1807 WP_000579793.1.18092 WP_000579793.1.18109 WP_000579793.1.18111 WP_000579793.1.1814 WP_000579793.1.18149 WP_000579793.1.18163 WP_000579793.1.1825 WP_000579793.1.18265 WP_000579793.1.18267 WP_000579793.1.18277 WP_000579793.1.18281 WP_000579793.1.18282 WP_000579793.1.18384 WP_000579793.1.18426 WP_000579793.1.18441 WP_000579793.1.18468 WP_000579793.1.18489 WP_000579793.1.18607 WP_000579793.1.18641 WP_000579793.1.18686 WP_000579793.1.18692 WP_000579793.1.18705 WP_000579793.1.18715 WP_000579793.1.18737 WP_000579793.1.18776 WP_000579793.1.18822 WP_000579793.1.18847 WP_000579793.1.18881 WP_000579793.1.18886 WP_000579793.1.18895 WP_000579793.1.18940 WP_000579793.1.18949 WP_000579793.1.1895 WP_000579793.1.1897 WP_000579793.1.18972 WP_000579793.1.19038 WP_000579793.1.19053 WP_000579793.1.19055 WP_000579793.1.19093 WP_000579793.1.19163 WP_000579793.1.19174 WP_000579793.1.19240 WP_000579793.1.19291 WP_000579793.1.19320 WP_000579793.1.19340 WP_000579793.1.19373 WP_000579793.1.1939 WP_000579793.1.19405 WP_000579793.1.19433 WP_000579793.1.19458 WP_000579793.1.19460 WP_000579793.1.19461 WP_000579793.1.1954 WP_000579793.1.1955 WP_000579793.1.19614 WP_000579793.1.19642 WP_000579793.1.19656 WP_000579793.1.19660 WP_000579793.1.1968 WP_000579793.1.19683 WP_000579793.1.19702 WP_000579793.1.19706 WP_000579793.1.19724 WP_000579793.1.19740 WP_000579793.1.19749 WP_000579793.1.19784 WP_000579793.1.19802 WP_000579793.1.19809 WP_000579793.1.19823 WP_000579793.1.19834 WP_000579793.1.19863 WP_000579793.1.19867 WP_000579793.1.19884 WP_000579793.1.1990 WP_000579793.1.19938 WP_000579793.1.1998 WP_000579793.1.20 WP_000579793.1.20086 WP_000579793.1.20091 WP_000579793.1.2010 WP_000579793.1.20212 WP_000579793.1.20218 WP_000579793.1.2026 WP_000579793.1.20261 WP_000579793.1.20266 WP_000579793.1.20271 WP_000579793.1.20330 WP_000579793.1.2036 WP_000579793.1.20362 WP_000579793.1.20376 WP_000579793.1.20391 WP_000579793.1.2041 WP_000579793.1.20415 WP_000579793.1.20418 WP_000579793.1.20425 WP_000579793.1.20437 WP_000579793.1.20443 WP_000579793.1.2047 WP_000579793.1.20488 WP_000579793.1.20525 WP_000579793.1.2054 WP_000579793.1.20553 WP_000579793.1.20573 WP_000579793.1.20626 WP_000579793.1.20646 WP_000579793.1.20695 WP_000579793.1.20760 WP_000579793.1.20787 WP_000579793.1.20810 WP_000579793.1.20839 WP_000579793.1.20862 WP_000579793.1.20886 WP_000579793.1.20894 WP_000579793.1.20900 WP_000579793.1.20908 WP_000579793.1.2101 WP_000579793.1.21049 WP_000579793.1.21079 WP_000579793.1.21086 WP_000579793.1.21103 WP_000579793.1.21146 WP_000579793.1.2116 WP_000579793.1.21165 WP_000579793.1.21194 WP_000579793.1.21202 WP_000579793.1.21241 WP_000579793.1.21245 WP_000579793.1.21246 WP_000579793.1.21260 WP_000579793.1.21269 WP_000579793.1.21286 WP_000579793.1.21332 WP_000579793.1.21362 WP_000579793.1.21399 WP_000579793.1.21400 WP_000579793.1.21423 WP_000579793.1.21443 WP_000579793.1.2146 WP_000579793.1.21473 WP_000579793.1.21497 WP_000579793.1.21499 WP_000579793.1.21548 WP_000579793.1.21603 WP_000579793.1.21681 WP_000579793.1.21715 WP_000579793.1.21728 WP_000579793.1.21730 WP_000579793.1.21750 WP_000579793.1.21751 WP_000579793.1.21757 WP_000579793.1.21792 WP_000579793.1.21877 WP_000579793.1.21909 WP_000579793.1.21910 WP_000579793.1.21940 WP_000579793.1.21950 WP_000579793.1.22024 WP_000579793.1.22030 WP_000579793.1.2205 WP_000579793.1.22051 WP_000579793.1.22062 WP_000579793.1.22067 WP_000579793.1.22096 WP_000579793.1.22136 WP_000579793.1.22158 WP_000579793.1.22162 WP_000579793.1.22205 WP_000579793.1.2221 WP_000579793.1.22240 WP_000579793.1.22296 WP_000579793.1.22315 WP_000579793.1.22323 WP_000579793.1.22346 WP_000579793.1.2235 WP_000579793.1.22379 WP_000579793.1.22427 WP_000579793.1.22449 WP_000579793.1.22453 WP_000579793.1.22454 WP_000579793.1.2246 WP_000579793.1.22460 WP_000579793.1.22485 WP_000579793.1.22514 WP_000579793.1.22537 WP_000579793.1.22565 WP_000579793.1.22595 WP_000579793.1.22604 WP_000579793.1.22605 WP_000579793.1.22620 WP_000579793.1.22760 WP_000579793.1.2283 WP_000579793.1.22845 WP_000579793.1.22857 WP_000579793.1.22870 WP_000579793.1.22880 WP_000579793.1.22902 WP_000579793.1.22947 WP_000579793.1.22966 WP_000579793.1.22979 WP_000579793.1.23010 WP_000579793.1.23102 WP_000579793.1.23114 WP_000579793.1.2314 WP_000579793.1.23155 WP_000579793.1.23169 WP_000579793.1.23175 WP_000579793.1.23192 WP_000579793.1.23259 WP_000579793.1.23274 WP_000579793.1.23279 WP_000579793.1.23311 WP_000579793.1.23329 WP_000579793.1.23343 WP_000579793.1.23409 WP_000579793.1.23442 WP_000579793.1.23444 WP_000579793.1.23460 WP_000579793.1.23472 WP_000579793.1.23482 WP_000579793.1.23485 WP_000579793.1.235 WP_000579793.1.23500 WP_000579793.1.2358 WP_000579793.1.23587 WP_000579793.1.23629 WP_000579793.1.23631 WP_000579793.1.23634 WP_000579793.1.23639 WP_000579793.1.2364 WP_000579793.1.23646 WP_000579793.1.237 WP_000579793.1.23720 WP_000579793.1.23736 WP_000579793.1.23746 WP_000579793.1.2376 WP_000579793.1.2380 WP_000579793.1.23932 WP_000579793.1.24017 WP_000579793.1.24145 WP_000579793.1.24158 WP_000579793.1.24206 WP_000579793.1.24214 WP_000579793.1.24250 WP_000579793.1.24297 WP_000579793.1.24303 WP_000579793.1.24308 WP_000579793.1.24361 WP_000579793.1.24392 WP_000579793.1.24408 WP_000579793.1.24409 WP_000579793.1.24412 WP_000579793.1.24450 WP_000579793.1.24476 WP_000579793.1.24494 WP_000579793.1.24521 WP_000579793.1.24578 WP_000579793.1.24673 WP_000579793.1.24686 WP_000579793.1.24723 WP_000579793.1.24737 WP_000579793.1.24779 WP_000579793.1.24839 WP_000579793.1.24873 WP_000579793.1.24901 WP_000579793.1.24944 WP_000579793.1.24995 WP_000579793.1.25008 WP_000579793.1.25015 WP_000579793.1.25064 WP_000579793.1.25159 WP_000579793.1.25175 WP_000579793.1.25206 WP_000579793.1.25217 WP_000579793.1.25229 WP_000579793.1.25354 WP_000579793.1.25397 WP_000579793.1.25405 WP_000579793.1.25426 WP_000579793.1.25454 WP_000579793.1.25493 WP_000579793.1.25498 WP_000579793.1.2554 WP_000579793.1.25618 WP_000579793.1.25668 WP_000579793.1.25690 WP_000579793.1.2570 WP_000579793.1.25703 WP_000579793.1.25740 WP_000579793.1.25780 WP_000579793.1.25814 WP_000579793.1.25928 WP_000579793.1.25951 WP_000579793.1.25988 WP_000579793.1.26075 WP_000579793.1.26083 WP_000579793.1.26093 WP_000579793.1.26129 WP_000579793.1.26194 WP_000579793.1.26213 WP_000579793.1.26224 WP_000579793.1.26269 WP_000579793.1.26282 WP_000579793.1.26311 WP_000579793.1.26319 WP_000579793.1.26363 WP_000579793.1.26426 WP_000579793.1.26429 WP_000579793.1.26440 WP_000579793.1.26441 WP_000579793.1.26493 WP_000579793.1.26551 WP_000579793.1.26567 WP_000579793.1.26582 WP_000579793.1.26646 WP_000579793.1.2667 WP_000579793.1.26687 WP_000579793.1.26709 WP_000579793.1.2672 WP_000579793.1.26794 WP_000579793.1.26833 WP_000579793.1.26856 WP_000579793.1.26882 WP_000579793.1.26892 WP_000579793.1.26936 WP_000579793.1.27010 WP_000579793.1.27051 WP_000579793.1.27055 WP_000579793.1.27072 WP_000579793.1.27122 WP_000579793.1.27169 WP_000579793.1.27173 WP_000579793.1.27206 WP_000579793.1.27272 WP_000579793.1.27314 WP_000579793.1.27342 WP_000579793.1.27383 WP_000579793.1.27419 WP_000579793.1.27423 WP_000579793.1.27513 WP_000579793.1.27522 WP_000579793.1.27535 WP_000579793.1.27547 WP_000579793.1.27561 WP_000579793.1.27616 WP_000579793.1.2763 WP_000579793.1.27632 WP_000579793.1.27638 WP_000579793.1.27655 WP_000579793.1.27658 WP_000579793.1.27665 WP_000579793.1.27707 WP_000579793.1.27761 WP_000579793.1.2777 WP_000579793.1.27798 WP_000579793.1.27800 WP_000579793.1.27833 WP_000579793.1.27857 WP_000579793.1.27883 WP_000579793.1.27969 WP_000579793.1.27977 WP_000579793.1.27995 WP_000579793.1.27997 