SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449813|ref|YP_005237172.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449813|ref|YP_005237172.1|
Domain Number 1 Region: 27-162
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000000000125
Family TM1287-like 0.081
Further Details:      
 
Domain Number 2 Region: 225-275
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000762
Family AraC type transcriptional activator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449813|ref|YP_005237172.1|
Sequence length 280
Comment DNA-binding transcriptional regulator ChbR [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MMQLQVNATEIKTVYEQQLFNGKNFHVFIYNKTESVTGLHQHDYYEFTLVLTGRYYQEIN
GKRVLLERGDFVFIPVGSNHQSFYEFGATRILNVGISKRFFEQHYLPLLPFCFVASQVYR
ANSTFLTYIETVIASLNFRGNGLDEFIEVVTFYIINRLRHYREEQVYDDIPQWLKATVEI
MHDKTQFGEHALENMVRLSAKSQEYLTRATRRYYSKTPMQIINEIRINFAKKQLEMTNYS
VTDIAYEAGYSSPSLFIKTFKKMTSFTPNSYRKRLTEINE
Download sequence
Identical sequences A0A0F6B0P9 A0A0H3BUN8 A0A0N1QUF3 A0A1X2RV32 A0A1X2V532 A0A1Z3Q3G2 A0A221YK87 A0A221Z0S3 A0A232RRQ7 A0A249UZK9 A0A265BB15 A0A267SAW7 A0A271CI98 A0A271CXV2 A0A2C9P0N1 A0A2D0MJN7 A0A2D1XEY0 A0A2D1XSS9 A0A2G1NSM9 A0A2H9YH99 A0A2I6M9C2 A0A2I6MM30 A0A2I6N0A0 A0A2I6NEA7 A0A2I6NS00 A0A2I6P509 A0A2J5WXN3 B5F7H8 C0Q661 E8XGC2 G4BY51 G5LA12 G5Q3J4 G5RGF9 G5RW50 M7S5K9 Q57PW9 Q7CQP1 Q8XFS2 S4HLP7 S5HT29 V1WEB3 V7IFI0 V7UDT2
gi|378988656|ref|YP_005251820.1| gi|537436434|ref|YP_008480811.1| 383143 APC24425 gi|29141659|ref|NP_805001.1| gi|528819103|ref|YP_008360306.1| gi|194735027|ref|YP_002114335.1| ABAK02000001|CDS_712910-713752 ABAM02000001|CDS_1853868-1854710 ABAN01000017|CDS_20739-19897 ABAO01000010|CDS_20416-19574 ABEH02000002|CDS_44544-45386 ABEI01000015|CDS_122052-122894 ABEJ01000024|CDS_46249-47091 ABEL01000013|CDS_114485-115327 ABEW01000001|CDS_696393-695551 ABFF01000015|CDS_91962-92804 ABFG01000011|CDS_110480-109638 ABFH02000002|CDS_753761-752919 AE006468|CDS_1393977-1394819 AE014613|CDS_1261853-1262695 AE017220|CDS_1432640-1433482 AL513382|CDS_1719277-1718435 CP000857|CDS_2471009-2470167 CP000886|CDS_1728259-1727417 CP001113|CDS_1395947-1396789 CP001120|CDS_1399022-1399864 CP001127|CDS_1360649-1361491 CP001138|CDS_1819303-1818461 CP001144|CDS_1963650-1962808 CP001363|CDS_1403953-1404795 gi|378959361|ref|YP_005216847.1| gi|525826865|ref|YP_008249346.1| gi|549479160|ref|YP_008613100.1| gi|563653259|ref|YP_008861326.1| gi|16764666|ref|NP_460281.1| gi|526220010|ref|YP_008265514.1| gi|449784938|ref|YP_002142259.2| gi|525947509|ref|YP_008308906.1| gi|197251765|ref|YP_002146720.1| gi|525838444|ref|YP_008255489.1| gi|482903125|ref|YP_007901685.1| gi|379700488|ref|YP_005242216.1| gi|198245333|ref|YP_002215809.1| gi|62179906|ref|YP_216323.1| gi|383496029|ref|YP_005396718.1| gi|538361897|ref|YP_008505182.1| gi|16760580|ref|NP_456197.1| gi|378449813|ref|YP_005237172.1| NP_456197.1.84458 NP_460281.1.58477 WP_000983393.1.100002 WP_000983393.1.100007 WP_000983393.1.100008 WP_000983393.1.100010 WP_000983393.1.100017 WP_000983393.1.100031 WP_000983393.1.100036 WP_000983393.1.100077 WP_000983393.1.100079 WP_000983393.1.100115 WP_000983393.1.100129 WP_000983393.1.10013 WP_000983393.1.100137 WP_000983393.1.100149 WP_000983393.1.100165 WP_000983393.1.100191 WP_000983393.1.100196 WP_000983393.1.1002 WP_000983393.1.100234 WP_000983393.1.100258 WP_000983393.1.100266 WP_000983393.1.100284 WP_000983393.1.100288 WP_000983393.1.100313 WP_000983393.1.100314 WP_000983393.1.100321 WP_000983393.1.100354 WP_000983393.1.100376 WP_000983393.1.100392 WP_000983393.1.100412 WP_000983393.1.100413 WP_000983393.1.100421 WP_000983393.1.100424 WP_000983393.1.100436 WP_000983393.1.100438 WP_000983393.1.100446 WP_000983393.1.100450 WP_000983393.1.100457 WP_000983393.1.100472 WP_000983393.1.100484 WP_000983393.1.100488 WP_000983393.1.100502 WP_000983393.1.100519 WP_000983393.1.100521 WP_000983393.1.100557 WP_000983393.1.100584 WP_000983393.1.100589 WP_000983393.1.100592 WP_000983393.1.100597 WP_000983393.1.100605 WP_000983393.1.100610 WP_000983393.1.100642 WP_000983393.1.10065 WP_000983393.1.100650 WP_000983393.1.100707 WP_000983393.1.100711 WP_000983393.1.100714 WP_000983393.1.100721 WP_000983393.1.100730 WP_000983393.1.100732 WP_000983393.1.100733 WP_000983393.1.100739 WP_000983393.1.10074 WP_000983393.1.100750 WP_000983393.1.10076 WP_000983393.1.100764 WP_000983393.1.100773 WP_000983393.1.100776 WP_000983393.1.100781 WP_000983393.1.100790 WP_000983393.1.100793 WP_000983393.1.100799 WP_000983393.1.10081 WP_000983393.1.100814 WP_000983393.1.100857 WP_000983393.1.100865 WP_000983393.1.100869 WP_000983393.1.100870 WP_000983393.1.100871 WP_000983393.1.100882 WP_000983393.1.100886 WP_000983393.1.100895 WP_000983393.1.100932 WP_000983393.1.100941 WP_000983393.1.100944 WP_000983393.1.100948 WP_000983393.1.100953 WP_000983393.1.101007 WP_000983393.1.101011 WP_000983393.1.101020 WP_000983393.1.101042 WP_000983393.1.101074 WP_000983393.1.101078 WP_000983393.1.10108 WP_000983393.1.101091 WP_000983393.1.101094 WP_000983393.1.101111 WP_000983393.1.101112 WP_000983393.1.101123 WP_000983393.1.101126 WP_000983393.1.101147 WP_000983393.1.101180 WP_000983393.1.101185 WP_000983393.1.101199 WP_000983393.1.101223 WP_000983393.1.101226 WP_000983393.1.101239 WP_000983393.1.10124 WP_000983393.1.101259 WP_000983393.1.101271 WP_000983393.1.101284 WP_000983393.1.101291 WP_000983393.1.1013 WP_000983393.1.101312 WP_000983393.1.101320 WP_000983393.1.101322 WP_000983393.1.101353 WP_000983393.1.101374 WP_000983393.1.101386 WP_000983393.1.101404 WP_000983393.1.101420 WP_000983393.1.101425 WP_000983393.1.101454 WP_000983393.1.101473 WP_000983393.1.101519 WP_000983393.1.101520 WP_000983393.1.101541 WP_000983393.1.101589 WP_000983393.1.101609 WP_000983393.1.101612 WP_000983393.1.101616 WP_000983393.1.101636 WP_000983393.1.101639 WP_000983393.1.10164 WP_000983393.1.101666 WP_000983393.1.101674 WP_000983393.1.101707 WP_000983393.1.101724 WP_000983393.1.101734 WP_000983393.1.101740 WP_000983393.1.101741 WP_000983393.1.101744 WP_000983393.1.101759 WP_000983393.1.10177 WP_000983393.1.101776 WP_000983393.1.101815 WP_000983393.1.101832 WP_000983393.1.101839 WP_000983393.1.101841 WP_000983393.1.101868 WP_000983393.1.101878 WP_000983393.1.101890 WP_000983393.1.101904 WP_000983393.1.10191 WP_000983393.1.101917 WP_000983393.1.101927 WP_000983393.1.101941 WP_000983393.1.101949 WP_000983393.1.101953 WP_000983393.1.101975 WP_000983393.1.102009 WP_000983393.1.102050 WP_000983393.1.102087 WP_000983393.1.102103 WP_000983393.1.102111 WP_000983393.1.10220 WP_000983393.1.10231 WP_000983393.1.10237 WP_000983393.1.10266 WP_000983393.1.10276 WP_000983393.1.10293 WP_000983393.1.10300 WP_000983393.1.10310 WP_000983393.1.10338 WP_000983393.1.1038 WP_000983393.1.10394 WP_000983393.1.104 WP_000983393.1.10401 WP_000983393.1.10428 WP_000983393.1.10429 WP_000983393.1.10439 WP_000983393.1.10459 WP_000983393.1.10463 WP_000983393.1.10465 WP_000983393.1.10475 WP_000983393.1.10498 WP_000983393.1.10507 WP_000983393.1.10511 WP_000983393.1.10514 WP_000983393.1.10521 WP_000983393.1.10530 WP_000983393.1.10532 WP_000983393.1.10547 WP_000983393.1.10562 WP_000983393.1.10566 WP_000983393.1.10568 WP_000983393.1.10595 WP_000983393.1.106 WP_000983393.1.10631 WP_000983393.1.10642 WP_000983393.1.10654 WP_000983393.1.10675 WP_000983393.1.10677 WP_000983393.1.10678 WP_000983393.1.10711 WP_000983393.1.10720 WP_000983393.1.10753 WP_000983393.1.10755 WP_000983393.1.10797 WP_000983393.1.10857 WP_000983393.1.10868 WP_000983393.1.10873 WP_000983393.1.10898 WP_000983393.1.10926 WP_000983393.1.10936 WP_000983393.1.10992 WP_000983393.1.11000 WP_000983393.1.11012 WP_000983393.1.11024 WP_000983393.1.11031 WP_000983393.1.11041 WP_000983393.1.11055 WP_000983393.1.11098 WP_000983393.1.1110 WP_000983393.1.11119 WP_000983393.1.11126 WP_000983393.1.11142 WP_000983393.1.11156 WP_000983393.1.11168 WP_000983393.1.11190 WP_000983393.1.11213 WP_000983393.1.11216 WP_000983393.1.11239 WP_000983393.1.11253 WP_000983393.1.11254 WP_000983393.1.11295 WP_000983393.1.113 WP_000983393.1.11304 WP_000983393.1.11314 WP_000983393.1.1135 WP_000983393.1.11362 WP_000983393.1.11369 WP_000983393.1.11385 WP_000983393.1.11405 WP_000983393.1.1142 WP_000983393.1.11426 WP_000983393.1.11429 WP_000983393.1.11455 WP_000983393.1.11458 WP_000983393.1.1150 WP_000983393.1.11511 WP_000983393.1.11518 WP_000983393.1.11526 WP_000983393.1.11532 WP_000983393.1.11543 WP_000983393.1.11544 WP_000983393.1.11557 WP_000983393.1.1156 WP_000983393.1.11565 WP_000983393.1.11567 WP_000983393.1.11588 WP_000983393.1.11603 WP_000983393.1.11621 WP_000983393.1.11638 WP_000983393.1.11681 WP_000983393.1.11687 WP_000983393.1.1169 WP_000983393.1.11735 WP_000983393.1.1174 WP_000983393.1.11763 WP_000983393.1.11772 WP_000983393.1.11810 WP_000983393.1.11824 WP_000983393.1.11834 WP_000983393.1.11841 WP_000983393.1.11865 WP_000983393.1.11868 WP_000983393.1.11875 WP_000983393.1.11883 WP_000983393.1.11897 WP_000983393.1.11900 WP_000983393.1.11908 WP_000983393.1.11914 WP_000983393.1.11936 WP_000983393.1.11938 WP_000983393.1.11964 WP_000983393.1.11978 WP_000983393.1.12007 WP_000983393.1.12017 WP_000983393.1.12025 WP_000983393.1.12027 WP_000983393.1.12040 WP_000983393.1.12047 WP_000983393.1.12059 WP_000983393.1.12061 WP_000983393.1.12063 WP_000983393.1.1207 WP_000983393.1.12106 WP_000983393.1.12114 WP_000983393.1.12141 WP_000983393.1.12144 WP_000983393.1.1215 WP_000983393.1.12159 WP_000983393.1.12160 WP_000983393.1.12168 WP_000983393.1.12172 WP_000983393.1.12192 WP_000983393.1.12210 WP_000983393.1.1224 WP_000983393.1.12244 WP_000983393.1.12280 WP_000983393.1.12282 WP_000983393.1.12308 WP_000983393.1.12340 WP_000983393.1.12351 WP_000983393.1.12364 WP_000983393.1.12370 WP_000983393.1.12374 WP_000983393.1.1239 WP_000983393.1.12396 WP_000983393.1.12397 WP_000983393.1.12398 WP_000983393.1.12441 WP_000983393.1.12456 WP_000983393.1.1246 WP_000983393.1.12472 WP_000983393.1.12484 WP_000983393.1.12485 WP_000983393.1.1250 WP_000983393.1.12546 WP_000983393.1.12568 WP_000983393.1.12569 WP_000983393.1.12581 WP_000983393.1.12584 WP_000983393.1.12585 WP_000983393.1.12620 WP_000983393.1.1264 WP_000983393.1.12648 WP_000983393.1.12650 WP_000983393.1.12683 WP_000983393.1.12696 WP_000983393.1.12701 WP_000983393.1.12718 WP_000983393.1.12726 WP_000983393.1.12727 WP_000983393.1.12728 WP_000983393.1.12741 