WP_000579793.1.28037 WP_000579793.1.28056 WP_000579793.1.2806 WP_000579793.1.28073 WP_000579793.1.28094 WP_000579793.1.28116 WP_000579793.1.28126 WP_000579793.1.28139 WP_000579793.1.28170 WP_000579793.1.28174 WP_000579793.1.28200 WP_000579793.1.28232 WP_000579793.1.2825 WP_000579793.1.2829 WP_000579793.1.28302 WP_000579793.1.28303 WP_000579793.1.2835 WP_000579793.1.28370 WP_000579793.1.28462 WP_000579793.1.28504 WP_000579793.1.2853 WP_000579793.1.28538 WP_000579793.1.28570 WP_000579793.1.28575 WP_000579793.1.28612 WP_000579793.1.28620 WP_000579793.1.28625 WP_000579793.1.28655 WP_000579793.1.28673 WP_000579793.1.28694 WP_000579793.1.28733 WP_000579793.1.28773 WP_000579793.1.2879 WP_000579793.1.28830 WP_000579793.1.2890 WP_000579793.1.28921 WP_000579793.1.28938 WP_000579793.1.28946 WP_000579793.1.28948 WP_000579793.1.28963 WP_000579793.1.29006 WP_000579793.1.29010 WP_000579793.1.2910 WP_000579793.1.29168 WP_000579793.1.29174 WP_000579793.1.29190 WP_000579793.1.29218 WP_000579793.1.2924 WP_000579793.1.29265 WP_000579793.1.2932 WP_000579793.1.29349 WP_000579793.1.29379 WP_000579793.1.29422 WP_000579793.1.29436 WP_000579793.1.29576 WP_000579793.1.29588 WP_000579793.1.29601 WP_000579793.1.29606 WP_000579793.1.29615 WP_000579793.1.29619 WP_000579793.1.29704 WP_000579793.1.29711 WP_000579793.1.2984 WP_000579793.1.29845 WP_000579793.1.29923 WP_000579793.1.29924 WP_000579793.1.29969 WP_000579793.1.30006 WP_000579793.1.30027 WP_000579793.1.3005 WP_000579793.1.30059 WP_000579793.1.30086 WP_000579793.1.30165 WP_000579793.1.30170 WP_000579793.1.30180 WP_000579793.1.30210 WP_000579793.1.30213 WP_000579793.1.30225 WP_000579793.1.30278 WP_000579793.1.30356 WP_000579793.1.30389 WP_000579793.1.30425 WP_000579793.1.30469 WP_000579793.1.30492 WP_000579793.1.30505 WP_000579793.1.30507 WP_000579793.1.30535 WP_000579793.1.30547 WP_000579793.1.30548 WP_000579793.1.30589 WP_000579793.1.30619 WP_000579793.1.30627 WP_000579793.1.3066 WP_000579793.1.3068 WP_000579793.1.30752 WP_000579793.1.30794 WP_000579793.1.30802 WP_000579793.1.30819 WP_000579793.1.30823 WP_000579793.1.30833 WP_000579793.1.30835 WP_000579793.1.3089 WP_000579793.1.30909 WP_000579793.1.30934 WP_000579793.1.3095 WP_000579793.1.30951 WP_000579793.1.30968 WP_000579793.1.30972 WP_000579793.1.31 WP_000579793.1.31001 WP_000579793.1.31011 WP_000579793.1.31042 WP_000579793.1.3113 WP_000579793.1.3114 WP_000579793.1.31167 WP_000579793.1.31171 WP_000579793.1.31185 WP_000579793.1.3119 WP_000579793.1.31190 WP_000579793.1.31195 WP_000579793.1.31196 WP_000579793.1.31198 WP_000579793.1.31210 WP_000579793.1.31214 WP_000579793.1.31219 WP_000579793.1.31262 WP_000579793.1.3127 WP_000579793.1.31272 WP_000579793.1.31281 WP_000579793.1.31335 WP_000579793.1.31362 WP_000579793.1.31435 WP_000579793.1.31476 WP_000579793.1.31504 WP_000579793.1.31515 WP_000579793.1.31578 WP_000579793.1.31585 WP_000579793.1.31658 WP_000579793.1.31665 WP_000579793.1.3167 WP_000579793.1.31782 WP_000579793.1.31845 WP_000579793.1.31895 WP_000579793.1.31901 WP_000579793.1.31940 WP_000579793.1.31967 WP_000579793.1.31972 WP_000579793.1.32006 WP_000579793.1.32056 WP_000579793.1.32109 WP_000579793.1.32116 WP_000579793.1.32170 WP_000579793.1.32192 WP_000579793.1.32204 WP_000579793.1.32206 WP_000579793.1.32252 WP_000579793.1.32255 WP_000579793.1.32274 WP_000579793.1.32277 WP_000579793.1.32309 WP_000579793.1.32357 WP_000579793.1.32368 WP_000579793.1.32434 WP_000579793.1.32438 WP_000579793.1.32491 WP_000579793.1.32515 WP_000579793.1.32519 WP_000579793.1.32527 WP_000579793.1.32545 WP_000579793.1.32643 WP_000579793.1.32660 WP_000579793.1.32668 WP_000579793.1.32702 WP_000579793.1.32714 WP_000579793.1.32740 WP_000579793.1.32750 WP_000579793.1.32786 WP_000579793.1.32804 WP_000579793.1.32832 WP_000579793.1.32860 WP_000579793.1.32881 WP_000579793.1.32899 WP_000579793.1.32900 WP_000579793.1.32902 WP_000579793.1.32907 WP_000579793.1.32930 WP_000579793.1.32977 WP_000579793.1.33030 WP_000579793.1.33106 WP_000579793.1.33114 WP_000579793.1.33127 WP_000579793.1.33143 WP_000579793.1.33248 WP_000579793.1.33253 WP_000579793.1.33261 WP_000579793.1.33270 WP_000579793.1.333 WP_000579793.1.33392 WP_000579793.1.33409 WP_000579793.1.33486 WP_000579793.1.33492 WP_000579793.1.33499 WP_000579793.1.335 WP_000579793.1.33553 WP_000579793.1.3356 WP_000579793.1.33586 WP_000579793.1.33592 WP_000579793.1.3364 WP_000579793.1.33693 WP_000579793.1.33825 WP_000579793.1.33870 WP_000579793.1.33894 WP_000579793.1.3396 WP_000579793.1.33986 WP_000579793.1.34 WP_000579793.1.34022 WP_000579793.1.34043 WP_000579793.1.34075 WP_000579793.1.34081 WP_000579793.1.34091 WP_000579793.1.34179 WP_000579793.1.34185 WP_000579793.1.34257 WP_000579793.1.34259 WP_000579793.1.34279 WP_000579793.1.34292 WP_000579793.1.34304 WP_000579793.1.34319 WP_000579793.1.34330 WP_000579793.1.3438 WP_000579793.1.34431 WP_000579793.1.34453 WP_000579793.1.34454 WP_000579793.1.34458 WP_000579793.1.34496 WP_000579793.1.34610 WP_000579793.1.34614 WP_000579793.1.34703 WP_000579793.1.34707 WP_000579793.1.34711 WP_000579793.1.34745 WP_000579793.1.34801 WP_000579793.1.34817 WP_000579793.1.34820 WP_000579793.1.34854 WP_000579793.1.34856 WP_000579793.1.3489 WP_000579793.1.34972 WP_000579793.1.34975 WP_000579793.1.34977 WP_000579793.1.35035 WP_000579793.1.35045 WP_000579793.1.35075 WP_000579793.1.35129 WP_000579793.1.35184 WP_000579793.1.35219 WP_000579793.1.35298 WP_000579793.1.35321 WP_000579793.1.35404 WP_000579793.1.35408 WP_000579793.1.3541 WP_000579793.1.35425 WP_000579793.1.35429 WP_000579793.1.35446 WP_000579793.1.35463 WP_000579793.1.35503 WP_000579793.1.35509 WP_000579793.1.35563 WP_000579793.1.35570 WP_000579793.1.35590 WP_000579793.1.35594 WP_000579793.1.35624 WP_000579793.1.35809 WP_000579793.1.35887 WP_000579793.1.35936 WP_000579793.1.35940 WP_000579793.1.35961 WP_000579793.1.35993 WP_000579793.1.36003 WP_000579793.1.3601 WP_000579793.1.36037 WP_000579793.1.36063 WP_000579793.1.36157 WP_000579793.1.36232 WP_000579793.1.36286 WP_000579793.1.36409 WP_000579793.1.36425 WP_000579793.1.36445 WP_000579793.1.36564 WP_000579793.1.36584 WP_000579793.1.36592 WP_000579793.1.36609 WP_000579793.1.36685 WP_000579793.1.36690 WP_000579793.1.3670 WP_000579793.1.36705 WP_000579793.1.36721 WP_000579793.1.36764 WP_000579793.1.36765 WP_000579793.1.36792 WP_000579793.1.36839 WP_000579793.1.3688 WP_000579793.1.36889 WP_000579793.1.36918 WP_000579793.1.36931 WP_000579793.1.36978 WP_000579793.1.37029 WP_000579793.1.37063 WP_000579793.1.37073 WP_000579793.1.37100 WP_000579793.1.37111 WP_000579793.1.37112 WP_000579793.1.37114 WP_000579793.1.37191 WP_000579793.1.37256 WP_000579793.1.37267 WP_000579793.1.37293 WP_000579793.1.37297 WP_000579793.1.3734 WP_000579793.1.37363 WP_000579793.1.37370 WP_000579793.1.37376 WP_000579793.1.37405 WP_000579793.1.3744 WP_000579793.1.37478 WP_000579793.1.3748 WP_000579793.1.37498 WP_000579793.1.37504 WP_000579793.1.3751 WP_000579793.1.37521 WP_000579793.1.37558 WP_000579793.1.3756 WP_000579793.1.37618 WP_000579793.1.37687 WP_000579793.1.3771 WP_000579793.1.37719 WP_000579793.1.3778 WP_000579793.1.37848 WP_000579793.1.37864 WP_000579793.1.3790 WP_000579793.1.37968 WP_000579793.1.37978 WP_000579793.1.38026 WP_000579793.1.38037 WP_000579793.1.38047 WP_000579793.1.38125 WP_000579793.1.38145 WP_000579793.1.38199 WP_000579793.1.38273 WP_000579793.1.383 WP_000579793.1.38322 WP_000579793.1.38341 WP_000579793.1.38344 WP_000579793.1.38349 WP_000579793.1.3848 WP_000579793.1.38512 WP_000579793.1.38613 WP_000579793.1.38622 WP_000579793.1.38673 WP_000579793.1.3869 WP_000579793.1.38693 WP_000579793.1.38773 