WP_000983393.1.12834 WP_000983393.1.12864 WP_000983393.1.12865 WP_000983393.1.12877 WP_000983393.1.12879 WP_000983393.1.12936 WP_000983393.1.1299 WP_000983393.1.12995 WP_000983393.1.1300 WP_000983393.1.13027 WP_000983393.1.13076 WP_000983393.1.13101 WP_000983393.1.13102 WP_000983393.1.13106 WP_000983393.1.13108 WP_000983393.1.13130 WP_000983393.1.13161 WP_000983393.1.13207 WP_000983393.1.1321 WP_000983393.1.13247 WP_000983393.1.1326 WP_000983393.1.13262 WP_000983393.1.13268 WP_000983393.1.13274 WP_000983393.1.13291 WP_000983393.1.133 WP_000983393.1.13311 WP_000983393.1.13314 WP_000983393.1.13334 WP_000983393.1.13338 WP_000983393.1.13342 WP_000983393.1.13352 WP_000983393.1.13367 WP_000983393.1.13391 WP_000983393.1.13406 WP_000983393.1.13414 WP_000983393.1.13429 WP_000983393.1.13440 WP_000983393.1.13443 WP_000983393.1.13446 WP_000983393.1.1346 WP_000983393.1.13476 WP_000983393.1.13488 WP_000983393.1.13509 WP_000983393.1.13528 WP_000983393.1.13543 WP_000983393.1.13573 WP_000983393.1.13599 WP_000983393.1.13602 WP_000983393.1.13625 WP_000983393.1.13661 WP_000983393.1.13669 WP_000983393.1.13677 WP_000983393.1.13686 WP_000983393.1.13691 WP_000983393.1.1372 WP_000983393.1.13732 WP_000983393.1.13741 WP_000983393.1.13750 WP_000983393.1.13764 WP_000983393.1.13799 WP_000983393.1.13819 WP_000983393.1.1382 WP_000983393.1.13827 WP_000983393.1.13829 WP_000983393.1.13848 WP_000983393.1.13857 WP_000983393.1.1387 WP_000983393.1.13908 WP_000983393.1.13932 WP_000983393.1.13967 WP_000983393.1.13968 WP_000983393.1.1397 WP_000983393.1.13972 WP_000983393.1.140 WP_000983393.1.14001 WP_000983393.1.1401 WP_000983393.1.14011 WP_000983393.1.14041 WP_000983393.1.14050 WP_000983393.1.14056 WP_000983393.1.1408 WP_000983393.1.14089 WP_000983393.1.14099 WP_000983393.1.14111 WP_000983393.1.1412 WP_000983393.1.14120 WP_000983393.1.14123 WP_000983393.1.14150 WP_000983393.1.14151 WP_000983393.1.14191 WP_000983393.1.14197 WP_000983393.1.14212 WP_000983393.1.14239 WP_000983393.1.14280 WP_000983393.1.14286 WP_000983393.1.14296 WP_000983393.1.14320 WP_000983393.1.14333 WP_000983393.1.14369 WP_000983393.1.14379 WP_000983393.1.14399 WP_000983393.1.1440 WP_000983393.1.14406 WP_000983393.1.14410 WP_000983393.1.14436 WP_000983393.1.14444 WP_000983393.1.14446 WP_000983393.1.14458 WP_000983393.1.14466 WP_000983393.1.14467 WP_000983393.1.14474 WP_000983393.1.14495 WP_000983393.1.14500 WP_000983393.1.14505 WP_000983393.1.14516 WP_000983393.1.14519 WP_000983393.1.14524 WP_000983393.1.14526 WP_000983393.1.14528 WP_000983393.1.14550 WP_000983393.1.14554 WP_000983393.1.14575 WP_000983393.1.146 WP_000983393.1.14618 WP_000983393.1.14688 WP_000983393.1.14701 WP_000983393.1.14703 WP_000983393.1.14706 WP_000983393.1.14708 WP_000983393.1.14719 WP_000983393.1.14725 WP_000983393.1.1473 WP_000983393.1.14737 WP_000983393.1.14765 WP_000983393.1.14789 WP_000983393.1.14793 WP_000983393.1.14808 WP_000983393.1.14810 WP_000983393.1.14819 WP_000983393.1.14852 WP_000983393.1.14876 WP_000983393.1.14877 WP_000983393.1.14884 WP_000983393.1.1489 WP_000983393.1.14894 WP_000983393.1.14913 WP_000983393.1.14917 WP_000983393.1.14930 WP_000983393.1.14932 WP_000983393.1.14936 WP_000983393.1.14947 WP_000983393.1.14948 WP_000983393.1.14964 WP_000983393.1.15011 WP_000983393.1.15046 WP_000983393.1.15054 WP_000983393.1.15059 WP_000983393.1.15067 WP_000983393.1.15079 WP_000983393.1.15100 WP_000983393.1.15102 WP_000983393.1.15124 WP_000983393.1.15184 WP_000983393.1.15214 WP_000983393.1.15223 WP_000983393.1.15226 WP_000983393.1.15265 WP_000983393.1.15276 WP_000983393.1.15316 WP_000983393.1.15318 WP_000983393.1.15353 WP_000983393.1.15362 WP_000983393.1.15369 WP_000983393.1.1540 WP_000983393.1.15415 WP_000983393.1.15423 WP_000983393.1.15433 WP_000983393.1.15439 WP_000983393.1.15479 WP_000983393.1.15483 WP_000983393.1.15487 WP_000983393.1.15508 WP_000983393.1.1551 WP_000983393.1.15535 WP_000983393.1.15581 WP_000983393.1.15585 WP_000983393.1.15586 WP_000983393.1.15597 WP_000983393.1.15612 WP_000983393.1.15616 WP_000983393.1.15625 WP_000983393.1.15627 WP_000983393.1.15637 WP_000983393.1.15644 WP_000983393.1.1568 WP_000983393.1.15708 WP_000983393.1.15710 WP_000983393.1.15717 WP_000983393.1.15775 WP_000983393.1.15777 WP_000983393.1.15784 WP_000983393.1.15795 WP_000983393.1.158 WP_000983393.1.15830 WP_000983393.1.15835 WP_000983393.1.15862 WP_000983393.1.15881 WP_000983393.1.15905 WP_000983393.1.15909 WP_000983393.1.15910 WP_000983393.1.15912 WP_000983393.1.1592 WP_000983393.1.15922 WP_000983393.1.15938 WP_000983393.1.15970 WP_000983393.1.15978 WP_000983393.1.15986 WP_000983393.1.15995 WP_000983393.1.16000 WP_000983393.1.16004 WP_000983393.1.16006 WP_000983393.1.1601 WP_000983393.1.16028 WP_000983393.1.16032 WP_000983393.1.16046 WP_000983393.1.16047 WP_000983393.1.16051 WP_000983393.1.16052 WP_000983393.1.16058 WP_000983393.1.16062 WP_000983393.1.16063 WP_000983393.1.16103 WP_000983393.1.1611 WP_000983393.1.16125 WP_000983393.1.16150 WP_000983393.1.16155 WP_000983393.1.16158 WP_000983393.1.16166 WP_000983393.1.16172 WP_000983393.1.16201 WP_000983393.1.16226 WP_000983393.1.16233 WP_000983393.1.16244 WP_000983393.1.1626 WP_000983393.1.16264 WP_000983393.1.16273 WP_000983393.1.16284 WP_000983393.1.16328 WP_000983393.1.16331 WP_000983393.1.16344 WP_000983393.1.1635 WP_000983393.1.16361 WP_000983393.1.16363 WP_000983393.1.16365 WP_000983393.1.16366 WP_000983393.1.16394 WP_000983393.1.16452 WP_000983393.1.16453 WP_000983393.1.16461 WP_000983393.1.16462 WP_000983393.1.16465 WP_000983393.1.16468 WP_000983393.1.16474 WP_000983393.1.16508 WP_000983393.1.16522 WP_000983393.1.16551 WP_000983393.1.16565 WP_000983393.1.16581 WP_000983393.1.16588 WP_000983393.1.16614 WP_000983393.1.16650 WP_000983393.1.16656 WP_000983393.1.16658 WP_000983393.1.16666 WP_000983393.1.16673 WP_000983393.1.1668 WP_000983393.1.16686 WP_000983393.1.16691 WP_000983393.1.167 WP_000983393.1.16710 WP_000983393.1.16729 WP_000983393.1.16732 WP_000983393.1.16735 WP_000983393.1.16736 WP_000983393.1.1674 WP_000983393.1.16767 WP_000983393.1.16781 WP_000983393.1.16786 WP_000983393.1.16804 WP_000983393.1.16817 WP_000983393.1.16819 WP_000983393.1.16826 WP_000983393.1.16846 WP_000983393.1.16855 WP_000983393.1.16858 WP_000983393.1.16873 WP_000983393.1.16879 WP_000983393.1.1689 WP_000983393.1.16893 WP_000983393.1.16896 WP_000983393.1.16903 WP_000983393.1.16905 WP_000983393.1.16910 WP_000983393.1.16916 WP_000983393.1.16941 WP_000983393.1.16942 WP_000983393.1.16944 WP_000983393.1.16948 WP_000983393.1.16949 WP_000983393.1.16965 WP_000983393.1.16972 WP_000983393.1.16998 WP_000983393.1.1700 WP_000983393.1.17031 WP_000983393.1.17049 WP_000983393.1.17058 WP_000983393.1.17060 WP_000983393.1.17078 WP_000983393.1.17093 WP_000983393.1.17098 WP_000983393.1.17105 WP_000983393.1.17188 WP_000983393.1.17202 WP_000983393.1.17219 WP_000983393.1.1722 WP_000983393.1.17270 WP_000983393.1.17285 WP_000983393.1.17302 WP_000983393.1.17307 WP_000983393.1.17308 WP_000983393.1.1733 WP_000983393.1.17368 WP_000983393.1.1737 WP_000983393.1.17390 WP_000983393.1.17405 WP_000983393.1.17406 WP_000983393.1.17439 WP_000983393.1.17447 WP_000983393.1.17480 WP_000983393.1.17482 WP_000983393.1.1749 WP_000983393.1.17504 WP_000983393.1.17513 WP_000983393.1.17525 WP_000983393.1.17543 WP_000983393.1.17546 WP_000983393.1.17560 WP_000983393.1.17563 WP_000983393.1.17578 WP_000983393.1.17583 WP_000983393.1.17622 WP_000983393.1.17629 WP_000983393.1.17659 WP_000983393.1.17667 WP_000983393.1.17686 WP_000983393.1.17693 WP_000983393.1.17702 WP_000983393.1.17703 WP_000983393.1.17705 WP_000983393.1.17732 WP_000983393.1.17741 WP_000983393.1.17743 WP_000983393.1.17747 WP_000983393.1.17755 WP_000983393.1.17840 WP_000983393.1.17865 WP_000983393.1.17886 WP_000983393.1.17891 WP_000983393.1.17901 WP_000983393.1.17914 WP_000983393.1.17919 WP_000983393.1.17936 WP_000983393.1.17949 WP_000983393.1.17956 WP_000983393.1.1798 WP_000983393.1.17991 WP_000983393.1.18005 WP_000983393.1.1801 WP_000983393.1.18019 WP_000983393.1.18021 WP_000983393.1.18022 WP_000983393.1.18056 WP_000983393.1.18061 WP_000983393.1.1807 WP_000983393.1.18089 WP_000983393.1.18092 WP_000983393.1.18099 WP_000983393.1.18103 WP_000983393.1.18109 WP_000983393.1.18111 WP_000983393.1.18122 WP_000983393.1.18124 WP_000983393.1.1814 WP_000983393.1.18144 WP_000983393.1.18149 WP_000983393.1.18163 WP_000983393.1.18173 WP_000983393.1.18177 WP_000983393.1.1818 WP_000983393.1.18192 WP_000983393.1.18249 WP_000983393.1.1825 WP_000983393.1.18254 WP_000983393.1.18265 WP_000983393.1.18267 WP_000983393.1.18270 WP_000983393.1.18277 WP_000983393.1.18280 WP_000983393.1.18281 WP_000983393.1.18282 WP_000983393.1.18328 WP_000983393.1.18355 WP_000983393.1.18358 WP_000983393.1.18365 WP_000983393.1.18370 WP_000983393.1.18384 WP_000983393.1.18406 WP_000983393.1.18426 WP_000983393.1.18445 WP_000983393.1.18468 WP_000983393.1.18474 WP_000983393.1.18485 WP_000983393.1.18489 WP_000983393.1.18513 WP_000983393.1.18607 WP_000983393.1.18610 WP_000983393.1.18641 WP_000983393.1.18678 WP_000983393.1.18686 WP_000983393.1.18692 WP_000983393.1.18705 WP_000983393.1.18715 WP_000983393.1.18722 WP_000983393.1.18737 WP_000983393.1.18766 WP_000983393.1.18776 WP_000983393.1.1880 WP_000983393.1.18822 WP_000983393.1.18847 WP_000983393.1.1885 WP_000983393.1.18860 WP_000983393.1.18881 WP_000983393.1.18886 WP_000983393.1.18895 WP_000983393.1.18919 WP_000983393.1.18922 WP_000983393.1.18940 WP_000983393.1.18949 WP_000983393.1.1895 WP_000983393.1.18959 WP_000983393.1.1897 WP_000983393.1.19001 WP_000983393.1.19006 WP_000983393.1.19030 WP_000983393.1.19038 WP_000983393.1.19044 WP_000983393.1.19053 WP_000983393.1.19055 WP_000983393.1.19064 WP_000983393.1.19084 WP_000983393.1.19093 WP_000983393.1.19163 WP_000983393.1.19174 WP_000983393.1.19187 WP_000983393.1.19228 WP_000983393.1.19240 WP_000983393.1.19273 WP_000983393.1.19288 WP_000983393.1.19291 WP_000983393.1.19300 WP_000983393.1.19320 WP_000983393.1.19340 WP_000983393.1.19373 WP_000983393.1.1939 WP_000983393.1.19405 WP_000983393.1.19422 WP_000983393.1.19433 WP_000983393.1.19454 WP_000983393.1.19456 WP_000983393.1.19458 WP_000983393.1.19460 WP_000983393.1.19461 WP_000983393.1.19469 WP_000983393.1.19496 WP_000983393.1.19535 WP_000983393.1.19538 WP_000983393.1.1954 WP_000983393.1.1955 WP_000983393.1.19588 WP_000983393.1.19589 WP_000983393.1.19614 WP_000983393.1.19616 WP_000983393.1.19642 WP_000983393.1.19656 WP_000983393.1.19660 WP_000983393.1.19663 WP_000983393.1.1968 WP_000983393.1.19683 WP_000983393.1.19686 WP_000983393.1.19702 WP_000983393.1.19706 WP_000983393.1.19723 WP_000983393.1.19724 WP_000983393.1.19731 WP_000983393.1.19740 WP_000983393.1.19749 WP_000983393.1.19784 WP_000983393.1.19793 WP_000983393.1.19794 WP_000983393.1.19802 WP_000983393.1.19809 WP_000983393.1.19823 WP_000983393.1.19834 WP_000983393.1.19851 WP_000983393.1.19863 WP_000983393.1.19867 WP_000983393.1.19882 WP_000983393.1.19884 WP_000983393.1.1990 WP_000983393.1.1992 WP_000983393.1.19967 WP_000983393.1.19970 WP_000983393.1.19975 WP_000983393.1.1998 WP_000983393.1.19987 WP_000983393.1.19999 WP_000983393.1.20 WP_000983393.1.20023 WP_000983393.1.20034 WP_000983393.1.20081 WP_000983393.1.20086 WP_000983393.1.20089 WP_000983393.1.20091 WP_000983393.1.2010 WP_000983393.1.20119 WP_000983393.1.20212 WP_000983393.1.20218 WP_000983393.1.20254 WP_000983393.1.20255 WP_000983393.1.2026 WP_000983393.1.20261 WP_000983393.1.20266 WP_000983393.1.20271 WP_000983393.1.20296 WP_000983393.1.20330 WP_000983393.1.20339 WP_000983393.1.20349 WP_000983393.1.2036 WP_000983393.1.20362 WP_000983393.1.20364 WP_000983393.1.20376 WP_000983393.1.20391 WP_000983393.1.2041 WP_000983393.1.20415 WP_000983393.1.20418 WP_000983393.1.20419 WP_000983393.1.20425 WP_000983393.1.20437 WP_000983393.1.20443 WP_000983393.1.20446 WP_000983393.1.20465 WP_000983393.1.20488 WP_000983393.1.20492 WP_000983393.1.20503 WP_000983393.1.20525 WP_000983393.1.2053 WP_000983393.1.2054 WP_000983393.1.20553 WP_000983393.1.20564 WP_000983393.1.20573 WP_000983393.1.20614 WP_000983393.1.20626 WP_000983393.1.20631 WP_000983393.1.20635 WP_000983393.1.20646 WP_000983393.1.20695 WP_000983393.1.20700 WP_000983393.1.20718 WP_000983393.1.20721 WP_000983393.1.2073 WP_000983393.1.20740 WP_000983393.1.20760 WP_000983393.1.20767 WP_000983393.1.20787 WP_000983393.1.20789 WP_000983393.1.20795 WP_000983393.1.20810 WP_000983393.1.20828 WP_000983393.1.20862 WP_000983393.1.2087 WP_000983393.1.20883 WP_000983393.1.20886 WP_000983393.1.20894 WP_000983393.1.20900 WP_000983393.1.20908 WP_000983393.1.2091 WP_000983393.1.20947 WP_000983393.1.2101 WP_000983393.1.21010 WP_000983393.1.21049 WP_000983393.1.2106 WP_000983393.1.21062 WP_000983393.1.2107 WP_000983393.1.21075 WP_000983393.1.21079 WP_000983393.1.21086 WP_000983393.1.21089 WP_000983393.1.21103 WP_000983393.1.21136 WP_000983393.1.21144 WP_000983393.1.21146 WP_000983393.1.2116 WP_000983393.1.21162 WP_000983393.1.21165 WP_000983393.1.21181 WP_000983393.1.21184 WP_000983393.1.21185 WP_000983393.1.21194 WP_000983393.1.21202 WP_000983393.1.21241 WP_000983393.1.21245 WP_000983393.1.21246 WP_000983393.1.21260 WP_000983393.1.21269 WP_000983393.1.21286 WP_000983393.1.2130 WP_000983393.1.21309 WP_000983393.1.21326 WP_000983393.1.21332 WP_000983393.1.21351 WP_000983393.1.21362 WP_000983393.1.21366 WP_000983393.1.2139 WP_000983393.1.21399 WP_000983393.1.21400 WP_000983393.1.21404 WP_000983393.1.21423 WP_000983393.1.21443 WP_000983393.1.21453 WP_000983393.1.2146 WP_000983393.1.21473 WP_000983393.1.21492 WP_000983393.1.21497 WP_000983393.1.21499 WP_000983393.1.21534 WP_000983393.1.21548 WP_000983393.1.21603 WP_000983393.1.21616 WP_000983393.1.2166 WP_000983393.1.21674 WP_000983393.1.21681 WP_000983393.1.21692 WP_000983393.1.21715 WP_000983393.1.21728 WP_000983393.1.21730 WP_000983393.1.21750 WP_000983393.1.21751 WP_000983393.1.21757 WP_000983393.1.21792 WP_000983393.1.21825 WP_000983393.1.21845 WP_000983393.1.21877 WP_000983393.1.21886 WP_000983393.1.21909 WP_000983393.1.21910 WP_000983393.1.21940 WP_000983393.1.21946 WP_000983393.1.21950 WP_000983393.1.21966 WP_000983393.1.21981 WP_000983393.1.21991 WP_000983393.1.22019 WP_000983393.1.22024 WP_000983393.1.22030 WP_000983393.1.2205 WP_000983393.1.22051 WP_000983393.1.22062 WP_000983393.1.22064 WP_000983393.1.22067 WP_000983393.1.22069 WP_000983393.1.22096 WP_000983393.1.22118 WP_000983393.1.22126 WP_000983393.1.22136 WP_000983393.1.22158 WP_000983393.1.2216 WP_000983393.1.22162 WP_000983393.1.22169 WP_000983393.1.22205 WP_000983393.1.22208 WP_000983393.1.2221 WP_000983393.1.22235 WP_000983393.1.2224 WP_000983393.1.2227 WP_000983393.1.22270 WP_000983393.1.22296 WP_000983393.1.22315 WP_000983393.1.22337 WP_000983393.1.22346 WP_000983393.1.2235 WP_000983393.1.22373 WP_000983393.1.22379 WP_000983393.1.22388 WP_000983393.1.22427 WP_000983393.1.22449 WP_000983393.1.22451 WP_000983393.1.22453 WP_000983393.1.22454 WP_000983393.1.2246 WP_000983393.1.22460 WP_000983393.1.22476 WP_000983393.1.22485 WP_000983393.1.22514 WP_000983393.1.22537 WP_000983393.1.22565 WP_000983393.1.22566 WP_000983393.1.22575 WP_000983393.1.22582 WP_000983393.1.22590 WP_000983393.1.22595 WP_000983393.1.22604 WP_000983393.1.22605 WP_000983393.1.22614 WP_000983393.1.22620 WP_000983393.1.22623 WP_000983393.1.22652 WP_000983393.1.22676 WP_000983393.1.22683 WP_000983393.1.22692 WP_000983393.1.22758 WP_000983393.1.22760 WP_000983393.1.2283 WP_000983393.1.2284 WP_000983393.1.22845 WP_000983393.1.22855 WP_000983393.1.22857 WP_000983393.1.22864 WP_000983393.1.22870 WP_000983393.1.22880 WP_000983393.1.22895 WP_000983393.1.22902 WP_000983393.1.22926 WP_000983393.1.22943 WP_000983393.1.22947 WP_000983393.1.22966 WP_000983393.1.22967 WP_000983393.1.22979 WP_000983393.1.23010 WP_000983393.1.23040 WP_000983393.1.23053 WP_000983393.1.23058 WP_000983393.1.23080 WP_000983393.1.23102 WP_000983393.1.23114 WP_000983393.1.2314 WP_000983393.1.23148 WP_000983393.1.23155 WP_000983393.1.23169 WP_000983393.1.23172 WP_000983393.1.23175 WP_000983393.1.23192 WP_000983393.1.23201 WP_000983393.1.23218 WP_000983393.1.2324 WP_000983393.1.23246 WP_000983393.1.23258 WP_000983393.1.23259 WP_000983393.1.23274 WP_000983393.1.23279 WP_000983393.1.23309 WP_000983393.1.2331 WP_000983393.1.23311 WP_000983393.1.2332 WP_000983393.1.23329 WP_000983393.1.23340 WP_000983393.1.23343 WP_000983393.1.2336 WP_000983393.1.23365 WP_000983393.1.23379 WP_000983393.1.23409 WP_000983393.1.23412 WP_000983393.1.2342 WP_000983393.1.23426 WP_000983393.1.23442 WP_000983393.1.23444 WP_000983393.1.23460 WP_000983393.1.23466 WP_000983393.1.23472 WP_000983393.1.23482 WP_000983393.1.23485 WP_000983393.1.23492 WP_000983393.1.235 WP_000983393.1.23500 WP_000983393.1.23503 WP_000983393.1.23509 WP_000983393.1.23513 WP_000983393.1.23515 WP_000983393.1.23529 WP_000983393.1.23548 WP_000983393.1.23571 WP_000983393.1.2358 WP_000983393.1.23587 WP_000983393.1.23604 WP_000983393.1.23621 WP_000983393.1.23629 WP_000983393.1.23631 WP_000983393.1.23634 WP_000983393.1.23639 WP_000983393.1.2364 WP_000983393.1.23643 WP_000983393.1.23646 WP_000983393.1.23670 WP_000983393.1.23675 WP_000983393.1.23679 WP_000983393.1.23685 WP_000983393.1.237 WP_000983393.1.23707 WP_000983393.1.23720 WP_000983393.1.23728 WP_000983393.1.23736 WP_000983393.1.23746 WP_000983393.1.2375 WP_000983393.1.23755 WP_000983393.1.2376 WP_000983393.1.23783 WP_000983393.1.23786 WP_000983393.1.23787 WP_000983393.1.2380 WP_000983393.1.23801 WP_000983393.1.23819 WP_000983393.1.23932 WP_000983393.1.23959 WP_000983393.1.24017 WP_000983393.1.24028 WP_000983393.1.24061 WP_000983393.1.24082 WP_000983393.1.24083 WP_000983393.1.24117 WP_000983393.1.24125 WP_000983393.1.24138 WP_000983393.1.24145 WP_000983393.1.2415 WP_000983393.1.24153 WP_000983393.1.24158 WP_000983393.1.24163 WP_000983393.1.24206 WP_000983393.1.24214 WP_000983393.1.24250 WP_000983393.1.24259 WP_000983393.1.24291 WP_000983393.1.24297 WP_000983393.1.24303 WP_000983393.1.24308 WP_000983393.1.24322 WP_000983393.1.24325 WP_000983393.1.24355 WP_000983393.1.24361 WP_000983393.1.24375 WP_000983393.1.24376 WP_000983393.1.24392 WP_000983393.1.24394 WP_000983393.1.24400 WP_000983393.1.24408 WP_000983393.1.24409 WP_000983393.1.24412 WP_000983393.1.24419 WP_000983393.1.24420 WP_000983393.1.24433 WP_000983393.1.24444 WP_000983393.1.24450 WP_000983393.1.24494 WP_000983393.1.24521 WP_000983393.1.24555 WP_000983393.1.24567 WP_000983393.1.24578 WP_000983393.1.24619 WP_000983393.1.24643 WP_000983393.1.2467 WP_000983393.1.24673 WP_000983393.1.24686 WP_000983393.1.24688 WP_000983393.1.24689 WP_000983393.1.24696 WP_000983393.1.24716 WP_000983393.1.24723 WP_000983393.1.24727 WP_000983393.1.24737 WP_000983393.1.24779 WP_000983393.1.24803 WP_000983393.1.2481 WP_000983393.1.24832 WP_000983393.1.24837 WP_000983393.1.24839 WP_000983393.1.24873 WP_000983393.1.24901 WP_000983393.1.24944 WP_000983393.1.24964 WP_000983393.1.24995 WP_000983393.1.25008 WP_000983393.1.25015 WP_000983393.1.25017 WP_000983393.1.25032 WP_000983393.1.25036 WP_000983393.1.25041 WP_000983393.1.25053 WP_000983393.1.25064 WP_000983393.1.25072 WP_000983393.1.25119 WP_000983393.1.25130 WP_000983393.1.25140 WP_000983393.1.25159 WP_000983393.1.25175 WP_000983393.1.25185 WP_000983393.1.25196 WP_000983393.1.25205 WP_000983393.1.25206 WP_000983393.1.25210 WP_000983393.1.25217 WP_000983393.1.25219 WP_000983393.1.25229 WP_000983393.1.2525 WP_000983393.1.25297 WP_000983393.1.25304 WP_000983393.1.25354 WP_000983393.1.25374 WP_000983393.1.25397 WP_000983393.1.25405 WP_000983393.1.25421 WP_000983393.1.25426 WP_000983393.1.25454 WP_000983393.1.25475 WP_000983393.1.25490 WP_000983393.1.25493 WP_000983393.1.25498 WP_000983393.1.25508 WP_000983393.1.25512 WP_000983393.1.25514 WP_000983393.1.2554 WP_000983393.1.25546 WP_000983393.1.25564 WP_000983393.1.25596 WP_000983393.1.25603 WP_000983393.1.25618 WP_000983393.1.2562 WP_000983393.1.25666 WP_000983393.1.25668 WP_000983393.1.2568 WP_000983393.1.25690 WP_000983393.1.2570 WP_000983393.1.25700 WP_000983393.1.25703 WP_000983393.1.25708 WP_000983393.1.25709 WP_000983393.1.25722 WP_000983393.1.25740 WP_000983393.1.25780 WP_000983393.1.25793 WP_000983393.1.25807 WP_000983393.1.25809 WP_000983393.1.2581 WP_000983393.1.25814 WP_000983393.1.25821 WP_000983393.1.25825 WP_000983393.1.25833 WP_000983393.1.25835 WP_000983393.1.25846 WP_000983393.1.25882 WP_000983393.1.25911 WP_000983393.1.25928 WP_000983393.1.25932 WP_000983393.1.25944 WP_000983393.1.25951 WP_000983393.1.25962 WP_000983393.1.25963 WP_000983393.1.25988 WP_000983393.1.26001 WP_000983393.1.26027 WP_000983393.1.26030 WP_000983393.1.26034 WP_000983393.1.26075 WP_000983393.1.26083 WP_000983393.1.26093 WP_000983393.1.26107 WP_000983393.1.26122 WP_000983393.1.26123 WP_000983393.1.26129 WP_000983393.1.2615 