WP_000579793.1.38797 WP_000579793.1.38830 WP_000579793.1.38857 WP_000579793.1.38881 WP_000579793.1.38882 WP_000579793.1.38895 WP_000579793.1.38898 WP_000579793.1.38913 WP_000579793.1.39003 WP_000579793.1.39038 WP_000579793.1.39048 WP_000579793.1.39055 WP_000579793.1.39059 WP_000579793.1.39065 WP_000579793.1.39082 WP_000579793.1.39128 WP_000579793.1.39136 WP_000579793.1.39197 WP_000579793.1.39229 WP_000579793.1.39275 WP_000579793.1.39311 WP_000579793.1.39312 WP_000579793.1.39385 WP_000579793.1.39395 WP_000579793.1.39405 WP_000579793.1.39420 WP_000579793.1.39449 WP_000579793.1.39466 WP_000579793.1.39512 WP_000579793.1.39556 WP_000579793.1.39576 WP_000579793.1.39609 WP_000579793.1.39629 WP_000579793.1.39632 WP_000579793.1.39722 WP_000579793.1.39763 WP_000579793.1.39808 WP_000579793.1.39862 WP_000579793.1.39921 WP_000579793.1.39923 WP_000579793.1.40017 WP_000579793.1.40025 WP_000579793.1.40072 WP_000579793.1.40073 WP_000579793.1.40081 WP_000579793.1.4011 WP_000579793.1.40111 WP_000579793.1.40155 WP_000579793.1.40171 WP_000579793.1.40205 WP_000579793.1.40208 WP_000579793.1.40224 WP_000579793.1.40229 WP_000579793.1.40240 WP_000579793.1.40257 WP_000579793.1.40258 WP_000579793.1.40292 WP_000579793.1.40305 WP_000579793.1.40307 WP_000579793.1.40311 WP_000579793.1.40380 WP_000579793.1.40395 WP_000579793.1.40465 WP_000579793.1.40492 WP_000579793.1.40493 WP_000579793.1.40508 WP_000579793.1.40533 WP_000579793.1.40577 WP_000579793.1.40583 WP_000579793.1.40605 WP_000579793.1.40622 WP_000579793.1.40648 WP_000579793.1.40693 WP_000579793.1.40695 WP_000579793.1.40710 WP_000579793.1.40722 WP_000579793.1.40745 WP_000579793.1.4075 WP_000579793.1.40849 WP_000579793.1.4087 WP_000579793.1.40877 WP_000579793.1.40930 WP_000579793.1.40973 WP_000579793.1.41017 WP_000579793.1.41086 WP_000579793.1.41091 WP_000579793.1.41116 WP_000579793.1.41128 WP_000579793.1.41192 WP_000579793.1.41225 WP_000579793.1.41226 WP_000579793.1.41277 WP_000579793.1.41279 WP_000579793.1.41299 WP_000579793.1.41310 WP_000579793.1.41345 WP_000579793.1.41375 WP_000579793.1.41427 WP_000579793.1.41440 WP_000579793.1.41468 WP_000579793.1.41516 WP_000579793.1.41528 WP_000579793.1.41554 WP_000579793.1.41572 WP_000579793.1.41591 WP_000579793.1.41610 WP_000579793.1.41662 WP_000579793.1.41688 WP_000579793.1.41690 WP_000579793.1.41708 WP_000579793.1.41761 WP_000579793.1.4178 WP_000579793.1.41799 WP_000579793.1.41802 WP_000579793.1.41859 WP_000579793.1.41877 WP_000579793.1.41882 WP_000579793.1.41897 WP_000579793.1.41904 WP_000579793.1.41911 WP_000579793.1.41949 WP_000579793.1.41978 WP_000579793.1.41979 WP_000579793.1.41985 WP_000579793.1.41994 WP_000579793.1.42104 WP_000579793.1.42109 WP_000579793.1.42136 WP_000579793.1.422 WP_000579793.1.42244 WP_000579793.1.42248 WP_000579793.1.42263 WP_000579793.1.42320 WP_000579793.1.42322 WP_000579793.1.42342 WP_000579793.1.42356 WP_000579793.1.4239 WP_000579793.1.42392 WP_000579793.1.42422 WP_000579793.1.42433 WP_000579793.1.42595 WP_000579793.1.42605 WP_000579793.1.42655 WP_000579793.1.42666 WP_000579793.1.42675 WP_000579793.1.42683 WP_000579793.1.42685 WP_000579793.1.42734 WP_000579793.1.4276 WP_000579793.1.42794 WP_000579793.1.42797 WP_000579793.1.42829 WP_000579793.1.42861 WP_000579793.1.42864 WP_000579793.1.4288 WP_000579793.1.42887 WP_000579793.1.42892 WP_000579793.1.42923 WP_000579793.1.42932 WP_000579793.1.42981 WP_000579793.1.43018 WP_000579793.1.43041 WP_000579793.1.43089 WP_000579793.1.43201 WP_000579793.1.43244 WP_000579793.1.43258 WP_000579793.1.43272 WP_000579793.1.43276 WP_000579793.1.43312 WP_000579793.1.4332 WP_000579793.1.43334 WP_000579793.1.43351 WP_000579793.1.43437 WP_000579793.1.4344 WP_000579793.1.43441 WP_000579793.1.43508 WP_000579793.1.43520 WP_000579793.1.43522 WP_000579793.1.43528 WP_000579793.1.43535 WP_000579793.1.43613 WP_000579793.1.43654 WP_000579793.1.43668 WP_000579793.1.43685 WP_000579793.1.43711 WP_000579793.1.4373 WP_000579793.1.43782 WP_000579793.1.43785 WP_000579793.1.43839 WP_000579793.1.43864 WP_000579793.1.43875 WP_000579793.1.43886 WP_000579793.1.43954 WP_000579793.1.44005 WP_000579793.1.44010 WP_000579793.1.4404 WP_000579793.1.44043 WP_000579793.1.4405 WP_000579793.1.44063 WP_000579793.1.44099 WP_000579793.1.44121 WP_000579793.1.44187 WP_000579793.1.44191 WP_000579793.1.4422 WP_000579793.1.4423 WP_000579793.1.44291 WP_000579793.1.44310 WP_000579793.1.44337 WP_000579793.1.44339 WP_000579793.1.44380 WP_000579793.1.44438 WP_000579793.1.44440 WP_000579793.1.44443 WP_000579793.1.44474 WP_000579793.1.44479 WP_000579793.1.44549 WP_000579793.1.44607 WP_000579793.1.44633 WP_000579793.1.44640 WP_000579793.1.4467 WP_000579793.1.44678 WP_000579793.1.44705 WP_000579793.1.44747 WP_000579793.1.44781 WP_000579793.1.44791 WP_000579793.1.44795 WP_000579793.1.44831 WP_000579793.1.44833 WP_000579793.1.4485 WP_000579793.1.44877 WP_000579793.1.44887 WP_000579793.1.449 WP_000579793.1.44927 WP_000579793.1.44950 WP_000579793.1.44966 WP_000579793.1.44971 WP_000579793.1.44978 WP_000579793.1.44996 WP_000579793.1.44997 WP_000579793.1.44998 WP_000579793.1.4500 WP_000579793.1.45067 WP_000579793.1.45074 WP_000579793.1.45079 WP_000579793.1.45098 WP_000579793.1.45138 WP_000579793.1.45173 WP_000579793.1.45177 WP_000579793.1.45184 WP_000579793.1.45229 WP_000579793.1.45251 WP_000579793.1.45259 WP_000579793.1.45268 WP_000579793.1.45302 WP_000579793.1.4531 WP_000579793.1.45322 WP_000579793.1.45344 WP_000579793.1.45349 WP_000579793.1.45351 WP_000579793.1.45365 WP_000579793.1.4540 WP_000579793.1.45402 WP_000579793.1.45432 WP_000579793.1.45468 WP_000579793.1.45522 WP_000579793.1.45544 WP_000579793.1.45549 WP_000579793.1.45550 WP_000579793.1.45566 WP_000579793.1.45569 WP_000579793.1.45571 WP_000579793.1.45583 WP_000579793.1.45585 WP_000579793.1.45660 WP_000579793.1.45690 WP_000579793.1.45706 WP_000579793.1.45781 WP_000579793.1.45797 WP_000579793.1.458 WP_000579793.1.45844 WP_000579793.1.45906 WP_000579793.1.45918 WP_000579793.1.46011 WP_000579793.1.46069 WP_000579793.1.46112 WP_000579793.1.46124 WP_000579793.1.46173 WP_000579793.1.46174 WP_000579793.1.46187 WP_000579793.1.46205 WP_000579793.1.46215 WP_000579793.1.46250 WP_000579793.1.46303 WP_000579793.1.46322 WP_000579793.1.46323 WP_000579793.1.46406 WP_000579793.1.46444 WP_000579793.1.46572 WP_000579793.1.46578 WP_000579793.1.46595 WP_000579793.1.46675 WP_000579793.1.4671 WP_000579793.1.46726 WP_000579793.1.46730 WP_000579793.1.4674 WP_000579793.1.46804 WP_000579793.1.4686 WP_000579793.1.46930 WP_000579793.1.46961 WP_000579793.1.46967 WP_000579793.1.46976 WP_000579793.1.47005 WP_000579793.1.47014 WP_000579793.1.47057 WP_000579793.1.47214 WP_000579793.1.47257 WP_000579793.1.47429 WP_000579793.1.47442 WP_000579793.1.47448 WP_000579793.1.4747 WP_000579793.1.47472 WP_000579793.1.47478 WP_000579793.1.47506 WP_000579793.1.47507 WP_000579793.1.47567 WP_000579793.1.47576 WP_000579793.1.4758 WP_000579793.1.47621 WP_000579793.1.4769 WP_000579793.1.4770 WP_000579793.1.47714 WP_000579793.1.4775 WP_000579793.1.47799 WP_000579793.1.47817 WP_000579793.1.47829 WP_000579793.1.47850 WP_000579793.1.47875 WP_000579793.1.47911 WP_000579793.1.4795 WP_000579793.1.47988 WP_000579793.1.48218 WP_000579793.1.48242 WP_000579793.1.48244 WP_000579793.1.48247 WP_000579793.1.48253 WP_000579793.1.483 WP_000579793.1.48367 WP_000579793.1.48377 WP_000579793.1.4839 WP_000579793.1.48399 WP_000579793.1.48455 WP_000579793.1.48493 WP_000579793.1.48524 WP_000579793.1.4853 WP_000579793.1.48647 WP_000579793.1.48774 WP_000579793.1.48788 WP_000579793.1.48797 WP_000579793.1.4885 WP_000579793.1.48855 WP_000579793.1.48876 WP_000579793.1.48894 