WP_000983393.1.26194 WP_000983393.1.26199 WP_000983393.1.26213 WP_000983393.1.26217 WP_000983393.1.26224 WP_000983393.1.26230 WP_000983393.1.26232 WP_000983393.1.26269 WP_000983393.1.26272 WP_000983393.1.26282 WP_000983393.1.26286 WP_000983393.1.26288 WP_000983393.1.26311 WP_000983393.1.26319 WP_000983393.1.2634 WP_000983393.1.26363 WP_000983393.1.26384 WP_000983393.1.26394 WP_000983393.1.26426 WP_000983393.1.26429 WP_000983393.1.26440 WP_000983393.1.26441 WP_000983393.1.26491 WP_000983393.1.26493 WP_000983393.1.26512 WP_000983393.1.26532 WP_000983393.1.2654 WP_000983393.1.26551 WP_000983393.1.26554 WP_000983393.1.26563 WP_000983393.1.26567 WP_000983393.1.26576 WP_000983393.1.26582 WP_000983393.1.26587 WP_000983393.1.26636 WP_000983393.1.26646 WP_000983393.1.2667 WP_000983393.1.26687 WP_000983393.1.26689 WP_000983393.1.26709 WP_000983393.1.2672 WP_000983393.1.26741 WP_000983393.1.26750 WP_000983393.1.26758 WP_000983393.1.26787 WP_000983393.1.2679 WP_000983393.1.26794 WP_000983393.1.26833 WP_000983393.1.26856 WP_000983393.1.26882 WP_000983393.1.26883 WP_000983393.1.26892 WP_000983393.1.26908 WP_000983393.1.26919 WP_000983393.1.2692 WP_000983393.1.26924 WP_000983393.1.26928 WP_000983393.1.26936 WP_000983393.1.26980 WP_000983393.1.270 WP_000983393.1.27008 WP_000983393.1.27010 WP_000983393.1.27027 WP_000983393.1.27051 WP_000983393.1.27055 WP_000983393.1.27070 WP_000983393.1.27072 WP_000983393.1.27077 WP_000983393.1.27084 WP_000983393.1.27086 WP_000983393.1.27087 WP_000983393.1.27111 WP_000983393.1.27115 WP_000983393.1.27122 WP_000983393.1.2713 WP_000983393.1.27169 WP_000983393.1.2717 WP_000983393.1.27173 WP_000983393.1.272 WP_000983393.1.27206 WP_000983393.1.27223 WP_000983393.1.27228 WP_000983393.1.2723 WP_000983393.1.27255 WP_000983393.1.27272 WP_000983393.1.27279 WP_000983393.1.27282 WP_000983393.1.27285 WP_000983393.1.27309 WP_000983393.1.27314 WP_000983393.1.27329 WP_000983393.1.27342 WP_000983393.1.27361 WP_000983393.1.27383 WP_000983393.1.27419 WP_000983393.1.27423 WP_000983393.1.27452 WP_000983393.1.27513 WP_000983393.1.27522 WP_000983393.1.27523 WP_000983393.1.27535 WP_000983393.1.27544 WP_000983393.1.27547 WP_000983393.1.27556 WP_000983393.1.27561 WP_000983393.1.27565 WP_000983393.1.27595 WP_000983393.1.27598 WP_000983393.1.27616 WP_000983393.1.2763 WP_000983393.1.27632 WP_000983393.1.27638 WP_000983393.1.27655 WP_000983393.1.27665 WP_000983393.1.27679 WP_000983393.1.27706 WP_000983393.1.27707 WP_000983393.1.27713 WP_000983393.1.27755 WP_000983393.1.27761 WP_000983393.1.2777 WP_000983393.1.27775 WP_000983393.1.27776 WP_000983393.1.27785 WP_000983393.1.27798 WP_000983393.1.27800 WP_000983393.1.27815 WP_000983393.1.27833 WP_000983393.1.27857 WP_000983393.1.27883 WP_000983393.1.27900 WP_000983393.1.27928 WP_000983393.1.27945 WP_000983393.1.27969 WP_000983393.1.27977 WP_000983393.1.27995 WP_000983393.1.27997 WP_000983393.1.28002 WP_000983393.1.28004 WP_000983393.1.28032 WP_000983393.1.28037 WP_000983393.1.28056 WP_000983393.1.2806 WP_000983393.1.28073 WP_000983393.1.2809 WP_000983393.1.28094 WP_000983393.1.28116 WP_000983393.1.28126 WP_000983393.1.28139 WP_000983393.1.28155 WP_000983393.1.28170 WP_000983393.1.28174 WP_000983393.1.28198 WP_000983393.1.28200 WP_000983393.1.28225 WP_000983393.1.28229 WP_000983393.1.28232 WP_000983393.1.28233 WP_000983393.1.28235 WP_000983393.1.2825 WP_000983393.1.28267 WP_000983393.1.2829 WP_000983393.1.28301 WP_000983393.1.28302 WP_000983393.1.28303 WP_000983393.1.2835 WP_000983393.1.28370 WP_000983393.1.28384 WP_000983393.1.28386 WP_000983393.1.28395 WP_000983393.1.284 WP_000983393.1.2845 WP_000983393.1.28462 WP_000983393.1.28479 WP_000983393.1.28514 WP_000983393.1.2853 WP_000983393.1.28538 WP_000983393.1.28570 WP_000983393.1.28575 WP_000983393.1.28612 WP_000983393.1.28620 WP_000983393.1.28625 WP_000983393.1.28627 WP_000983393.1.28655 WP_000983393.1.28673 WP_000983393.1.28692 WP_000983393.1.28694 WP_000983393.1.287 WP_000983393.1.2873 WP_000983393.1.28773 WP_000983393.1.28775 WP_000983393.1.28776 WP_000983393.1.2879 WP_000983393.1.28811 WP_000983393.1.28830 WP_000983393.1.2890 WP_000983393.1.28902 WP_000983393.1.28917 WP_000983393.1.28921 WP_000983393.1.28938 WP_000983393.1.28946 WP_000983393.1.28948 WP_000983393.1.28962 WP_000983393.1.28963 WP_000983393.1.28977 WP_000983393.1.29006 WP_000983393.1.29010 WP_000983393.1.29023 WP_000983393.1.29042 WP_000983393.1.2905 WP_000983393.1.2907 WP_000983393.1.29081 WP_000983393.1.29089 WP_000983393.1.29099 WP_000983393.1.2910 WP_000983393.1.29113 WP_000983393.1.29130 WP_000983393.1.29153 WP_000983393.1.29168 WP_000983393.1.29174 WP_000983393.1.29190 WP_000983393.1.29203 WP_000983393.1.29218 WP_000983393.1.29237 WP_000983393.1.2924 WP_000983393.1.29248 WP_000983393.1.29255 WP_000983393.1.29265 WP_000983393.1.29274 WP_000983393.1.29288 WP_000983393.1.2932 WP_000983393.1.29349 WP_000983393.1.29379 WP_000983393.1.29389 WP_000983393.1.29422 WP_000983393.1.29436 WP_000983393.1.29439 WP_000983393.1.29454 WP_000983393.1.2946 WP_000983393.1.29462 WP_000983393.1.29509 WP_000983393.1.29530 WP_000983393.1.29563 WP_000983393.1.29576 WP_000983393.1.29588 WP_000983393.1.29601 WP_000983393.1.29606 WP_000983393.1.29615 WP_000983393.1.29619 WP_000983393.1.29682 WP_000983393.1.29704 WP_000983393.1.29711 WP_000983393.1.29727 WP_000983393.1.29732 WP_000983393.1.29743 WP_000983393.1.29768 WP_000983393.1.29775 WP_000983393.1.29782 WP_000983393.1.29827 WP_000983393.1.29833 WP_000983393.1.2984 WP_000983393.1.29851 WP_000983393.1.29865 WP_000983393.1.29886 WP_000983393.1.29898 WP_000983393.1.29919 WP_000983393.1.29923 WP_000983393.1.29924 WP_000983393.1.2994 WP_000983393.1.29964 WP_000983393.1.29969 WP_000983393.1.29983 WP_000983393.1.29990 WP_000983393.1.30006 WP_000983393.1.30009 WP_000983393.1.30013 WP_000983393.1.30018 WP_000983393.1.3002 WP_000983393.1.30022 WP_000983393.1.30027 WP_000983393.1.30034 WP_000983393.1.30049 WP_000983393.1.3005 WP_000983393.1.30058 WP_000983393.1.30059 WP_000983393.1.30086 WP_000983393.1.30093 WP_000983393.1.30165 WP_000983393.1.3017 WP_000983393.1.30170 WP_000983393.1.30172 WP_000983393.1.30179 WP_000983393.1.30180 WP_000983393.1.30185 WP_000983393.1.30195 WP_000983393.1.30202 WP_000983393.1.30210 WP_000983393.1.30213 WP_000983393.1.30225 WP_000983393.1.30238 WP_000983393.1.30246 WP_000983393.1.30278 WP_000983393.1.30331 WP_000983393.1.30354 WP_000983393.1.30356 WP_000983393.1.30357 WP_000983393.1.30362 WP_000983393.1.30386 WP_000983393.1.30389 WP_000983393.1.3042 WP_000983393.1.30421 WP_000983393.1.30425 WP_000983393.1.30437 WP_000983393.1.30440 WP_000983393.1.30448 WP_000983393.1.30469 WP_000983393.1.30489 WP_000983393.1.30492 WP_000983393.1.30505 WP_000983393.1.30507 WP_000983393.1.30517 WP_000983393.1.30535 WP_000983393.1.30542 WP_000983393.1.30544 WP_000983393.1.30547 WP_000983393.1.30548 WP_000983393.1.30555 WP_000983393.1.30556 WP_000983393.1.30572 WP_000983393.1.30573 WP_000983393.1.30585 WP_000983393.1.30589 WP_000983393.1.30602 WP_000983393.1.30618 WP_000983393.1.30627 WP_000983393.1.30635 WP_000983393.1.3066 WP_000983393.1.30664 WP_000983393.1.3067 WP_000983393.1.3068 WP_000983393.1.30688 WP_000983393.1.30696 WP_000983393.1.30752 WP_000983393.1.3076 WP_000983393.1.30794 WP_000983393.1.3080 WP_000983393.1.30802 WP_000983393.1.30803 WP_000983393.1.30806 WP_000983393.1.30819 WP_000983393.1.30823 WP_000983393.1.30833 WP_000983393.1.30835 WP_000983393.1.3089 WP_000983393.1.30909 WP_000983393.1.30934 WP_000983393.1.3095 WP_000983393.1.30951 WP_000983393.1.30967 WP_000983393.1.30968 WP_000983393.1.30972 WP_000983393.1.31 WP_000983393.1.31001 WP_000983393.1.31011 WP_000983393.1.31042 WP_000983393.1.31046 WP_000983393.1.31066 WP_000983393.1.31078 WP_000983393.1.31086 WP_000983393.1.31092 WP_000983393.1.31107 WP_000983393.1.31111 WP_000983393.1.31122 WP_000983393.1.3113 WP_000983393.1.31139 WP_000983393.1.3114 WP_000983393.1.31145 WP_000983393.1.31155 WP_000983393.1.31156 WP_000983393.1.31167 WP_000983393.1.31171 WP_000983393.1.31182 WP_000983393.1.31185 WP_000983393.1.3119 WP_000983393.1.31190 WP_000983393.1.31195 WP_000983393.1.31196 WP_000983393.1.31198 WP_000983393.1.31205 WP_000983393.1.3121 WP_000983393.1.31210 WP_000983393.1.31214 WP_000983393.1.31219 WP_000983393.1.31222 WP_000983393.1.31223 WP_000983393.1.3124 WP_000983393.1.31251 WP_000983393.1.31262 WP_000983393.1.3127 WP_000983393.1.31272 WP_000983393.1.31281 WP_000983393.1.31303 WP_000983393.1.3131 WP_000983393.1.31335 WP_000983393.1.31352 WP_000983393.1.31362 WP_000983393.1.31389 WP_000983393.1.31413 WP_000983393.1.31435 WP_000983393.1.31446 WP_000983393.1.31451 WP_000983393.1.31476 WP_000983393.1.31504 WP_000983393.1.31515 WP_000983393.1.31533 WP_000983393.1.31546 WP_000983393.1.31578 WP_000983393.1.31585 WP_000983393.1.31658 WP_000983393.1.31665 WP_000983393.1.3167 WP_000983393.1.3170 WP_000983393.1.31720 WP_000983393.1.31725 WP_000983393.1.31762 WP_000983393.1.31782 WP_000983393.1.31799 WP_000983393.1.31836 WP_000983393.1.31845 WP_000983393.1.3185 WP_000983393.1.31854 WP_000983393.1.31895 WP_000983393.1.31901 WP_000983393.1.31927 WP_000983393.1.31940 WP_000983393.1.31951 WP_000983393.1.31952 WP_000983393.1.31967 WP_000983393.1.31972 WP_000983393.1.31983 WP_000983393.1.32006 WP_000983393.1.32038 WP_000983393.1.32041 WP_000983393.1.32042 WP_000983393.1.32054 WP_000983393.1.32056 WP_000983393.1.3207 WP_000983393.1.32109 WP_000983393.1.32170 WP_000983393.1.32189 WP_000983393.1.32192 WP_000983393.1.32202 WP_000983393.1.32204 WP_000983393.1.32206 WP_000983393.1.32252 WP_000983393.1.32260 WP_000983393.1.32263 WP_000983393.1.32274 WP_000983393.1.32275 WP_000983393.1.32277 WP_000983393.1.32293 WP_000983393.1.32299 WP_000983393.1.32309 WP_000983393.1.32357 WP_000983393.1.32368 WP_000983393.1.32408 WP_000983393.1.32422 WP_000983393.1.32423 WP_000983393.1.32424 WP_000983393.1.32425 WP_000983393.1.32434 WP_000983393.1.32438 WP_000983393.1.32458 WP_000983393.1.32459 WP_000983393.1.32460 WP_000983393.1.32491 WP_000983393.1.32493 WP_000983393.1.32515 WP_000983393.1.32519 WP_000983393.1.32527 WP_000983393.1.32529 WP_000983393.1.32545 WP_000983393.1.32563 WP_000983393.1.32578 WP_000983393.1.32617 WP_000983393.1.32624 WP_000983393.1.32629 WP_000983393.1.32643 WP_000983393.1.32660 WP_000983393.1.32668 WP_000983393.1.3270 WP_000983393.1.32702 WP_000983393.1.32714 WP_000983393.1.32725 