WP_000579793.1.48896 WP_000579793.1.48918 WP_000579793.1.48919 WP_000579793.1.48931 WP_000579793.1.49005 WP_000579793.1.49012 WP_000579793.1.49084 WP_000579793.1.49090 WP_000579793.1.49102 WP_000579793.1.49155 WP_000579793.1.49162 WP_000579793.1.49204 WP_000579793.1.49226 WP_000579793.1.49239 WP_000579793.1.49256 WP_000579793.1.49262 WP_000579793.1.49290 WP_000579793.1.49309 WP_000579793.1.49311 WP_000579793.1.49334 WP_000579793.1.49340 WP_000579793.1.49366 WP_000579793.1.49375 WP_000579793.1.49490 WP_000579793.1.49515 WP_000579793.1.49572 WP_000579793.1.49574 WP_000579793.1.49595 WP_000579793.1.49630 WP_000579793.1.49647 WP_000579793.1.49650 WP_000579793.1.49770 WP_000579793.1.49778 WP_000579793.1.49780 WP_000579793.1.4979 WP_000579793.1.49803 WP_000579793.1.49805 WP_000579793.1.49827 WP_000579793.1.49929 WP_000579793.1.49931 WP_000579793.1.50 WP_000579793.1.50003 WP_000579793.1.50007 WP_000579793.1.50080 WP_000579793.1.5009 WP_000579793.1.50128 WP_000579793.1.50161 WP_000579793.1.50211 WP_000579793.1.50239 WP_000579793.1.50251 WP_000579793.1.50332 WP_000579793.1.50349 WP_000579793.1.50376 WP_000579793.1.50386 WP_000579793.1.50389 WP_000579793.1.50449 WP_000579793.1.50480 WP_000579793.1.5058 WP_000579793.1.50652 WP_000579793.1.50676 WP_000579793.1.50684 WP_000579793.1.50774 WP_000579793.1.50804 WP_000579793.1.50808 WP_000579793.1.5088 WP_000579793.1.50882 WP_000579793.1.50908 WP_000579793.1.50941 WP_000579793.1.50960 WP_000579793.1.51014 WP_000579793.1.51022 WP_000579793.1.51117 WP_000579793.1.51162 WP_000579793.1.51178 WP_000579793.1.51179 WP_000579793.1.51182 WP_000579793.1.51186 WP_000579793.1.51285 WP_000579793.1.51308 WP_000579793.1.51356 WP_000579793.1.5138 WP_000579793.1.51412 WP_000579793.1.51451 WP_000579793.1.51487 WP_000579793.1.51488 WP_000579793.1.51502 WP_000579793.1.51514 WP_000579793.1.51518 WP_000579793.1.51555 WP_000579793.1.51611 WP_000579793.1.51634 WP_000579793.1.51642 WP_000579793.1.51649 WP_000579793.1.51686 WP_000579793.1.51756 WP_000579793.1.51764 WP_000579793.1.51810 WP_000579793.1.51868 WP_000579793.1.51911 WP_000579793.1.51914 WP_000579793.1.51930 WP_000579793.1.51932 WP_000579793.1.51989 WP_000579793.1.51994 WP_000579793.1.520 WP_000579793.1.52047 WP_000579793.1.5211 WP_000579793.1.52121 WP_000579793.1.52123 WP_000579793.1.52148 WP_000579793.1.52156 WP_000579793.1.5216 WP_000579793.1.52255 WP_000579793.1.52301 WP_000579793.1.52321 WP_000579793.1.52346 WP_000579793.1.52353 WP_000579793.1.52361 WP_000579793.1.52446 WP_000579793.1.52456 WP_000579793.1.52528 WP_000579793.1.52582 WP_000579793.1.52586 WP_000579793.1.52637 WP_000579793.1.52653 WP_000579793.1.52656 WP_000579793.1.52675 WP_000579793.1.5273 WP_000579793.1.52738 WP_000579793.1.52743 WP_000579793.1.52744 WP_000579793.1.52824 WP_000579793.1.52833 WP_000579793.1.52857 WP_000579793.1.52898 WP_000579793.1.52915 WP_000579793.1.53100 WP_000579793.1.53107 WP_000579793.1.53119 WP_000579793.1.5313 WP_000579793.1.53179 WP_000579793.1.53190 WP_000579793.1.53198 WP_000579793.1.53203 WP_000579793.1.53234 WP_000579793.1.5333 WP_000579793.1.53362 WP_000579793.1.53385 WP_000579793.1.53406 WP_000579793.1.53436 WP_000579793.1.53454 WP_000579793.1.53466 WP_000579793.1.53529 WP_000579793.1.53534 WP_000579793.1.53543 WP_000579793.1.53567 WP_000579793.1.53694 WP_000579793.1.53757 WP_000579793.1.53778 WP_000579793.1.53781 WP_000579793.1.53790 WP_000579793.1.53812 WP_000579793.1.53896 WP_000579793.1.53961 WP_000579793.1.54033 WP_000579793.1.54061 WP_000579793.1.54068 WP_000579793.1.54075 WP_000579793.1.54082 WP_000579793.1.54085 WP_000579793.1.54196 WP_000579793.1.542 WP_000579793.1.54209 WP_000579793.1.54271 WP_000579793.1.54273 WP_000579793.1.54274 WP_000579793.1.54283 WP_000579793.1.54319 WP_000579793.1.54324 WP_000579793.1.54364 WP_000579793.1.54366 WP_000579793.1.54400 WP_000579793.1.54500 WP_000579793.1.54522 WP_000579793.1.5456 WP_000579793.1.54615 WP_000579793.1.54644 WP_000579793.1.54662 WP_000579793.1.54722 WP_000579793.1.54749 WP_000579793.1.54764 WP_000579793.1.54814 WP_000579793.1.54827 WP_000579793.1.54833 WP_000579793.1.54845 WP_000579793.1.54877 WP_000579793.1.54936 WP_000579793.1.54984 WP_000579793.1.54992 WP_000579793.1.55008 WP_000579793.1.55073 WP_000579793.1.55152 WP_000579793.1.55156 WP_000579793.1.5517 WP_000579793.1.55178 WP_000579793.1.55223 WP_000579793.1.5523 WP_000579793.1.5525 WP_000579793.1.55285 WP_000579793.1.55461 WP_000579793.1.55475 WP_000579793.1.5552 WP_000579793.1.55528 WP_000579793.1.55545 WP_000579793.1.55557 WP_000579793.1.55559 WP_000579793.1.55640 WP_000579793.1.55647 WP_000579793.1.55672 WP_000579793.1.55680 WP_000579793.1.5572 WP_000579793.1.55743 WP_000579793.1.55768 WP_000579793.1.5577 WP_000579793.1.55782 WP_000579793.1.55796 WP_000579793.1.55923 WP_000579793.1.55948 WP_000579793.1.55993 WP_000579793.1.55995 WP_000579793.1.56002 WP_000579793.1.56012 WP_000579793.1.56026 WP_000579793.1.56069 WP_000579793.1.56105 WP_000579793.1.56130 WP_000579793.1.56235 WP_000579793.1.56238 WP_000579793.1.56247 WP_000579793.1.56261 WP_000579793.1.56263 WP_000579793.1.56286 WP_000579793.1.56304 WP_000579793.1.56305 WP_000579793.1.5633 WP_000579793.1.56354 WP_000579793.1.56368 WP_000579793.1.56393 WP_000579793.1.56396 WP_000579793.1.56413 WP_000579793.1.56414 WP_000579793.1.56420 WP_000579793.1.56438 WP_000579793.1.56468 WP_000579793.1.56560 WP_000579793.1.56597 WP_000579793.1.56601 WP_000579793.1.56614 WP_000579793.1.56647 WP_000579793.1.56671 WP_000579793.1.5668 WP_000579793.1.56682 WP_000579793.1.56824 WP_000579793.1.56851 WP_000579793.1.56861 WP_000579793.1.56875 WP_000579793.1.56877 WP_000579793.1.56898 WP_000579793.1.56905 WP_000579793.1.57000 WP_000579793.1.57026 WP_000579793.1.57039 WP_000579793.1.57056 WP_000579793.1.57084 WP_000579793.1.5711 WP_000579793.1.57143 WP_000579793.1.57149 WP_000579793.1.57168 WP_000579793.1.57187 WP_000579793.1.57232 WP_000579793.1.57246 WP_000579793.1.57296 WP_000579793.1.57357 WP_000579793.1.57362 WP_000579793.1.57377 WP_000579793.1.57433 WP_000579793.1.57494 WP_000579793.1.57495 WP_000579793.1.57515 WP_000579793.1.57529 WP_000579793.1.5753 WP_000579793.1.57534 WP_000579793.1.57559 WP_000579793.1.57576 WP_000579793.1.57601 WP_000579793.1.57607 WP_000579793.1.57631 WP_000579793.1.57709 WP_000579793.1.57710 WP_000579793.1.57763 WP_000579793.1.57778 WP_000579793.1.5781 WP_000579793.1.57835 WP_000579793.1.57857 WP_000579793.1.57862 WP_000579793.1.57890 WP_000579793.1.57891 WP_000579793.1.57893 WP_000579793.1.57978 WP_000579793.1.5801 WP_000579793.1.58041 WP_000579793.1.58090 WP_000579793.1.58153 WP_000579793.1.58157 WP_000579793.1.58249 WP_000579793.1.5828 WP_000579793.1.58290 WP_000579793.1.58301 WP_000579793.1.58334 WP_000579793.1.58418 WP_000579793.1.58442 WP_000579793.1.58443 WP_000579793.1.5846 WP_000579793.1.58486 WP_000579793.1.58489 WP_000579793.1.5854 WP_000579793.1.58548 WP_000579793.1.5858 WP_000579793.1.58633 WP_000579793.1.58662 WP_000579793.1.58669 WP_000579793.1.58675 WP_000579793.1.58698 WP_000579793.1.587 WP_000579793.1.58729 WP_000579793.1.58744 WP_000579793.1.58745 WP_000579793.1.58803 WP_000579793.1.58831 WP_000579793.1.5886 WP_000579793.1.58884 WP_000579793.1.58926 WP_000579793.1.59012 WP_000579793.1.59094 WP_000579793.1.59097 WP_000579793.1.59142 WP_000579793.1.59148 WP_000579793.1.59163 WP_000579793.1.59224 WP_000579793.1.59294 WP_000579793.1.59295 WP_000579793.1.59321 WP_000579793.1.59375 WP_000579793.1.59412 WP_000579793.1.59427 WP_000579793.1.59458 WP_000579793.1.59486 WP_000579793.1.59490 WP_000579793.1.59508 WP_000579793.1.59512 WP_000579793.1.5953 WP_000579793.1.59538 