WP_000983393.1.32740 WP_000983393.1.32747 WP_000983393.1.32750 WP_000983393.1.3278 WP_000983393.1.32786 WP_000983393.1.32804 WP_000983393.1.32832 WP_000983393.1.32838 WP_000983393.1.32848 WP_000983393.1.32860 WP_000983393.1.32868 WP_000983393.1.32881 WP_000983393.1.32899 WP_000983393.1.329 WP_000983393.1.3290 WP_000983393.1.32900 WP_000983393.1.32902 WP_000983393.1.32907 WP_000983393.1.32930 WP_000983393.1.32940 WP_000983393.1.32941 WP_000983393.1.3296 WP_000983393.1.32961 WP_000983393.1.32966 WP_000983393.1.32977 WP_000983393.1.32985 WP_000983393.1.33010 WP_000983393.1.33030 WP_000983393.1.33037 WP_000983393.1.3304 WP_000983393.1.3305 WP_000983393.1.33051 WP_000983393.1.33065 WP_000983393.1.33078 WP_000983393.1.3310 WP_000983393.1.33106 WP_000983393.1.33122 WP_000983393.1.33127 WP_000983393.1.33143 WP_000983393.1.33144 WP_000983393.1.3315 WP_000983393.1.33160 WP_000983393.1.33208 WP_000983393.1.33214 WP_000983393.1.33247 WP_000983393.1.33248 WP_000983393.1.33253 WP_000983393.1.33261 WP_000983393.1.33270 WP_000983393.1.33280 WP_000983393.1.33283 WP_000983393.1.333 WP_000983393.1.33313 WP_000983393.1.33339 WP_000983393.1.33382 WP_000983393.1.33392 WP_000983393.1.33409 WP_000983393.1.33420 WP_000983393.1.33486 WP_000983393.1.33490 WP_000983393.1.33492 WP_000983393.1.33499 WP_000983393.1.335 WP_000983393.1.33501 WP_000983393.1.33504 WP_000983393.1.33529 WP_000983393.1.33553 WP_000983393.1.3356 WP_000983393.1.33580 WP_000983393.1.33586 WP_000983393.1.33592 WP_000983393.1.33609 WP_000983393.1.3364 WP_000983393.1.33659 WP_000983393.1.33689 WP_000983393.1.33693 WP_000983393.1.3370 WP_000983393.1.33730 WP_000983393.1.33741 WP_000983393.1.33817 WP_000983393.1.33825 WP_000983393.1.33840 WP_000983393.1.33865 WP_000983393.1.33870 WP_000983393.1.33894 WP_000983393.1.3392 WP_000983393.1.33926 WP_000983393.1.3394 WP_000983393.1.3395 WP_000983393.1.33957 WP_000983393.1.3396 WP_000983393.1.33969 WP_000983393.1.33986 WP_000983393.1.34001 WP_000983393.1.34022 WP_000983393.1.34043 WP_000983393.1.34059 WP_000983393.1.34075 WP_000983393.1.34081 WP_000983393.1.34084 WP_000983393.1.34091 WP_000983393.1.34107 WP_000983393.1.34118 WP_000983393.1.34126 WP_000983393.1.34179 WP_000983393.1.34184 WP_000983393.1.34185 WP_000983393.1.34211 WP_000983393.1.34214 WP_000983393.1.34234 WP_000983393.1.34257 WP_000983393.1.34259 WP_000983393.1.34279 WP_000983393.1.34284 WP_000983393.1.34292 WP_000983393.1.34304 WP_000983393.1.34319 WP_000983393.1.34330 WP_000983393.1.34376 WP_000983393.1.3438 WP_000983393.1.34382 WP_000983393.1.34417 WP_000983393.1.34424 WP_000983393.1.34431 WP_000983393.1.3445 WP_000983393.1.34453 WP_000983393.1.34454 WP_000983393.1.34458 WP_000983393.1.34484 WP_000983393.1.34496 WP_000983393.1.34517 WP_000983393.1.34530 WP_000983393.1.34610 WP_000983393.1.34614 WP_000983393.1.34647 WP_000983393.1.34659 WP_000983393.1.34665 WP_000983393.1.34667 WP_000983393.1.34684 WP_000983393.1.34694 WP_000983393.1.34703 WP_000983393.1.34704 WP_000983393.1.34707 WP_000983393.1.34711 WP_000983393.1.34745 WP_000983393.1.34751 WP_000983393.1.3476 WP_000983393.1.34801 WP_000983393.1.34808 WP_000983393.1.34817 WP_000983393.1.34820 WP_000983393.1.34824 WP_000983393.1.34834 WP_000983393.1.34854 WP_000983393.1.34856 WP_000983393.1.34881 WP_000983393.1.3489 WP_000983393.1.34932 WP_000983393.1.34962 WP_000983393.1.34972 WP_000983393.1.34975 WP_000983393.1.34977 WP_000983393.1.35001 WP_000983393.1.35035 WP_000983393.1.35040 WP_000983393.1.35045 WP_000983393.1.35074 WP_000983393.1.35075 WP_000983393.1.35125 WP_000983393.1.35129 WP_000983393.1.35175 WP_000983393.1.35184 WP_000983393.1.35193 WP_000983393.1.35219 WP_000983393.1.35240 WP_000983393.1.35274 WP_000983393.1.35294 WP_000983393.1.35298 WP_000983393.1.35321 WP_000983393.1.35331 WP_000983393.1.35332 WP_000983393.1.35404 WP_000983393.1.35408 WP_000983393.1.3541 WP_000983393.1.35425 WP_000983393.1.35429 WP_000983393.1.35446 WP_000983393.1.35460 WP_000983393.1.35463 WP_000983393.1.35494 WP_000983393.1.35503 WP_000983393.1.35507 WP_000983393.1.35509 WP_000983393.1.35532 WP_000983393.1.3556 WP_000983393.1.35560 WP_000983393.1.35563 WP_000983393.1.3557 WP_000983393.1.35570 WP_000983393.1.35590 WP_000983393.1.35594 WP_000983393.1.35619 WP_000983393.1.35624 WP_000983393.1.35628 WP_000983393.1.35648 WP_000983393.1.3566 WP_000983393.1.3570 WP_000983393.1.35712 WP_000983393.1.35713 WP_000983393.1.3572 WP_000983393.1.35736 WP_000983393.1.35777 WP_000983393.1.35791 WP_000983393.1.35795 WP_000983393.1.35809 WP_000983393.1.35835 WP_000983393.1.35868 WP_000983393.1.35870 WP_000983393.1.35887 WP_000983393.1.35892 WP_000983393.1.35916 WP_000983393.1.35936 WP_000983393.1.35938 WP_000983393.1.35940 WP_000983393.1.35961 WP_000983393.1.35966 WP_000983393.1.35993 WP_000983393.1.36000 WP_000983393.1.36003 WP_000983393.1.3601 WP_000983393.1.36011 WP_000983393.1.36017 WP_000983393.1.36034 WP_000983393.1.36036 WP_000983393.1.36037 WP_000983393.1.36057 WP_000983393.1.36063 WP_000983393.1.36069 WP_000983393.1.3610 WP_000983393.1.36157 WP_000983393.1.36172 WP_000983393.1.36229 WP_000983393.1.36232 WP_000983393.1.36286 WP_000983393.1.36291 WP_000983393.1.36298 WP_000983393.1.36308 WP_000983393.1.36323 WP_000983393.1.36343 WP_000983393.1.36409 WP_000983393.1.36425 WP_000983393.1.36445 WP_000983393.1.36460 WP_000983393.1.3649 WP_000983393.1.36495 WP_000983393.1.36512 WP_000983393.1.36526 WP_000983393.1.36542 WP_000983393.1.36547 WP_000983393.1.36564 WP_000983393.1.36567 WP_000983393.1.36579 WP_000983393.1.36584 WP_000983393.1.36586 WP_000983393.1.36592 WP_000983393.1.36609 WP_000983393.1.36617 WP_000983393.1.36618 WP_000983393.1.36643 WP_000983393.1.36652 WP_000983393.1.36663 WP_000983393.1.36685 WP_000983393.1.36690 WP_000983393.1.3670 WP_000983393.1.36701 WP_000983393.1.36705 WP_000983393.1.36721 WP_000983393.1.36725 WP_000983393.1.36751 WP_000983393.1.36764 WP_000983393.1.36765 WP_000983393.1.36779 WP_000983393.1.36792 WP_000983393.1.36798 WP_000983393.1.36802 WP_000983393.1.36821 WP_000983393.1.36839 WP_000983393.1.36853 WP_000983393.1.36875 WP_000983393.1.3688 WP_000983393.1.36885 WP_000983393.1.36889 WP_000983393.1.36899 WP_000983393.1.36918 WP_000983393.1.36931 WP_000983393.1.36948 WP_000983393.1.36949 WP_000983393.1.36950 WP_000983393.1.36978 WP_000983393.1.37013 WP_000983393.1.37014 WP_000983393.1.37021 WP_000983393.1.37028 WP_000983393.1.37029 WP_000983393.1.37063 WP_000983393.1.37073 WP_000983393.1.37100 WP_000983393.1.37111 WP_000983393.1.37112 WP_000983393.1.37114 WP_000983393.1.37133 WP_000983393.1.37147 WP_000983393.1.37158 WP_000983393.1.37176 WP_000983393.1.37190 WP_000983393.1.37191 WP_000983393.1.37199 WP_000983393.1.37200 WP_000983393.1.37256 WP_000983393.1.37258 WP_000983393.1.3726 WP_000983393.1.37267 WP_000983393.1.3728 WP_000983393.1.37293 WP_000983393.1.37297 WP_000983393.1.37303 WP_000983393.1.37320 WP_000983393.1.3734 WP_000983393.1.37351 WP_000983393.1.37363 WP_000983393.1.37370 WP_000983393.1.37376 WP_000983393.1.37405 WP_000983393.1.3744 WP_000983393.1.37478 WP_000983393.1.3748 WP_000983393.1.37498 WP_000983393.1.37504 WP_000983393.1.3751 WP_000983393.1.37513 WP_000983393.1.37521 WP_000983393.1.37558 WP_000983393.1.3756 WP_000983393.1.37584 WP_000983393.1.37590 WP_000983393.1.37593 WP_000983393.1.37600 WP_000983393.1.37610 WP_000983393.1.37613 WP_000983393.1.37618 WP_000983393.1.37659 WP_000983393.1.37662 WP_000983393.1.37666 WP_000983393.1.37675 WP_000983393.1.37687 WP_000983393.1.37691 WP_000983393.1.3771 WP_000983393.1.37719 WP_000983393.1.37761 WP_000983393.1.37775 WP_000983393.1.37777 WP_000983393.1.3778 WP_000983393.1.378 WP_000983393.1.37808 WP_000983393.1.37848 WP_000983393.1.37864 WP_000983393.1.379 WP_000983393.1.3790 WP_000983393.1.37911 WP_000983393.1.37941 WP_000983393.1.37965 WP_000983393.1.37968 WP_000983393.1.37978 WP_000983393.1.37985 WP_000983393.1.38001 WP_000983393.1.38026 WP_000983393.1.38037 WP_000983393.1.38047 WP_000983393.1.38055 WP_000983393.1.38061 WP_000983393.1.38064 WP_000983393.1.38108 WP_000983393.1.38113 WP_000983393.1.38125 WP_000983393.1.38145 WP_000983393.1.3816 WP_000983393.1.38199 WP_000983393.1.38207 WP_000983393.1.38261 WP_000983393.1.38266 WP_000983393.1.38273 WP_000983393.1.3828 WP_000983393.1.383 WP_000983393.1.38310 WP_000983393.1.38322 WP_000983393.1.3834 WP_000983393.1.38341 WP_000983393.1.38344 WP_000983393.1.38349 WP_000983393.1.38351 WP_000983393.1.3838 WP_000983393.1.38381 WP_000983393.1.38393 WP_000983393.1.38408 WP_000983393.1.38440 WP_000983393.1.38452 WP_000983393.1.3848 WP_000983393.1.38486 WP_000983393.1.38512 WP_000983393.1.38515 WP_000983393.1.38569 WP_000983393.1.38595 WP_000983393.1.3860 WP_000983393.1.38609 WP_000983393.1.38613 WP_000983393.1.38620 WP_000983393.1.38622 WP_000983393.1.38642 WP_000983393.1.38673 WP_000983393.1.3869 WP_000983393.1.38693 WP_000983393.1.38734 WP_000983393.1.38740 WP_000983393.1.38773 WP_000983393.1.38781 WP_000983393.1.38797 WP_000983393.1.38830 WP_000983393.1.38857 WP_000983393.1.38877 WP_000983393.1.38881 WP_000983393.1.38882 WP_000983393.1.38895 WP_000983393.1.38898 WP_000983393.1.3891 WP_000983393.1.38913 WP_000983393.1.38942 WP_000983393.1.38983 WP_000983393.1.38995 WP_000983393.1.38996 WP_000983393.1.39003 WP_000983393.1.39038 WP_000983393.1.39048 WP_000983393.1.39055 WP_000983393.1.39056 WP_000983393.1.39059 WP_000983393.1.39065 WP_000983393.1.3907 WP_000983393.1.39075 WP_000983393.1.39082 WP_000983393.1.39105 WP_000983393.1.39112 WP_000983393.1.39113 WP_000983393.1.39128 WP_000983393.1.39136 WP_000983393.1.3914 WP_000983393.1.39140 WP_000983393.1.39146 WP_000983393.1.39147 WP_000983393.1.39161 WP_000983393.1.39183 WP_000983393.1.39197 WP_000983393.1.39210 WP_000983393.1.39229 WP_000983393.1.39235 WP_000983393.1.39265 WP_000983393.1.39275 WP_000983393.1.3931 WP_000983393.1.39311 WP_000983393.1.39312 WP_000983393.1.39385 WP_000983393.1.39395 WP_000983393.1.39405 WP_000983393.1.39414 WP_000983393.1.39420 WP_000983393.1.39435 WP_000983393.1.39449 WP_000983393.1.39466 WP_000983393.1.39471 WP_000983393.1.39497 WP_000983393.1.39502 WP_000983393.1.39503 WP_000983393.1.39512 WP_000983393.1.39530 WP_000983393.1.39553 WP_000983393.1.39556 WP_000983393.1.39576 WP_000983393.1.39584 WP_000983393.1.39609 WP_000983393.1.39614 WP_000983393.1.39619 WP_000983393.1.39620 WP_000983393.1.39624 WP_000983393.1.39629 WP_000983393.1.39632 WP_000983393.1.39659 WP_000983393.1.39667 WP_000983393.1.39722 WP_000983393.1.39723 WP_000983393.1.39724 WP_000983393.1.39763 WP_000983393.1.39775 WP_000983393.1.39808 WP_000983393.1.39862 WP_000983393.1.39879 WP_000983393.1.39890 WP_000983393.1.39921 WP_000983393.1.39923 WP_000983393.1.39941 WP_000983393.1.39945 WP_000983393.1.39947 WP_000983393.1.39953 WP_000983393.1.40008 WP_000983393.1.40017 WP_000983393.1.40025 WP_000983393.1.40031 WP_000983393.1.40072 WP_000983393.1.40073 WP_000983393.1.40081 WP_000983393.1.40095 WP_000983393.1.40097 WP_000983393.1.401 WP_000983393.1.4011 WP_000983393.1.40111 WP_000983393.1.40155 WP_000983393.1.40158 WP_000983393.1.40160 WP_000983393.1.40167 WP_000983393.1.40170 WP_000983393.1.40171 WP_000983393.1.40205 WP_000983393.1.40208 WP_000983393.1.40224 WP_000983393.1.40229 WP_000983393.1.40240 WP_000983393.1.40254 WP_000983393.1.40257 WP_000983393.1.40258 WP_000983393.1.40259 WP_000983393.1.40279 WP_000983393.1.40284 WP_000983393.1.40292 WP_000983393.1.40305 WP_000983393.1.40307 WP_000983393.1.40311 WP_000983393.1.40341 WP_000983393.1.40361 WP_000983393.1.40374 WP_000983393.1.40380 WP_000983393.1.40395 WP_000983393.1.4042 WP_000983393.1.40465 WP_000983393.1.40467 WP_000983393.1.40492 WP_000983393.1.40493 WP_000983393.1.40496 WP_000983393.1.40508 WP_000983393.1.40517 WP_000983393.1.40528 WP_000983393.1.40533 WP_000983393.1.40577 WP_000983393.1.40583 WP_000983393.1.40605 WP_000983393.1.40622 WP_000983393.1.40648 WP_000983393.1.40688 WP_000983393.1.40693 WP_000983393.1.40695 WP_000983393.1.40698 WP_000983393.1.40710 WP_000983393.1.40722 WP_000983393.1.40745 WP_000983393.1.4075 WP_000983393.1.40750 WP_000983393.1.40763 WP_000983393.1.40771 WP_000983393.1.40788 WP_000983393.1.40849 WP_000983393.1.40854 WP_000983393.1.4087 WP_000983393.1.40877 WP_000983393.1.4088 WP_000983393.1.4089 WP_000983393.1.40910 WP_000983393.1.40924 WP_000983393.1.40930 WP_000983393.1.40932 WP_000983393.1.40935 WP_000983393.1.40946 WP_000983393.1.40973 WP_000983393.1.40979 WP_000983393.1.40996 WP_000983393.1.41004 WP_000983393.1.41017 WP_000983393.1.41018 WP_000983393.1.41048 WP_000983393.1.41050 WP_000983393.1.4106 WP_000983393.1.41070 WP_000983393.1.41074 WP_000983393.1.41075 WP_000983393.1.41086 WP_000983393.1.4109 WP_000983393.1.41091 WP_000983393.1.41097 WP_000983393.1.41116 WP_000983393.1.41128 WP_000983393.1.41132 WP_000983393.1.41176 WP_000983393.1.41192 WP_000983393.1.41225 WP_000983393.1.41226 WP_000983393.1.41251 WP_000983393.1.41258 WP_000983393.1.41265 WP_000983393.1.41277 WP_000983393.1.41279 WP_000983393.1.41299 WP_000983393.1.41305 WP_000983393.1.41308 WP_000983393.1.41310 WP_000983393.1.41321 WP_000983393.1.41333 WP_000983393.1.41335 WP_000983393.1.41345 WP_000983393.1.4136 WP_000983393.1.41375 WP_000983393.1.4141 WP_000983393.1.41415 WP_000983393.1.41427 WP_000983393.1.41434 WP_000983393.1.41438 WP_000983393.1.41440 WP_000983393.1.41459 WP_000983393.1.41468 WP_000983393.1.41498 WP_000983393.1.41519 WP_000983393.1.41524 WP_000983393.1.41528 WP_000983393.1.41554 WP_000983393.1.41572 WP_000983393.1.41591 WP_000983393.1.41593 WP_000983393.1.41610 WP_000983393.1.41628 WP_000983393.1.41631 WP_000983393.1.41658 WP_000983393.1.41659 WP_000983393.1.41662 WP_000983393.1.41690 WP_000983393.1.41708 WP_000983393.1.41716 WP_000983393.1.41724 WP_000983393.1.41735 WP_000983393.1.41746 WP_000983393.1.41761 WP_000983393.1.4178 WP_000983393.1.41789 WP_000983393.1.41799 WP_000983393.1.41802 WP_000983393.1.41824 WP_000983393.1.41825 WP_000983393.1.41836 WP_000983393.1.4184 WP_000983393.1.41859 WP_000983393.1.41862 WP_000983393.1.41877 WP_000983393.1.41882 WP_000983393.1.41894 WP_000983393.1.41897 WP_000983393.1.41904 WP_000983393.1.41911 WP_000983393.1.41919 WP_000983393.1.41929 WP_000983393.1.41931 WP_000983393.1.41938 WP_000983393.1.4194 WP_000983393.1.41949 WP_000983393.1.41978 WP_000983393.1.41979 WP_000983393.1.41985 WP_000983393.1.41994 WP_000983393.1.41998 WP_000983393.1.42009 WP_000983393.1.42069 WP_000983393.1.42081 WP_000983393.1.42090 WP_000983393.1.42098 WP_000983393.1.42104 WP_000983393.1.42109 WP_000983393.1.42111 WP_000983393.1.42136 WP_000983393.1.42156 WP_000983393.1.42187 WP_000983393.1.422 WP_000983393.1.42200 WP_000983393.1.42219 WP_000983393.1.4222 WP_000983393.1.42238 WP_000983393.1.42243 WP_000983393.1.42244 WP_000983393.1.42248 WP_000983393.1.42257 WP_000983393.1.42261 WP_000983393.1.42262 WP_000983393.1.42263 WP_000983393.1.42276 WP_000983393.1.4229 WP_000983393.1.42320 WP_000983393.1.42322 WP_000983393.1.42328 WP_000983393.1.42342 WP_000983393.1.42349 WP_000983393.1.42356 WP_000983393.1.42364 WP_000983393.1.42371 WP_000983393.1.42372 WP_000983393.1.42379 WP_000983393.1.4239 WP_000983393.1.42391 WP_000983393.1.42392 WP_000983393.1.42399 WP_000983393.1.42404 WP_000983393.1.42422 WP_000983393.1.42433 WP_000983393.1.42444 WP_000983393.1.42453 WP_000983393.1.42489 WP_000983393.1.42491 WP_000983393.1.42539 WP_000983393.1.4257 WP_000983393.1.42595 WP_000983393.1.42603 WP_000983393.1.42605 WP_000983393.1.42650 WP_000983393.1.42655 WP_000983393.1.42666 WP_000983393.1.4267 WP_000983393.1.42675 WP_000983393.1.42676 WP_000983393.1.42683 WP_000983393.1.42685 WP_000983393.1.42701 WP_000983393.1.42707 WP_000983393.1.42734 WP_000983393.1.4276 WP_000983393.1.42767 WP_000983393.1.42794 WP_000983393.1.42797 WP_000983393.1.42805 WP_000983393.1.42815 WP_000983393.1.42829 WP_000983393.1.42859 WP_000983393.1.42861 WP_000983393.1.42864 WP_000983393.1.4288 WP_000983393.1.42887 WP_000983393.1.4289 WP_000983393.1.42892 WP_000983393.1.42923 WP_000983393.1.42932 WP_000983393.1.42957 WP_000983393.1.42978 WP_000983393.1.4298 WP_000983393.1.42981 WP_000983393.1.43008 WP_000983393.1.43016 WP_000983393.1.43018 WP_000983393.1.43019 WP_000983393.1.43041 WP_000983393.1.43065 WP_000983393.1.43068 WP_000983393.1.43069 WP_000983393.1.43070 WP_000983393.1.43077 WP_000983393.1.43086 WP_000983393.1.43089 WP_000983393.1.43126 WP_000983393.1.43128 WP_000983393.1.43141 WP_000983393.1.43149 WP_000983393.1.43157 WP_000983393.1.43160 WP_000983393.1.43161 WP_000983393.1.43190 WP_000983393.1.43198 WP_000983393.1.43201 WP_000983393.1.43244 WP_000983393.1.43258 WP_000983393.1.4326 WP_000983393.1.43272 WP_000983393.1.43276 WP_000983393.1.43290 WP_000983393.1.43292 WP_000983393.1.43299 WP_000983393.1.43307 WP_000983393.1.43312 WP_000983393.1.4332 WP_000983393.1.43334 WP_000983393.1.43339 WP_000983393.1.43351 WP_000983393.1.43371 WP_000983393.1.43437 WP_000983393.1.43438 WP_000983393.1.4344 WP_000983393.1.43441 WP_000983393.1.43476 WP_000983393.1.43513 WP_000983393.1.43520 WP_000983393.1.43522 WP_000983393.1.43528 WP_000983393.1.43535 WP_000983393.1.43606 WP_000983393.1.43613 WP_000983393.1.43633 WP_000983393.1.43637 WP_000983393.1.43651 WP_000983393.1.43654 WP_000983393.1.43668 WP_000983393.1.43676 WP_000983393.1.43685 WP_000983393.1.43710 WP_000983393.1.43711 WP_000983393.1.43722 WP_000983393.1.4373 WP_000983393.1.43763 WP_000983393.1.43778 WP_000983393.1.43782 WP_000983393.1.43785 WP_000983393.1.43801 WP_000983393.1.43812 WP_000983393.1.43839 WP_000983393.1.43864 WP_000983393.1.43873 WP_000983393.1.43875 WP_000983393.1.43878 WP_000983393.1.43886 WP_000983393.1.43888 WP_000983393.1.43919 WP_000983393.1.43951 WP_000983393.1.43954 WP_000983393.1.43974 WP_000983393.1.44005 WP_000983393.1.44010 WP_000983393.1.4404 WP_000983393.1.44043 WP_000983393.1.44049 WP_000983393.1.4405 WP_000983393.1.44063 WP_000983393.1.44099 WP_000983393.1.44101 WP_000983393.1.44113 WP_000983393.1.44121 WP_000983393.1.44132 WP_000983393.1.44144 WP_000983393.1.44160 WP_000983393.1.44180 WP_000983393.1.44187 WP_000983393.1.44191 WP_000983393.1.44196 WP_000983393.1.4422 WP_000983393.1.4423 WP_000983393.1.44248 WP_000983393.1.44250 WP_000983393.1.44262 WP_000983393.1.44268 WP_000983393.1.4427 WP_000983393.1.44291 WP_000983393.1.44296 WP_000983393.1.44300 WP_000983393.1.44310 WP_000983393.1.44337 WP_000983393.1.44339 WP_000983393.1.44343 WP_000983393.1.44351 WP_000983393.1.44359 WP_000983393.1.44360 WP_000983393.1.44380 WP_000983393.1.44386 WP_000983393.1.44397 WP_000983393.1.4440 WP_000983393.1.44416 WP_000983393.1.44431 WP_000983393.1.44433 WP_000983393.1.44437 WP_000983393.1.44438 WP_000983393.1.44440 WP_000983393.1.44443 WP_000983393.1.44453 WP_000983393.1.44474 WP_000983393.1.44479 WP_000983393.1.44546 WP_000983393.1.44549 WP_000983393.1.44578 WP_000983393.1.44593 WP_000983393.1.44606 WP_000983393.1.44607 WP_000983393.1.44633 WP_000983393.1.44636 WP_000983393.1.44640 WP_000983393.1.4467 WP_000983393.1.44678 WP_000983393.1.4468 WP_000983393.1.44687 WP_000983393.1.44702 WP_000983393.1.44705 WP_000983393.1.44747 WP_000983393.1.44762 WP_000983393.1.44781 WP_000983393.1.44791 WP_000983393.1.44815 WP_000983393.1.44828 WP_000983393.1.44831 WP_000983393.1.44833 WP_000983393.1.4485 WP_000983393.1.44877 WP_000983393.1.44879 WP_000983393.1.449 WP_000983393.1.44917 WP_000983393.1.44927 WP_000983393.1.44933 WP_000983393.1.44943 WP_000983393.1.44950 WP_000983393.1.44966 WP_000983393.1.44971 WP_000983393.1.44978 WP_000983393.1.44985 WP_000983393.1.44996 WP_000983393.1.44997 WP_000983393.1.44998 WP_000983393.1.4500 WP_000983393.1.4501 WP_000983393.1.45027 WP_000983393.1.45038 WP_000983393.1.45045 WP_000983393.1.4505 WP_000983393.1.45067 WP_000983393.1.45072 WP_000983393.1.45074 WP_000983393.1.45079 WP_000983393.1.45093 WP_000983393.1.45098 WP_000983393.1.45123 WP_000983393.1.45134 WP_000983393.1.45136 WP_000983393.1.45138 WP_000983393.1.45145 WP_000983393.1.45154 WP_000983393.1.45173 WP_000983393.1.45177 WP_000983393.1.45184 WP_000983393.1.45229 WP_000983393.1.45241 WP_000983393.1.45251 WP_000983393.1.45259 WP_000983393.1.45268 WP_000983393.1.45302 WP_000983393.1.4531 WP_000983393.1.45322 WP_000983393.1.45344 WP_000983393.1.45349 WP_000983393.1.45351 WP_000983393.1.45365 WP_000983393.1.4540 WP_000983393.1.45402 WP_000983393.1.45432 WP_000983393.1.45434 WP_000983393.1.45435 WP_000983393.1.45462 WP_000983393.1.45468 WP_000983393.1.45522 WP_000983393.1.45523 WP_000983393.1.45535 WP_000983393.1.45544 WP_000983393.1.45549 WP_000983393.1.45550 WP_000983393.1.45566 WP_000983393.1.45569 WP_000983393.1.45571 WP_000983393.1.45582 WP_000983393.1.45583 WP_000983393.1.45585 WP_000983393.1.45596 WP_000983393.1.45622 WP_000983393.1.45648 WP_000983393.1.45660 WP_000983393.1.45690 WP_000983393.1.45781 