WP_000579793.1.59548 WP_000579793.1.59587 WP_000579793.1.59646 WP_000579793.1.59684 WP_000579793.1.59694 WP_000579793.1.59755 WP_000579793.1.59771 WP_000579793.1.5979 WP_000579793.1.59848 WP_000579793.1.59928 WP_000579793.1.59953 WP_000579793.1.60008 WP_000579793.1.60015 WP_000579793.1.60021 WP_000579793.1.60069 WP_000579793.1.60106 WP_000579793.1.60126 WP_000579793.1.60137 WP_000579793.1.60140 WP_000579793.1.60155 WP_000579793.1.60209 WP_000579793.1.60231 WP_000579793.1.60285 WP_000579793.1.60320 WP_000579793.1.6033 WP_000579793.1.60379 WP_000579793.1.60425 WP_000579793.1.60464 WP_000579793.1.60560 WP_000579793.1.60608 WP_000579793.1.60643 WP_000579793.1.60713 WP_000579793.1.60746 WP_000579793.1.608 WP_000579793.1.60838 WP_000579793.1.60851 WP_000579793.1.60855 WP_000579793.1.60857 WP_000579793.1.60866 WP_000579793.1.60874 WP_000579793.1.60897 WP_000579793.1.60941 WP_000579793.1.60976 WP_000579793.1.61078 WP_000579793.1.6108 WP_000579793.1.6114 WP_000579793.1.61146 WP_000579793.1.61200 WP_000579793.1.61232 WP_000579793.1.61233 WP_000579793.1.6129 WP_000579793.1.61296 WP_000579793.1.61345 WP_000579793.1.61356 WP_000579793.1.61417 WP_000579793.1.61434 WP_000579793.1.61501 WP_000579793.1.61509 WP_000579793.1.61519 WP_000579793.1.61574 WP_000579793.1.61582 WP_000579793.1.61594 WP_000579793.1.61595 WP_000579793.1.61609 WP_000579793.1.61667 WP_000579793.1.61671 WP_000579793.1.61712 WP_000579793.1.61714 WP_000579793.1.61730 WP_000579793.1.61737 WP_000579793.1.61743 WP_000579793.1.61857 WP_000579793.1.6190 WP_000579793.1.61908 WP_000579793.1.61918 WP_000579793.1.61922 WP_000579793.1.61952 WP_000579793.1.61968 WP_000579793.1.62007 WP_000579793.1.62025 WP_000579793.1.62076 WP_000579793.1.6210 WP_000579793.1.62120 WP_000579793.1.62122 WP_000579793.1.62142 WP_000579793.1.62158 WP_000579793.1.62201 WP_000579793.1.62204 WP_000579793.1.62210 WP_000579793.1.62222 WP_000579793.1.62271 WP_000579793.1.62304 WP_000579793.1.62310 WP_000579793.1.62339 WP_000579793.1.62364 WP_000579793.1.62374 WP_000579793.1.62403 WP_000579793.1.62412 WP_000579793.1.62486 WP_000579793.1.62488 WP_000579793.1.62522 WP_000579793.1.6253 WP_000579793.1.62570 WP_000579793.1.62619 WP_000579793.1.627 WP_000579793.1.62745 WP_000579793.1.62757 WP_000579793.1.62828 WP_000579793.1.62853 WP_000579793.1.62903 WP_000579793.1.62910 WP_000579793.1.6292 WP_000579793.1.62955 WP_000579793.1.62976 WP_000579793.1.62983 WP_000579793.1.62988 WP_000579793.1.63043 WP_000579793.1.63045 WP_000579793.1.63063 WP_000579793.1.63102 WP_000579793.1.63155 WP_000579793.1.63181 WP_000579793.1.63186 WP_000579793.1.63203 WP_000579793.1.63229 WP_000579793.1.63234 WP_000579793.1.63256 WP_000579793.1.63290 WP_000579793.1.63358 WP_000579793.1.63382 WP_000579793.1.63432 WP_000579793.1.63455 WP_000579793.1.63461 WP_000579793.1.63479 WP_000579793.1.63497 WP_000579793.1.63499 WP_000579793.1.63509 WP_000579793.1.63513 WP_000579793.1.63525 WP_000579793.1.63529 WP_000579793.1.6357 WP_000579793.1.63577 WP_000579793.1.63585 WP_000579793.1.63603 WP_000579793.1.63664 WP_000579793.1.63677 WP_000579793.1.6370 WP_000579793.1.63718 WP_000579793.1.63731 WP_000579793.1.63748 WP_000579793.1.6375 WP_000579793.1.63757 WP_000579793.1.63782 WP_000579793.1.63824 WP_000579793.1.63831 WP_000579793.1.63834 WP_000579793.1.63851 WP_000579793.1.63863 WP_000579793.1.63992 WP_000579793.1.64010 WP_000579793.1.64034 WP_000579793.1.64046 WP_000579793.1.64072 WP_000579793.1.64085 WP_000579793.1.64109 WP_000579793.1.64157 WP_000579793.1.64217 WP_000579793.1.64229 WP_000579793.1.6423 WP_000579793.1.64242 WP_000579793.1.64244 WP_000579793.1.64266 WP_000579793.1.64294 WP_000579793.1.64350 WP_000579793.1.6437 WP_000579793.1.64385 WP_000579793.1.64389 WP_000579793.1.64403 WP_000579793.1.64462 WP_000579793.1.64500 WP_000579793.1.64569 WP_000579793.1.64597 WP_000579793.1.64649 WP_000579793.1.64667 WP_000579793.1.64690 WP_000579793.1.64702 WP_000579793.1.64711 WP_000579793.1.64757 WP_000579793.1.64771 WP_000579793.1.64781 WP_000579793.1.64831 WP_000579793.1.6489 WP_000579793.1.64944 WP_000579793.1.65011 WP_000579793.1.65018 WP_000579793.1.65028 WP_000579793.1.65163 WP_000579793.1.65171 WP_000579793.1.65248 WP_000579793.1.6525 WP_000579793.1.65348 WP_000579793.1.6535 WP_000579793.1.65357 WP_000579793.1.65394 WP_000579793.1.65437 WP_000579793.1.65474 WP_000579793.1.6550 WP_000579793.1.65508 WP_000579793.1.65538 WP_000579793.1.65572 WP_000579793.1.65601 WP_000579793.1.65633 WP_000579793.1.6565 WP_000579793.1.65687 WP_000579793.1.65696 WP_000579793.1.65698 WP_000579793.1.6572 WP_000579793.1.6575 WP_000579793.1.65771 WP_000579793.1.65782 WP_000579793.1.65790 WP_000579793.1.65795 WP_000579793.1.65838 WP_000579793.1.65881 WP_000579793.1.65883 WP_000579793.1.65901 WP_000579793.1.6594 WP_000579793.1.6595 WP_000579793.1.65968 WP_000579793.1.66074 WP_000579793.1.66167 WP_000579793.1.66171 WP_000579793.1.66235 WP_000579793.1.66250 WP_000579793.1.66270 WP_000579793.1.6630 WP_000579793.1.66314 WP_000579793.1.66315 WP_000579793.1.66358 WP_000579793.1.66362 WP_000579793.1.66368 WP_000579793.1.6638 WP_000579793.1.66385 WP_000579793.1.6640 WP_000579793.1.66400 WP_000579793.1.66428 WP_000579793.1.66446 WP_000579793.1.66534 WP_000579793.1.66539 WP_000579793.1.66600 WP_000579793.1.66698 WP_000579793.1.66702 WP_000579793.1.66733 WP_000579793.1.66779 WP_000579793.1.6680 WP_000579793.1.66824 WP_000579793.1.66825 WP_000579793.1.66834 WP_000579793.1.66901 WP_000579793.1.66959 WP_000579793.1.66962 WP_000579793.1.67 WP_000579793.1.67037 WP_000579793.1.67045 WP_000579793.1.67075 WP_000579793.1.6710 WP_000579793.1.67173 WP_000579793.1.67181 WP_000579793.1.67184 WP_000579793.1.67268 WP_000579793.1.67279 WP_000579793.1.67347 WP_000579793.1.67374 WP_000579793.1.67405 WP_000579793.1.67465 WP_000579793.1.67552 WP_000579793.1.6760 WP_000579793.1.67603 WP_000579793.1.67617 WP_000579793.1.67633 WP_000579793.1.67637 WP_000579793.1.67682 WP_000579793.1.67731 WP_000579793.1.67803 WP_000579793.1.6782 WP_000579793.1.67827 WP_000579793.1.67887 WP_000579793.1.67924 WP_000579793.1.67932 WP_000579793.1.67970 WP_000579793.1.67988 WP_000579793.1.68073 WP_000579793.1.6809 WP_000579793.1.68115 WP_000579793.1.68140 WP_000579793.1.68159 WP_000579793.1.68201 WP_000579793.1.68206 WP_000579793.1.6827 WP_000579793.1.68275 WP_000579793.1.6849 WP_000579793.1.68547 WP_000579793.1.6857 WP_000579793.1.6858 WP_000579793.1.68589 WP_000579793.1.68652 WP_000579793.1.68655 WP_000579793.1.68656 WP_000579793.1.68658 WP_000579793.1.68677 WP_000579793.1.6869 WP_000579793.1.68690 WP_000579793.1.6875 WP_000579793.1.68778 WP_000579793.1.68787 WP_000579793.1.68816 WP_000579793.1.68818 WP_000579793.1.6882 WP_000579793.1.6883 WP_000579793.1.68893 WP_000579793.1.68894 WP_000579793.1.68928 WP_000579793.1.68958 WP_000579793.1.68966 WP_000579793.1.68975 WP_000579793.1.68999 WP_000579793.1.69006 WP_000579793.1.69029 WP_000579793.1.6905 WP_000579793.1.69058 WP_000579793.1.69080 WP_000579793.1.69086 WP_000579793.1.6913 WP_000579793.1.69131 WP_000579793.1.69146 WP_000579793.1.69236 WP_000579793.1.69255 WP_000579793.1.69273 WP_000579793.1.69288 WP_000579793.1.69346 WP_000579793.1.69357 WP_000579793.1.69371 WP_000579793.1.69397 WP_000579793.1.69465 WP_000579793.1.69485 WP_000579793.1.69564 WP_000579793.1.69575 WP_000579793.1.69592 WP_000579793.1.69597 WP_000579793.1.69616 WP_000579793.1.69644 WP_000579793.1.69704 WP_000579793.1.69710 WP_000579793.1.69760 WP_000579793.1.69767 WP_000579793.1.69787 WP_000579793.1.69808 WP_000579793.1.69817 WP_000579793.1.69848 WP_000579793.1.69965 WP_000579793.1.69975 WP_000579793.1.69977 WP_000579793.1.69982 WP_000579793.1.70028 WP_000579793.1.70088 WP_000579793.1.7010 WP_000579793.1.7014 WP_000579793.1.70183 WP_000579793.1.7021 WP_000579793.1.70241 WP_000579793.1.70269 WP_000579793.1.70272 WP_000579793.1.70281 WP_000579793.1.70289 WP_000579793.1.70326 WP_000579793.1.70355 WP_000579793.1.7044 WP_000579793.1.70440 WP_000579793.1.70447 WP_000579793.1.70485 WP_000579793.1.70491 WP_000579793.1.70523 WP_000579793.1.70531 WP_000579793.1.70547 WP_000579793.1.7055 WP_000579793.1.70596 WP_000579793.1.70643 WP_000579793.1.70644 WP_000579793.1.70678 WP_000579793.1.70683 WP_000579793.1.70685 WP_000579793.1.70712 WP_000579793.1.70785 WP_000579793.1.70792 WP_000579793.1.70837 WP_000579793.1.70883 WP_000579793.1.70914 WP_000579793.1.70922 WP_000579793.1.7093 WP_000579793.1.70948 WP_000579793.1.70969 WP_000579793.1.70985 WP_000579793.1.70986 WP_000579793.1.71116 WP_000579793.1.71146 WP_000579793.1.71150 WP_000579793.1.71165 WP_000579793.1.71172 WP_000579793.1.71184 WP_000579793.1.71188 WP_000579793.1.71201 WP_000579793.1.71202 WP_000579793.1.71243 WP_000579793.1.71248 WP_000579793.1.71305 WP_000579793.1.71306 WP_000579793.1.71337 WP_000579793.1.71378 WP_000579793.1.71401 WP_000579793.1.71407 WP_000579793.1.71450 WP_000579793.1.71452 WP_000579793.1.71481 WP_000579793.1.71583 WP_000579793.1.71626 WP_000579793.1.71649 WP_000579793.1.71691 WP_000579793.1.71702 WP_000579793.1.71750 WP_000579793.1.71845 WP_000579793.1.71881 WP_000579793.1.71908 WP_000579793.1.71923 WP_000579793.1.71952 WP_000579793.1.71973 WP_000579793.1.71979 WP_000579793.1.71984 WP_000579793.1.720 WP_000579793.1.72065 WP_000579793.1.72100 WP_000579793.1.72105 WP_000579793.1.72107 WP_000579793.1.72119 WP_000579793.1.72188 WP_000579793.1.72190 WP_000579793.1.72203 WP_000579793.1.72221 WP_000579793.1.72234 WP_000579793.1.72277 WP_000579793.1.72283 WP_000579793.1.72300 WP_000579793.1.72325 WP_000579793.1.72339 WP_000579793.1.72351 WP_000579793.1.72372 WP_000579793.1.72376 WP_000579793.1.72382 WP_000579793.1.7243 WP_000579793.1.72532 WP_000579793.1.72594 WP_000579793.1.72602 WP_000579793.1.72629 WP_000579793.1.72642 WP_000579793.1.72671 WP_000579793.1.72716 WP_000579793.1.72718 WP_000579793.1.72827 WP_000579793.1.72865 WP_000579793.1.72871 WP_000579793.1.72894 WP_000579793.1.72897 WP_000579793.1.72944 WP_000579793.1.7295 WP_000579793.1.72975 WP_000579793.1.73062 WP_000579793.1.73068 WP_000579793.1.73144 WP_000579793.1.7315 WP_000579793.1.73164 WP_000579793.1.73200 WP_000579793.1.73328 WP_000579793.1.7334 WP_000579793.1.73377 WP_000579793.1.73481 WP_000579793.1.73535 WP_000579793.1.7356 WP_000579793.1.73561 WP_000579793.1.73581 WP_000579793.1.73617 WP_000579793.1.73667 WP_000579793.1.73708 WP_000579793.1.7374 WP_000579793.1.73753 WP_000579793.1.73758 WP_000579793.1.73794 WP_000579793.1.73804 WP_000579793.1.7387 WP_000579793.1.73924 WP_000579793.1.73926 WP_000579793.1.7394 WP_000579793.1.73945 WP_000579793.1.74028 WP_000579793.1.74029 WP_000579793.1.74049 WP_000579793.1.74117 WP_000579793.1.74174 WP_000579793.1.74181 WP_000579793.1.74191 WP_000579793.1.74207 WP_000579793.1.74248 WP_000579793.1.743 WP_000579793.1.74300 WP_000579793.1.7433 WP_000579793.1.74379 WP_000579793.1.74410 WP_000579793.1.74414 WP_000579793.1.74466 WP_000579793.1.74469 WP_000579793.1.74481 WP_000579793.1.74500 WP_000579793.1.74529 WP_000579793.1.74545 WP_000579793.1.74578 WP_000579793.1.74620 WP_000579793.1.74632 WP_000579793.1.74639 WP_000579793.1.74644 WP_000579793.1.74661 WP_000579793.1.74702 WP_000579793.1.74745 WP_000579793.1.74757 WP_000579793.1.74876 WP_000579793.1.74946 WP_000579793.1.74972 WP_000579793.1.74992 WP_000579793.1.74996 WP_000579793.1.75009 WP_000579793.1.75051 WP_000579793.1.75056 WP_000579793.1.75129 WP_000579793.1.75134 WP_000579793.1.75148 WP_000579793.1.75159 WP_000579793.1.75168 WP_000579793.1.75180 WP_000579793.1.75187 WP_000579793.1.75288 WP_000579793.1.75334 WP_000579793.1.75362 WP_000579793.1.75385 WP_000579793.1.75392 WP_000579793.1.75400 WP_000579793.1.75450 WP_000579793.1.7558 WP_000579793.1.75607 WP_000579793.1.75609 WP_000579793.1.75664 WP_000579793.1.75716 WP_000579793.1.75760 WP_000579793.1.75764 WP_000579793.1.75793 WP_000579793.1.75794 WP_000579793.1.75810 WP_000579793.1.75828 WP_000579793.1.75837 WP_000579793.1.75863 WP_000579793.1.75874 WP_000579793.1.75902 WP_000579793.1.75945 WP_000579793.1.76 WP_000579793.1.76020 WP_000579793.1.76055 WP_000579793.1.76108 WP_000579793.1.76137 WP_000579793.1.76164 WP_000579793.1.76186 WP_000579793.1.76208 WP_000579793.1.76252 WP_000579793.1.7629 WP_000579793.1.76301 WP_000579793.1.76345 WP_000579793.1.76346 WP_000579793.1.76445 WP_000579793.1.76451 WP_000579793.1.76471 WP_000579793.1.76495 WP_000579793.1.76548 WP_000579793.1.7657 WP_000579793.1.76576 WP_000579793.1.7660 WP_000579793.1.76611 WP_000579793.1.76673 WP_000579793.1.76706 WP_000579793.1.76721 WP_000579793.1.76738 WP_000579793.1.76756 WP_000579793.1.76760 WP_000579793.1.76776 WP_000579793.1.76866 WP_000579793.1.76875 WP_000579793.1.76880 WP_000579793.1.76899 WP_000579793.1.76913 WP_000579793.1.76968 WP_000579793.1.77017 WP_000579793.1.77033 WP_000579793.1.77038 WP_000579793.1.77047 WP_000579793.1.77080 WP_000579793.1.7712 WP_000579793.1.77180 WP_000579793.1.77244 WP_000579793.1.77271 WP_000579793.1.77292 WP_000579793.1.77306 WP_000579793.1.77349 WP_000579793.1.77356 WP_000579793.1.77390 WP_000579793.1.77431 WP_000579793.1.77436 WP_000579793.1.77440 WP_000579793.1.77475 WP_000579793.1.77496 WP_000579793.1.77514 WP_000579793.1.77529 WP_000579793.1.77543 WP_000579793.1.77549 WP_000579793.1.77629 WP_000579793.1.77692 WP_000579793.1.77729 WP_000579793.1.77754 WP_000579793.1.77761 WP_000579793.1.7782 WP_000579793.1.77846 WP_000579793.1.77851 WP_000579793.1.77871 WP_000579793.1.77898 WP_000579793.1.77918 WP_000579793.1.7792 WP_000579793.1.7793 WP_000579793.1.77951 WP_000579793.1.77960 WP_000579793.1.77971 WP_000579793.1.77983 WP_000579793.1.77989 WP_000579793.1.78 WP_000579793.1.78016 WP_000579793.1.7802 WP_000579793.1.78033 WP_000579793.1.78051 WP_000579793.1.78076 WP_000579793.1.78096 WP_000579793.1.78100 WP_000579793.1.78110 WP_000579793.1.78120 WP_000579793.1.78170 WP_000579793.1.78180 WP_000579793.1.78245 WP_000579793.1.78259 WP_000579793.1.78301 WP_000579793.1.78366 WP_000579793.1.78383 WP_000579793.1.78407 WP_000579793.1.78443 WP_000579793.1.78501 WP_000579793.1.78502 WP_000579793.1.78602 WP_000579793.1.78603 WP_000579793.1.7861 WP_000579793.1.78618 WP_000579793.1.78632 WP_000579793.1.78658 WP_000579793.1.78673 WP_000579793.1.78697 WP_000579793.1.78734 WP_000579793.1.78735 WP_000579793.1.78738 WP_000579793.1.7877 WP_000579793.1.78789 WP_000579793.1.78802 WP_000579793.1.78815 WP_000579793.1.78830 WP_000579793.1.78835 WP_000579793.1.78871 WP_000579793.1.78874 WP_000579793.1.78877 WP_000579793.1.78896 WP_000579793.1.78913 WP_000579793.1.78918 WP_000579793.1.7893 WP_000579793.1.78930 WP_000579793.1.78951 WP_000579793.1.79032 WP_000579793.1.79081 WP_000579793.1.79099 WP_000579793.1.79151 WP_000579793.1.79167 WP_000579793.1.79189 WP_000579793.1.79235 WP_000579793.1.79289 WP_000579793.1.79297 WP_000579793.1.79302 WP_000579793.1.79335 WP_000579793.1.794 WP_000579793.1.79462 WP_000579793.1.79468 WP_000579793.1.79472 WP_000579793.1.79490 WP_000579793.1.79495 WP_000579793.1.79529 WP_000579793.1.79570 WP_000579793.1.79580 WP_000579793.1.79586 WP_000579793.1.7964 WP_000579793.1.79659 WP_000579793.1.79668 WP_000579793.1.79708 WP_000579793.1.79738 WP_000579793.1.79778 WP_000579793.1.7982 WP_000579793.1.79845 WP_000579793.1.79910 WP_000579793.1.79914 WP_000579793.1.7994 