WP_000983393.1.45797 WP_000983393.1.458 WP_000983393.1.45829 WP_000983393.1.45844 WP_000983393.1.45848 WP_000983393.1.45871 WP_000983393.1.45906 WP_000983393.1.45918 WP_000983393.1.4592 WP_000983393.1.45984 WP_000983393.1.46011 WP_000983393.1.46028 WP_000983393.1.46030 WP_000983393.1.46069 WP_000983393.1.46077 WP_000983393.1.46091 WP_000983393.1.46112 WP_000983393.1.46124 WP_000983393.1.46169 WP_000983393.1.46173 WP_000983393.1.46174 WP_000983393.1.46187 WP_000983393.1.46203 WP_000983393.1.46205 WP_000983393.1.46215 WP_000983393.1.46225 WP_000983393.1.46232 WP_000983393.1.46241 WP_000983393.1.46243 WP_000983393.1.46278 WP_000983393.1.46286 WP_000983393.1.46299 WP_000983393.1.46303 WP_000983393.1.46307 WP_000983393.1.46322 WP_000983393.1.46323 WP_000983393.1.46345 WP_000983393.1.46355 WP_000983393.1.46358 WP_000983393.1.464 WP_000983393.1.46406 WP_000983393.1.46434 WP_000983393.1.46444 WP_000983393.1.46454 WP_000983393.1.46461 WP_000983393.1.46499 WP_000983393.1.46504 WP_000983393.1.46505 WP_000983393.1.46551 WP_000983393.1.46559 WP_000983393.1.46572 WP_000983393.1.46574 WP_000983393.1.46578 WP_000983393.1.46595 WP_000983393.1.46620 WP_000983393.1.46637 WP_000983393.1.46666 WP_000983393.1.46675 WP_000983393.1.46689 WP_000983393.1.46693 WP_000983393.1.46701 WP_000983393.1.4671 WP_000983393.1.46726 WP_000983393.1.46730 WP_000983393.1.46732 WP_000983393.1.4674 WP_000983393.1.46749 WP_000983393.1.46781 WP_000983393.1.46803 WP_000983393.1.46804 WP_000983393.1.46816 WP_000983393.1.46842 WP_000983393.1.4686 WP_000983393.1.4690 WP_000983393.1.46920 WP_000983393.1.46930 WP_000983393.1.46945 WP_000983393.1.46961 WP_000983393.1.46967 WP_000983393.1.46976 WP_000983393.1.47005 WP_000983393.1.47008 WP_000983393.1.47014 WP_000983393.1.47036 WP_000983393.1.47037 WP_000983393.1.47042 WP_000983393.1.47057 WP_000983393.1.47058 WP_000983393.1.47059 WP_000983393.1.47061 WP_000983393.1.47067 WP_000983393.1.47085 WP_000983393.1.47110 WP_000983393.1.47123 WP_000983393.1.47214 WP_000983393.1.47215 WP_000983393.1.47243 WP_000983393.1.47245 WP_000983393.1.47257 WP_000983393.1.47389 WP_000983393.1.47429 WP_000983393.1.47442 WP_000983393.1.47448 WP_000983393.1.47460 WP_000983393.1.4747 WP_000983393.1.47472 WP_000983393.1.47478 WP_000983393.1.47492 WP_000983393.1.47506 WP_000983393.1.47507 WP_000983393.1.47523 WP_000983393.1.47531 WP_000983393.1.47532 WP_000983393.1.47542 WP_000983393.1.47567 WP_000983393.1.47576 WP_000983393.1.47579 WP_000983393.1.4758 WP_000983393.1.47587 WP_000983393.1.47605 WP_000983393.1.47614 WP_000983393.1.47621 WP_000983393.1.47630 WP_000983393.1.47649 WP_000983393.1.47660 WP_000983393.1.4769 WP_000983393.1.4770 WP_000983393.1.47714 WP_000983393.1.4774 WP_000983393.1.4775 WP_000983393.1.47756 WP_000983393.1.47767 WP_000983393.1.47799 WP_000983393.1.4781 WP_000983393.1.47814 WP_000983393.1.47817 WP_000983393.1.47829 WP_000983393.1.47849 WP_000983393.1.47850 WP_000983393.1.47875 WP_000983393.1.47886 WP_000983393.1.47898 WP_000983393.1.47902 WP_000983393.1.47911 WP_000983393.1.47928 WP_000983393.1.4795 WP_000983393.1.47988 WP_000983393.1.47992 WP_000983393.1.48019 WP_000983393.1.48100 WP_000983393.1.48114 WP_000983393.1.48124 WP_000983393.1.48132 WP_000983393.1.48134 WP_000983393.1.48139 WP_000983393.1.48190 WP_000983393.1.48209 WP_000983393.1.48215 WP_000983393.1.48218 WP_000983393.1.48242 WP_000983393.1.48244 WP_000983393.1.48247 WP_000983393.1.48253 WP_000983393.1.48262 WP_000983393.1.48268 WP_000983393.1.48292 WP_000983393.1.483 WP_000983393.1.48324 WP_000983393.1.48367 WP_000983393.1.48377 WP_000983393.1.4839 WP_000983393.1.48399 WP_000983393.1.48426 WP_000983393.1.48430 WP_000983393.1.48436 WP_000983393.1.48455 WP_000983393.1.48493 WP_000983393.1.48510 WP_000983393.1.48524 WP_000983393.1.4853 WP_000983393.1.48570 WP_000983393.1.48586 WP_000983393.1.4859 WP_000983393.1.48591 WP_000983393.1.48610 WP_000983393.1.48631 WP_000983393.1.48647 WP_000983393.1.48651 WP_000983393.1.48663 WP_000983393.1.48690 WP_000983393.1.48734 WP_000983393.1.48751 WP_000983393.1.48756 WP_000983393.1.48768 WP_000983393.1.48774 WP_000983393.1.48778 WP_000983393.1.48788 WP_000983393.1.48797 WP_000983393.1.48841 WP_000983393.1.48849 WP_000983393.1.4885 WP_000983393.1.48855 WP_000983393.1.48876 WP_000983393.1.48886 WP_000983393.1.48894 WP_000983393.1.48896 WP_000983393.1.48908 WP_000983393.1.48918 WP_000983393.1.48919 WP_000983393.1.48931 WP_000983393.1.48955 WP_000983393.1.48963 WP_000983393.1.48973 WP_000983393.1.48985 WP_000983393.1.49004 WP_000983393.1.49005 WP_000983393.1.49012 WP_000983393.1.49084 WP_000983393.1.49090 WP_000983393.1.49102 WP_000983393.1.49106 WP_000983393.1.49113 WP_000983393.1.49117 WP_000983393.1.49121 WP_000983393.1.4914 WP_000983393.1.49140 WP_000983393.1.49153 WP_000983393.1.49155 WP_000983393.1.49162 WP_000983393.1.49166 WP_000983393.1.49175 WP_000983393.1.49204 WP_000983393.1.49214 WP_000983393.1.49226 WP_000983393.1.49233 WP_000983393.1.49239 WP_000983393.1.49256 WP_000983393.1.49262 WP_000983393.1.49276 WP_000983393.1.49290 WP_000983393.1.49304 WP_000983393.1.49309 WP_000983393.1.49311 WP_000983393.1.49334 WP_000983393.1.49340 WP_000983393.1.49355 WP_000983393.1.49358 WP_000983393.1.49366 WP_000983393.1.49375 WP_000983393.1.49429 WP_000983393.1.49430 WP_000983393.1.49434 WP_000983393.1.49443 WP_000983393.1.49450 WP_000983393.1.49472 WP_000983393.1.49490 WP_000983393.1.49494 WP_000983393.1.495 WP_000983393.1.49515 WP_000983393.1.49545 WP_000983393.1.49550 WP_000983393.1.49572 WP_000983393.1.49574 WP_000983393.1.49590 WP_000983393.1.49595 WP_000983393.1.49602 WP_000983393.1.49626 WP_000983393.1.49630 WP_000983393.1.49650 WP_000983393.1.49703 WP_000983393.1.49769 WP_000983393.1.49770 WP_000983393.1.49778 WP_000983393.1.49780 WP_000983393.1.4979 WP_000983393.1.49790 WP_000983393.1.49803 WP_000983393.1.49805 WP_000983393.1.49827 WP_000983393.1.49846 WP_000983393.1.49848 WP_000983393.1.4991 WP_000983393.1.49929 WP_000983393.1.49931 WP_000983393.1.49947 WP_000983393.1.49959 WP_000983393.1.49997 WP_000983393.1.50 WP_000983393.1.50003 WP_000983393.1.50007 WP_000983393.1.50014 WP_000983393.1.50030 WP_000983393.1.50043 WP_000983393.1.50080 WP_000983393.1.5009 WP_000983393.1.50103 WP_000983393.1.50128 WP_000983393.1.50153 WP_000983393.1.50158 WP_000983393.1.50161 WP_000983393.1.50198 WP_000983393.1.50211 WP_000983393.1.50238 WP_000983393.1.50239 WP_000983393.1.50247 WP_000983393.1.50251 WP_000983393.1.50285 WP_000983393.1.50308 WP_000983393.1.50309 WP_000983393.1.50332 WP_000983393.1.50349 WP_000983393.1.50374 WP_000983393.1.50376 WP_000983393.1.50386 WP_000983393.1.50387 WP_000983393.1.50389 WP_000983393.1.50404 WP_000983393.1.50406 WP_000983393.1.50413 WP_000983393.1.50449 WP_000983393.1.50468 WP_000983393.1.50469 WP_000983393.1.50478 WP_000983393.1.50480 WP_000983393.1.5051 WP_000983393.1.50517 WP_000983393.1.50529 WP_000983393.1.50563 WP_000983393.1.50565 WP_000983393.1.50566 WP_000983393.1.50570 WP_000983393.1.50576 WP_000983393.1.5058 WP_000983393.1.50593 WP_000983393.1.50626 WP_000983393.1.50652 WP_000983393.1.50676 WP_000983393.1.50684 WP_000983393.1.50726 WP_000983393.1.50750 WP_000983393.1.50769 WP_000983393.1.50771 WP_000983393.1.50774 WP_000983393.1.50777 WP_000983393.1.50782 WP_000983393.1.50800 WP_000983393.1.50804 WP_000983393.1.50808 WP_000983393.1.50811 WP_000983393.1.50875 WP_000983393.1.5088 WP_000983393.1.50882 WP_000983393.1.50885 WP_000983393.1.50893 WP_000983393.1.509 WP_000983393.1.50905 WP_000983393.1.50908 WP_000983393.1.50918 WP_000983393.1.50929 WP_000983393.1.50941 WP_000983393.1.50954 WP_000983393.1.50960 WP_000983393.1.50970 WP_000983393.1.50999 WP_000983393.1.51014 WP_000983393.1.51022 WP_000983393.1.51025 WP_000983393.1.51036 WP_000983393.1.51040 WP_000983393.1.51048 WP_000983393.1.51066 WP_000983393.1.51100 WP_000983393.1.51131 WP_000983393.1.51134 WP_000983393.1.51139 WP_000983393.1.5114 WP_000983393.1.51162 WP_000983393.1.51179 WP_000983393.1.51182 WP_000983393.1.51186 WP_000983393.1.51224 WP_000983393.1.51227 WP_000983393.1.5125 WP_000983393.1.5127 WP_000983393.1.51285 WP_000983393.1.51305 WP_000983393.1.51308 WP_000983393.1.51315 WP_000983393.1.51338 WP_000983393.1.51356 WP_000983393.1.5136 WP_000983393.1.5138 WP_000983393.1.51394 WP_000983393.1.51412 WP_000983393.1.51414 WP_000983393.1.51419 WP_000983393.1.51451 WP_000983393.1.51464 WP_000983393.1.51474 WP_000983393.1.51487 WP_000983393.1.51488 WP_000983393.1.51502 WP_000983393.1.51506 WP_000983393.1.51514 WP_000983393.1.51518 WP_000983393.1.51519 WP_000983393.1.51555 WP_000983393.1.51594 WP_000983393.1.51598 WP_000983393.1.51611 WP_000983393.1.51613 WP_000983393.1.51634 WP_000983393.1.51642 WP_000983393.1.51644 WP_000983393.1.51649 WP_000983393.1.51686 WP_000983393.1.51700 WP_000983393.1.51704 WP_000983393.1.51724 WP_000983393.1.51734 WP_000983393.1.51756 WP_000983393.1.51764 WP_000983393.1.51810 WP_000983393.1.51831 WP_000983393.1.51838 WP_000983393.1.51841 WP_000983393.1.5185 WP_000983393.1.51863 WP_000983393.1.51868 WP_000983393.1.51900 WP_000983393.1.51910 WP_000983393.1.51911 WP_000983393.1.51914 WP_000983393.1.51930 WP_000983393.1.51935 WP_000983393.1.51989 WP_000983393.1.51994 WP_000983393.1.520 WP_000983393.1.52047 WP_000983393.1.52057 WP_000983393.1.52101 WP_000983393.1.5211 WP_000983393.1.52114 WP_000983393.1.52121 WP_000983393.1.52123 WP_000983393.1.52129 WP_000983393.1.52148 WP_000983393.1.52156 WP_000983393.1.5216 WP_000983393.1.52161 WP_000983393.1.52170 WP_000983393.1.52191 WP_000983393.1.52202 WP_000983393.1.52209 WP_000983393.1.52255 WP_000983393.1.52301 WP_000983393.1.52321 WP_000983393.1.52336 WP_000983393.1.52339 WP_000983393.1.52346 WP_000983393.1.52353 WP_000983393.1.52356 WP_000983393.1.52361 WP_000983393.1.52438 WP_000983393.1.52446 WP_000983393.1.52456 WP_000983393.1.52469 WP_000983393.1.52527 WP_000983393.1.52528 WP_000983393.1.52571 WP_000983393.1.52582 WP_000983393.1.52586 WP_000983393.1.526 WP_000983393.1.52608 WP_000983393.1.52637 WP_000983393.1.52647 WP_000983393.1.52653 WP_000983393.1.52656 WP_000983393.1.52675 WP_000983393.1.52692 WP_000983393.1.5273 WP_000983393.1.52738 WP_000983393.1.52742 WP_000983393.1.52743 WP_000983393.1.52744 WP_000983393.1.52748 WP_000983393.1.52773 WP_000983393.1.52795 WP_000983393.1.52807 WP_000983393.1.52824 WP_000983393.1.52833 WP_000983393.1.52857 WP_000983393.1.52858 