WP_000579793.1.79942 WP_000579793.1.79945 WP_000579793.1.79966 WP_000579793.1.79996 WP_000579793.1.80077 WP_000579793.1.80137 WP_000579793.1.80182 WP_000579793.1.80229 WP_000579793.1.80236 WP_000579793.1.8024 WP_000579793.1.80249 WP_000579793.1.80254 WP_000579793.1.80293 WP_000579793.1.80296 WP_000579793.1.80366 WP_000579793.1.80380 WP_000579793.1.80479 WP_000579793.1.80496 WP_000579793.1.80638 WP_000579793.1.80651 WP_000579793.1.80667 WP_000579793.1.80674 WP_000579793.1.80707 WP_000579793.1.80723 WP_000579793.1.80725 WP_000579793.1.80750 WP_000579793.1.80757 WP_000579793.1.80780 WP_000579793.1.80803 WP_000579793.1.80819 WP_000579793.1.80827 WP_000579793.1.80831 WP_000579793.1.80840 WP_000579793.1.80850 WP_000579793.1.80874 WP_000579793.1.80876 WP_000579793.1.80881 WP_000579793.1.80913 WP_000579793.1.80927 WP_000579793.1.80939 WP_000579793.1.8096 WP_000579793.1.81037 WP_000579793.1.8106 WP_000579793.1.81067 WP_000579793.1.81069 WP_000579793.1.81109 WP_000579793.1.81110 WP_000579793.1.81118 WP_000579793.1.81149 WP_000579793.1.81175 WP_000579793.1.8119 WP_000579793.1.81193 WP_000579793.1.81197 WP_000579793.1.81225 WP_000579793.1.8127 WP_000579793.1.8130 WP_000579793.1.81321 WP_000579793.1.8134 WP_000579793.1.81354 WP_000579793.1.81388 WP_000579793.1.81404 WP_000579793.1.81409 WP_000579793.1.81410 WP_000579793.1.81425 WP_000579793.1.81472 WP_000579793.1.81504 WP_000579793.1.81548 WP_000579793.1.81667 WP_000579793.1.81668 WP_000579793.1.8168 WP_000579793.1.81727 WP_000579793.1.81746 WP_000579793.1.81750 WP_000579793.1.81768 WP_000579793.1.81785 WP_000579793.1.81902 WP_000579793.1.81941 WP_000579793.1.81974 WP_000579793.1.81995 WP_000579793.1.82149 WP_000579793.1.82258 WP_000579793.1.82269 WP_000579793.1.82337 WP_000579793.1.82352 WP_000579793.1.8236 WP_000579793.1.82369 WP_000579793.1.82395 WP_000579793.1.82401 WP_000579793.1.82420 WP_000579793.1.82434 WP_000579793.1.8247 WP_000579793.1.82474 WP_000579793.1.82479 WP_000579793.1.82503 WP_000579793.1.82515 WP_000579793.1.82530 WP_000579793.1.82569 WP_000579793.1.82636 WP_000579793.1.82637 WP_000579793.1.82676 WP_000579793.1.82761 WP_000579793.1.82763 WP_000579793.1.8282 WP_000579793.1.82895 WP_000579793.1.82899 WP_000579793.1.82944 WP_000579793.1.82946 WP_000579793.1.82956 WP_000579793.1.82964 WP_000579793.1.82992 WP_000579793.1.83005 WP_000579793.1.83006 WP_000579793.1.83061 WP_000579793.1.83092 WP_000579793.1.83119 WP_000579793.1.83163 WP_000579793.1.83204 WP_000579793.1.83221 WP_000579793.1.83247 WP_000579793.1.83252 WP_000579793.1.83305 WP_000579793.1.83331 WP_000579793.1.83354 WP_000579793.1.83356 WP_000579793.1.83360 WP_000579793.1.83365 WP_000579793.1.83378 WP_000579793.1.83388 WP_000579793.1.83413 WP_000579793.1.83491 WP_000579793.1.83516 WP_000579793.1.83523 WP_000579793.1.8354 WP_000579793.1.83558 WP_000579793.1.83572 WP_000579793.1.83651 WP_000579793.1.83721 WP_000579793.1.83759 WP_000579793.1.83760 WP_000579793.1.83897 WP_000579793.1.83960 WP_000579793.1.8399 WP_000579793.1.83995 WP_000579793.1.84000 WP_000579793.1.84011 WP_000579793.1.84075 WP_000579793.1.84083 WP_000579793.1.84086 WP_000579793.1.84103 WP_000579793.1.84115 WP_000579793.1.84154 WP_000579793.1.84168 WP_000579793.1.84205 WP_000579793.1.84229 WP_000579793.1.84283 WP_000579793.1.84300 WP_000579793.1.84325 WP_000579793.1.84359 WP_000579793.1.84373 WP_000579793.1.84392 WP_000579793.1.8441 WP_000579793.1.84459 WP_000579793.1.84461 WP_000579793.1.84497 WP_000579793.1.84515 WP_000579793.1.84523 WP_000579793.1.84532 WP_000579793.1.84551 WP_000579793.1.84572 WP_000579793.1.84598 WP_000579793.1.84644 WP_000579793.1.84659 WP_000579793.1.84683 WP_000579793.1.84693 WP_000579793.1.84721 WP_000579793.1.84876 WP_000579793.1.84899 WP_000579793.1.849 WP_000579793.1.8497 WP_000579793.1.84983 WP_000579793.1.850 WP_000579793.1.85031 WP_000579793.1.85040 WP_000579793.1.85079 WP_000579793.1.85094 WP_000579793.1.85120 WP_000579793.1.85134 WP_000579793.1.85178 WP_000579793.1.85180 WP_000579793.1.85190 WP_000579793.1.8526 WP_000579793.1.85271 WP_000579793.1.85301 WP_000579793.1.8533 WP_000579793.1.8537 WP_000579793.1.85433 WP_000579793.1.8545 WP_000579793.1.85456 WP_000579793.1.85469 WP_000579793.1.85481 WP_000579793.1.85483 WP_000579793.1.8552 WP_000579793.1.85541 WP_000579793.1.8556 WP_000579793.1.85615 WP_000579793.1.85617 WP_000579793.1.85663 WP_000579793.1.85672 WP_000579793.1.85675 WP_000579793.1.85742 WP_000579793.1.85759 WP_000579793.1.85777 WP_000579793.1.85780 WP_000579793.1.85784 WP_000579793.1.85797 WP_000579793.1.85855 WP_000579793.1.85864 WP_000579793.1.85886 WP_000579793.1.85900 WP_000579793.1.85904 WP_000579793.1.8591 WP_000579793.1.85976 WP_000579793.1.85982 WP_000579793.1.86007 WP_000579793.1.86092 WP_000579793.1.86138 WP_000579793.1.86157 WP_000579793.1.8616 WP_000579793.1.86206 WP_000579793.1.86224 WP_000579793.1.86259 WP_000579793.1.86306 WP_000579793.1.86335 WP_000579793.1.86347 WP_000579793.1.86356 WP_000579793.1.86380 WP_000579793.1.86389 WP_000579793.1.86442 WP_000579793.1.86450 WP_000579793.1.86469 WP_000579793.1.8647 WP_000579793.1.86514 WP_000579793.1.86580 WP_000579793.1.86588 WP_000579793.1.86593 WP_000579793.1.86601 WP_000579793.1.86610 WP_000579793.1.86658 WP_000579793.1.86661 WP_000579793.1.86676 WP_000579793.1.86699 WP_000579793.1.8672 WP_000579793.1.86744 WP_000579793.1.8678 WP_000579793.1.86807 WP_000579793.1.86810 WP_000579793.1.8684 WP_000579793.1.86859 WP_000579793.1.86860 WP_000579793.1.86895 WP_000579793.1.86906 WP_000579793.1.86915 WP_000579793.1.86921 WP_000579793.1.86982 WP_000579793.1.87038 WP_000579793.1.87095 WP_000579793.1.87187 WP_000579793.1.87219 WP_000579793.1.87265 WP_000579793.1.87323 WP_000579793.1.8736 WP_000579793.1.87365 WP_000579793.1.87460 WP_000579793.1.87484 WP_000579793.1.87500 WP_000579793.1.87552 WP_000579793.1.87583 WP_000579793.1.87584 WP_000579793.1.87618 WP_000579793.1.87626 WP_000579793.1.8767 WP_000579793.1.87712 WP_000579793.1.87779 WP_000579793.1.87905 WP_000579793.1.87945 WP_000579793.1.87999 WP_000579793.1.88019 WP_000579793.1.88052 WP_000579793.1.88073 WP_000579793.1.8809 WP_000579793.1.88136 WP_000579793.1.88165 WP_000579793.1.88174 WP_000579793.1.88185 WP_000579793.1.88222 WP_000579793.1.88264 WP_000579793.1.88275 WP_000579793.1.88291 WP_000579793.1.88293 WP_000579793.1.88356 WP_000579793.1.8837 WP_000579793.1.88393 WP_000579793.1.88423 WP_000579793.1.88474 WP_000579793.1.8849 WP_000579793.1.88508 WP_000579793.1.88597 WP_000579793.1.88620 WP_000579793.1.88675 WP_000579793.1.88698 WP_000579793.1.88703 WP_000579793.1.88731 WP_000579793.1.88776 WP_000579793.1.88792 WP_000579793.1.88854 WP_000579793.1.88902 WP_000579793.1.8891 WP_000579793.1.88966 WP_000579793.1.88968 WP_000579793.1.88981 WP_000579793.1.88995 WP_000579793.1.88998 WP_000579793.1.89008 WP_000579793.1.89054 WP_000579793.1.89116 WP_000579793.1.89120 WP_000579793.1.89138 WP_000579793.1.89174 WP_000579793.1.89177 WP_000579793.1.89188 WP_000579793.1.89215 WP_000579793.1.89221 WP_000579793.1.89291 WP_000579793.1.89304 WP_000579793.1.89362 WP_000579793.1.89408 WP_000579793.1.89425 WP_000579793.1.89452 WP_000579793.1.89512 WP_000579793.1.89527 WP_000579793.1.89570 WP_000579793.1.8958 WP_000579793.1.89604 WP_000579793.1.89606 WP_000579793.1.8961 WP_000579793.1.89622 WP_000579793.1.89632 WP_000579793.1.89634 WP_000579793.1.89647 WP_000579793.1.89659 WP_000579793.1.89680 WP_000579793.1.89746 WP_000579793.1.89777 WP_000579793.1.89789 WP_000579793.1.89832 WP_000579793.1.89870 WP_000579793.1.89902 WP_000579793.1.89940 WP_000579793.1.8996 WP_000579793.1.89965 WP_000579793.1.9003 WP_000579793.1.90033 WP_000579793.1.90097 WP_000579793.1.90108 WP_000579793.1.90248 WP_000579793.1.90252 WP_000579793.1.90293 WP_000579793.1.90363 WP_000579793.1.90417 WP_000579793.1.90421 WP_000579793.1.90453 WP_000579793.1.90458 WP_000579793.1.90472 WP_000579793.1.90522 WP_000579793.1.90540 WP_000579793.1.90557 WP_000579793.1.90563 WP_000579793.1.90585 WP_000579793.1.90641 WP_000579793.1.90686 WP_000579793.1.90734 WP_000579793.1.90759 WP_000579793.1.90792 WP_000579793.1.90814 WP_000579793.1.90859 WP_000579793.1.90866 WP_000579793.1.90876 WP_000579793.1.9089 WP_000579793.1.9093 WP_000579793.1.90959 WP_000579793.1.90973 WP_000579793.1.90983 WP_000579793.1.90984 WP_000579793.1.90991 WP_000579793.1.91003 WP_000579793.1.91023 WP_000579793.1.91069 WP_000579793.1.91156 WP_000579793.1.91189 WP_000579793.1.91215 WP_000579793.1.9131 WP_000579793.1.9137 WP_000579793.1.91372 WP_000579793.1.91424 WP_000579793.1.91459 WP_000579793.1.91473 WP_000579793.1.91474 WP_000579793.1.91505 WP_000579793.1.91512 WP_000579793.1.91524 WP_000579793.1.91528 WP_000579793.1.91564 WP_000579793.1.91625 WP_000579793.1.91628 WP_000579793.1.91655 WP_000579793.1.91724 WP_000579793.1.91732 WP_000579793.1.91742 WP_000579793.1.91772 WP_000579793.1.91776 WP_000579793.1.91788 WP_000579793.1.91795 WP_000579793.1.91898 WP_000579793.1.91904 WP_000579793.1.91914 WP_000579793.1.91974 WP_000579793.1.92013 WP_000579793.1.92047 WP_000579793.1.92060 WP_000579793.1.92068 WP_000579793.1.92082 WP_000579793.1.92093 WP_000579793.1.92108 WP_000579793.1.92122 WP_000579793.1.92129 WP_000579793.1.92149 WP_000579793.1.92171 WP_000579793.1.92183 WP_000579793.1.92208 WP_000579793.1.92213 WP_000579793.1.9222 WP_000579793.1.92268 WP_000579793.1.92270 WP_000579793.1.92299 WP_000579793.1.92310 WP_000579793.1.92318 WP_000579793.1.92399 WP_000579793.1.92408 WP_000579793.1.92411 WP_000579793.1.92439 WP_000579793.1.92443 WP_000579793.1.92452 WP_000579793.1.92482 WP_000579793.1.92531 WP_000579793.1.92557 WP_000579793.1.92562 WP_000579793.1.92575 WP_000579793.1.92628 WP_000579793.1.92659 WP_000579793.1.92669 WP_000579793.1.92671 WP_000579793.1.92738 WP_000579793.1.92806 WP_000579793.1.92832 WP_000579793.1.92836 WP_000579793.1.92843 WP_000579793.1.92879 WP_000579793.1.92883 WP_000579793.1.92890 WP_000579793.1.92929 WP_000579793.1.93076 WP_000579793.1.93086 WP_000579793.1.93101 WP_000579793.1.93136 WP_000579793.1.93155 WP_000579793.1.93215 WP_000579793.1.93275 WP_000579793.1.93350 WP_000579793.1.93365 WP_000579793.1.93376 WP_000579793.1.93524 WP_000579793.1.93543 WP_000579793.1.93577 WP_000579793.1.93596 WP_000579793.1.93604 WP_000579793.1.93648 WP_000579793.1.93650 WP_000579793.1.93656 WP_000579793.1.93662 WP_000579793.1.93691 WP_000579793.1.937 WP_000579793.1.93705 WP_000579793.1.93761 WP_000579793.1.9380 WP_000579793.1.93804 WP_000579793.1.93809 WP_000579793.1.93837 WP_000579793.1.9389 WP_000579793.1.93994 WP_000579793.1.94039 WP_000579793.1.94056 WP_000579793.1.94064 WP_000579793.1.94070 WP_000579793.1.94072 WP_000579793.1.94162 WP_000579793.1.94168 WP_000579793.1.94198 WP_000579793.1.9432 WP_000579793.1.94352 WP_000579793.1.94354 WP_000579793.1.94380 WP_000579793.1.94383 WP_000579793.1.9440 WP_000579793.1.94458 WP_000579793.1.94473 WP_000579793.1.94565 WP_000579793.1.94584 WP_000579793.1.94598 WP_000579793.1.94622 WP_000579793.1.9463 WP_000579793.1.94649 WP_000579793.1.94670 WP_000579793.1.94674 WP_000579793.1.9481 WP_000579793.1.94835 WP_000579793.1.94862 WP_000579793.1.94947 WP_000579793.1.94959 WP_000579793.1.94967 WP_000579793.1.94971 WP_000579793.1.94982 WP_000579793.1.94987 WP_000579793.1.95051 WP_000579793.1.95085 WP_000579793.1.95094 WP_000579793.1.95121 WP_000579793.1.95136 WP_000579793.1.95152 WP_000579793.1.9516 WP_000579793.1.95171 WP_000579793.1.95235 WP_000579793.1.9527 WP_000579793.1.95282 WP_000579793.1.95289 WP_000579793.1.95298 WP_000579793.1.95404 WP_000579793.1.95434 WP_000579793.1.95447 WP_000579793.1.95456 WP_000579793.1.95465 WP_000579793.1.95546 WP_000579793.1.95607 WP_000579793.1.95630 WP_000579793.1.95656 WP_000579793.1.95701 WP_000579793.1.95703 WP_000579793.1.95757 WP_000579793.1.95803 WP_000579793.1.95805 WP_000579793.1.95826 WP_000579793.1.9586 WP_000579793.1.95866 WP_000579793.1.95901 WP_000579793.1.95911 WP_000579793.1.95963 WP_000579793.1.96045 WP_000579793.1.96107 WP_000579793.1.96139 WP_000579793.1.96172 WP_000579793.1.96206 WP_000579793.1.9624 WP_000579793.1.96260 WP_000579793.1.9627 WP_000579793.1.96317 WP_000579793.1.96340 WP_000579793.1.96343 WP_000579793.1.96348 WP_000579793.1.96349 WP_000579793.1.96380 WP_000579793.1.96404 WP_000579793.1.96429 WP_000579793.1.9644 WP_000579793.1.96469 WP_000579793.1.96497 WP_000579793.1.96500 WP_000579793.1.96521 WP_000579793.1.96533 WP_000579793.1.96537 WP_000579793.1.96555 WP_000579793.1.96563 WP_000579793.1.96588 WP_000579793.1.96640 WP_000579793.1.96732 WP_000579793.1.96735 WP_000579793.1.96761 WP_000579793.1.96771 WP_000579793.1.96798 WP_000579793.1.96810 WP_000579793.1.96876 WP_000579793.1.96890 WP_000579793.1.96993 WP_000579793.1.97015 WP_000579793.1.97043 WP_000579793.1.97089 WP_000579793.1.97103 WP_000579793.1.97109 WP_000579793.1.97145 WP_000579793.1.97190 WP_000579793.1.97318 WP_000579793.1.97322 WP_000579793.1.97328 WP_000579793.1.97369 WP_000579793.1.97386 WP_000579793.1.97413 WP_000579793.1.97480 WP_000579793.1.97547 WP_000579793.1.97594 WP_000579793.1.97597 WP_000579793.1.97613 WP_000579793.1.97620 WP_000579793.1.97628 WP_000579793.1.97640 WP_000579793.1.97648 WP_000579793.1.97656 WP_000579793.1.97693 WP_000579793.1.97704 WP_000579793.1.97725 WP_000579793.1.97726 WP_000579793.1.97727 WP_000579793.1.97732 WP_000579793.1.97736 WP_000579793.1.9774 WP_000579793.1.9775 WP_000579793.1.97768 WP_000579793.1.97846 WP_000579793.1.9793 WP_000579793.1.97981 WP_000579793.1.97991 WP_000579793.1.98006 WP_000579793.1.98019 WP_000579793.1.98022 WP_000579793.1.98107 WP_000579793.1.9811 WP_000579793.1.98110 WP_000579793.1.98119 WP_000579793.1.98124 WP_000579793.1.98146 WP_000579793.1.98219 WP_000579793.1.98236 WP_000579793.1.98250 WP_000579793.1.98338 WP_000579793.1.9841 WP_000579793.1.98440 WP_000579793.1.98472 WP_000579793.1.98495 WP_000579793.1.98513 WP_000579793.1.98531 WP_000579793.1.98551 WP_000579793.1.98570 WP_000579793.1.98577 WP_000579793.1.98608 WP_000579793.1.98634 WP_000579793.1.98676 WP_000579793.1.98677 WP_000579793.1.98726 WP_000579793.1.98760 WP_000579793.1.98763 WP_000579793.1.98843 WP_000579793.1.9887 WP_000579793.1.98931 WP_000579793.1.98947 WP_000579793.1.9898 WP_000579793.1.9899 WP_000579793.1.99040 WP_000579793.1.99057 WP_000579793.1.99072 WP_000579793.1.99083 WP_000579793.1.99097 WP_000579793.1.99098 WP_000579793.1.99164 WP_000579793.1.99184 WP_000579793.1.99197 WP_000579793.1.99198 WP_000579793.1.99215 WP_000579793.1.99219 WP_000579793.1.99255 WP_000579793.1.99267 WP_000579793.1.99276 WP_000579793.1.99327 WP_000579793.1.99339 WP_000579793.1.99370 WP_000579793.1.99456 WP_000579793.1.99490 WP_000579793.1.99493 WP_000579793.1.99561 WP_000579793.1.99613 WP_000579793.1.99630 WP_000579793.1.99637 WP_000579793.1.99646 WP_000579793.1.99657 WP_000579793.1.99660 WP_000579793.1.99712 WP_000579793.1.99725 WP_000579793.1.99747 WP_000579793.1.99813 WP_000579793.1.99858 WP_000579793.1.99889 WP_000579793.1.99924 WP_000579793.1.99958 WP_000579793.1.99961 gi|205352994|ref|YP_002226795.1| gi|528819064|ref|YP_008360267.1| gi|378444709|ref|YP_005232341.1| gi|16764630|ref|NP_460245.1| gi|379700450|ref|YP_005242178.1| gi|378983836|ref|YP_005246991.1| gi|550900649|ref|YP_008669741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]