WP_000983393.1.52866 WP_000983393.1.52887 WP_000983393.1.52898 WP_000983393.1.52915 WP_000983393.1.52924 WP_000983393.1.52949 WP_000983393.1.52985 WP_000983393.1.5301 WP_000983393.1.53016 WP_000983393.1.53092 WP_000983393.1.53100 WP_000983393.1.53107 WP_000983393.1.53119 WP_000983393.1.5313 WP_000983393.1.53141 WP_000983393.1.53151 WP_000983393.1.53154 WP_000983393.1.53158 WP_000983393.1.53159 WP_000983393.1.5316 WP_000983393.1.53179 WP_000983393.1.53190 WP_000983393.1.53198 WP_000983393.1.53203 WP_000983393.1.53206 WP_000983393.1.53210 WP_000983393.1.53233 WP_000983393.1.53234 WP_000983393.1.53272 WP_000983393.1.53274 WP_000983393.1.53286 WP_000983393.1.53307 WP_000983393.1.53315 WP_000983393.1.53316 WP_000983393.1.53321 WP_000983393.1.53328 WP_000983393.1.5333 WP_000983393.1.53362 WP_000983393.1.53368 WP_000983393.1.53375 WP_000983393.1.53385 WP_000983393.1.53406 WP_000983393.1.53436 WP_000983393.1.53450 WP_000983393.1.53454 WP_000983393.1.53466 WP_000983393.1.5349 WP_000983393.1.53529 WP_000983393.1.53534 WP_000983393.1.53540 WP_000983393.1.53543 WP_000983393.1.53555 WP_000983393.1.53559 WP_000983393.1.5356 WP_000983393.1.53567 WP_000983393.1.53571 WP_000983393.1.5358 WP_000983393.1.53664 WP_000983393.1.53675 WP_000983393.1.53688 WP_000983393.1.53692 WP_000983393.1.53694 WP_000983393.1.53696 WP_000983393.1.53723 WP_000983393.1.5374 WP_000983393.1.53750 WP_000983393.1.53757 WP_000983393.1.53772 WP_000983393.1.53778 WP_000983393.1.53781 WP_000983393.1.53790 WP_000983393.1.53800 WP_000983393.1.53812 WP_000983393.1.53814 WP_000983393.1.53815 WP_000983393.1.53839 WP_000983393.1.53892 WP_000983393.1.53896 WP_000983393.1.53898 WP_000983393.1.53902 WP_000983393.1.53905 WP_000983393.1.5392 WP_000983393.1.53935 WP_000983393.1.53958 WP_000983393.1.53961 WP_000983393.1.53981 WP_000983393.1.53984 WP_000983393.1.54033 WP_000983393.1.54061 WP_000983393.1.54068 WP_000983393.1.54075 WP_000983393.1.54082 WP_000983393.1.54085 WP_000983393.1.54132 WP_000983393.1.54136 WP_000983393.1.5415 WP_000983393.1.54159 WP_000983393.1.54170 WP_000983393.1.54175 WP_000983393.1.54196 WP_000983393.1.542 WP_000983393.1.54203 WP_000983393.1.54209 WP_000983393.1.54259 WP_000983393.1.54271 WP_000983393.1.54273 WP_000983393.1.54274 WP_000983393.1.54283 WP_000983393.1.5430 WP_000983393.1.54319 WP_000983393.1.54324 WP_000983393.1.54333 WP_000983393.1.54340 WP_000983393.1.54364 WP_000983393.1.54366 WP_000983393.1.54371 WP_000983393.1.54400 WP_000983393.1.54431 WP_000983393.1.54442 WP_000983393.1.54469 WP_000983393.1.54482 WP_000983393.1.54500 WP_000983393.1.54522 WP_000983393.1.54526 WP_000983393.1.54558 WP_000983393.1.5456 WP_000983393.1.54569 WP_000983393.1.54589 WP_000983393.1.5459 WP_000983393.1.54607 WP_000983393.1.54615 WP_000983393.1.5462 WP_000983393.1.54644 WP_000983393.1.54662 WP_000983393.1.54667 WP_000983393.1.54678 WP_000983393.1.54681 WP_000983393.1.54694 WP_000983393.1.54722 WP_000983393.1.54748 WP_000983393.1.54749 WP_000983393.1.54764 WP_000983393.1.54774 WP_000983393.1.5481 WP_000983393.1.54814 WP_000983393.1.54822 WP_000983393.1.54827 WP_000983393.1.54833 WP_000983393.1.54845 WP_000983393.1.5485 WP_000983393.1.54865 WP_000983393.1.54877 WP_000983393.1.5493 WP_000983393.1.54935 WP_000983393.1.54936 WP_000983393.1.54979 WP_000983393.1.54984 WP_000983393.1.54992 WP_000983393.1.55008 WP_000983393.1.55010 WP_000983393.1.55034 WP_000983393.1.55073 WP_000983393.1.55152 WP_000983393.1.55156 WP_000983393.1.55163 WP_000983393.1.55165 WP_000983393.1.55166 WP_000983393.1.5517 WP_000983393.1.55178 WP_000983393.1.55200 WP_000983393.1.55215 WP_000983393.1.55223 WP_000983393.1.55224 WP_000983393.1.5523 WP_000983393.1.5525 WP_000983393.1.55285 WP_000983393.1.55290 WP_000983393.1.55294 WP_000983393.1.55310 WP_000983393.1.55317 WP_000983393.1.55325 WP_000983393.1.55361 WP_000983393.1.55379 WP_000983393.1.5539 WP_000983393.1.55418 WP_000983393.1.55430 WP_000983393.1.55461 WP_000983393.1.55468 WP_000983393.1.55475 WP_000983393.1.55477 WP_000983393.1.55496 WP_000983393.1.55506 WP_000983393.1.5552 WP_000983393.1.55528 WP_000983393.1.55545 WP_000983393.1.5555 WP_000983393.1.55554 WP_000983393.1.55557 WP_000983393.1.55559 WP_000983393.1.5560 WP_000983393.1.55604 WP_000983393.1.55614 WP_000983393.1.55623 WP_000983393.1.55639 WP_000983393.1.55640 WP_000983393.1.55647 WP_000983393.1.55672 WP_000983393.1.55680 WP_000983393.1.55699 WP_000983393.1.55706 WP_000983393.1.55718 WP_000983393.1.5572 WP_000983393.1.55725 WP_000983393.1.55743 WP_000983393.1.55768 WP_000983393.1.5577 WP_000983393.1.55780 WP_000983393.1.55782 WP_000983393.1.55803 WP_000983393.1.55853 WP_000983393.1.55923 WP_000983393.1.55948 WP_000983393.1.55967 WP_000983393.1.55973 WP_000983393.1.55993 WP_000983393.1.55995 WP_000983393.1.56002 WP_000983393.1.56004 WP_000983393.1.56012 WP_000983393.1.56026 WP_000983393.1.56059 WP_000983393.1.56069 WP_000983393.1.56070 WP_000983393.1.56082 WP_000983393.1.56097 WP_000983393.1.56100 WP_000983393.1.56105 WP_000983393.1.56130 WP_000983393.1.56144 WP_000983393.1.56152 WP_000983393.1.56172 WP_000983393.1.5621 WP_000983393.1.56222 WP_000983393.1.56226 WP_000983393.1.56235 WP_000983393.1.56238 WP_000983393.1.56244 WP_000983393.1.56247 WP_000983393.1.56263 WP_000983393.1.56286 WP_000983393.1.56303 WP_000983393.1.56304 WP_000983393.1.56305 WP_000983393.1.56311 WP_000983393.1.5633 WP_000983393.1.56354 WP_000983393.1.56368 WP_000983393.1.56370 WP_000983393.1.56374 WP_000983393.1.56385 WP_000983393.1.56389 WP_000983393.1.56393 WP_000983393.1.56396 WP_000983393.1.56413 WP_000983393.1.56414 WP_000983393.1.56419 WP_000983393.1.56420 WP_000983393.1.56423 WP_000983393.1.56438 WP_000983393.1.56468 WP_000983393.1.56512 WP_000983393.1.56514 WP_000983393.1.56535 WP_000983393.1.56559 WP_000983393.1.56560 WP_000983393.1.56585 WP_000983393.1.56597 WP_000983393.1.56601 WP_000983393.1.56614 WP_000983393.1.56615 WP_000983393.1.56640 WP_000983393.1.56642 WP_000983393.1.56647 WP_000983393.1.56651 WP_000983393.1.56660 WP_000983393.1.56671 WP_000983393.1.5668 WP_000983393.1.56682 WP_000983393.1.56724 WP_000983393.1.56791 WP_000983393.1.56824 WP_000983393.1.56825 WP_000983393.1.56851 WP_000983393.1.56853 WP_000983393.1.56861 WP_000983393.1.56875 WP_000983393.1.56877 WP_000983393.1.56887 WP_000983393.1.56889 WP_000983393.1.56893 WP_000983393.1.56898 WP_000983393.1.56905 WP_000983393.1.56942 WP_000983393.1.56950 WP_000983393.1.56981 WP_000983393.1.57000 WP_000983393.1.57026 WP_000983393.1.57039 WP_000983393.1.57056 WP_000983393.1.57076 WP_000983393.1.57084 WP_000983393.1.57101 WP_000983393.1.5711 WP_000983393.1.57125 WP_000983393.1.57137 WP_000983393.1.57143 WP_000983393.1.57147 WP_000983393.1.57149 WP_000983393.1.57168 WP_000983393.1.57179 WP_000983393.1.57186 WP_000983393.1.57187 WP_000983393.1.57232 WP_000983393.1.57233 WP_000983393.1.57244 WP_000983393.1.57246 WP_000983393.1.57296 WP_000983393.1.57307 WP_000983393.1.57342 WP_000983393.1.57344 WP_000983393.1.57356 WP_000983393.1.57357 WP_000983393.1.57362 WP_000983393.1.57377 WP_000983393.1.57399 WP_000983393.1.57418 WP_000983393.1.57433 WP_000983393.1.57494 WP_000983393.1.57495 WP_000983393.1.57510 WP_000983393.1.57515 WP_000983393.1.57521 WP_000983393.1.57529 WP_000983393.1.5753 WP_000983393.1.57534 WP_000983393.1.57555 WP_000983393.1.57559 WP_000983393.1.57576 WP_000983393.1.57601 WP_000983393.1.57607 WP_000983393.1.5761 WP_000983393.1.57631 WP_000983393.1.57641 WP_000983393.1.57684 WP_000983393.1.57699 WP_000983393.1.57709 WP_000983393.1.57710 WP_000983393.1.57735 WP_000983393.1.57763 WP_000983393.1.57778 WP_000983393.1.57781 WP_000983393.1.57785 WP_000983393.1.57797 WP_000983393.1.57800 WP_000983393.1.5781 WP_000983393.1.57835 WP_000983393.1.57857 WP_000983393.1.57862 WP_000983393.1.57873 WP_000983393.1.57890 WP_000983393.1.57891 WP_000983393.1.57893 WP_000983393.1.57902 WP_000983393.1.57965 WP_000983393.1.57972 WP_000983393.1.57978 WP_000983393.1.58008 WP_000983393.1.5801 WP_000983393.1.58040 WP_000983393.1.58041 WP_000983393.1.58044 WP_000983393.1.58081 WP_000983393.1.5809 WP_000983393.1.58090 WP_000983393.1.58131 WP_000983393.1.58132 WP_000983393.1.58144 WP_000983393.1.58153 WP_000983393.1.58157 WP_000983393.1.58173 WP_000983393.1.58191 WP_000983393.1.58194 WP_000983393.1.58239 WP_000983393.1.58249 WP_000983393.1.58251 WP_000983393.1.58252 WP_000983393.1.58261 WP_000983393.1.58274 WP_000983393.1.5828 WP_000983393.1.58282 WP_000983393.1.58290 WP_000983393.1.58301 WP_000983393.1.58324 WP_000983393.1.58326 WP_000983393.1.58334 WP_000983393.1.58357 WP_000983393.1.58358 WP_000983393.1.5836 WP_000983393.1.58372 WP_000983393.1.58407 WP_000983393.1.58416 WP_000983393.1.58418 WP_000983393.1.58442 WP_000983393.1.58443 WP_000983393.1.58451 WP_000983393.1.5846 WP_000983393.1.58467 WP_000983393.1.58485 WP_000983393.1.58486 WP_000983393.1.58489 WP_000983393.1.58537 WP_000983393.1.5854 WP_000983393.1.58548 WP_000983393.1.58564 WP_000983393.1.58568 WP_000983393.1.5858 WP_000983393.1.58583 WP_000983393.1.58604 WP_000983393.1.58633 WP_000983393.1.58652 WP_000983393.1.58662 WP_000983393.1.58663 WP_000983393.1.58669 WP_000983393.1.58675 WP_000983393.1.58698 WP_000983393.1.587 WP_000983393.1.58724 WP_000983393.1.58729 WP_000983393.1.58744 WP_000983393.1.58745 WP_000983393.1.58749 WP_000983393.1.5875 WP_000983393.1.5878 WP_000983393.1.58796 WP_000983393.1.58803 WP_000983393.1.58807 WP_000983393.1.58834 WP_000983393.1.58836 WP_000983393.1.58847 WP_000983393.1.5886 WP_000983393.1.58861 WP_000983393.1.58883 WP_000983393.1.58884 WP_000983393.1.58898 WP_000983393.1.58926 WP_000983393.1.58932 WP_000983393.1.58949 WP_000983393.1.58963 WP_000983393.1.58970 WP_000983393.1.58974 WP_000983393.1.59006 WP_000983393.1.59012 WP_000983393.1.59020 WP_000983393.1.59043 WP_000983393.1.59056 WP_000983393.1.59061 WP_000983393.1.59064 WP_000983393.1.59068 WP_000983393.1.59084 WP_000983393.1.59094 WP_000983393.1.59097 WP_000983393.1.59125 WP_000983393.1.59136 WP_000983393.1.59142 WP_000983393.1.59148 WP_000983393.1.59163 WP_000983393.1.59224 WP_000983393.1.59236 WP_000983393.1.59276 WP_000983393.1.59282 WP_000983393.1.5929 WP_000983393.1.59294 WP_000983393.1.59295 WP_000983393.1.59299 WP_000983393.1.59313 WP_000983393.1.59321 WP_000983393.1.59335 WP_000983393.1.59336 WP_000983393.1.59375 WP_000983393.1.59381 WP_000983393.1.59412 WP_000983393.1.59420 WP_000983393.1.59427 WP_000983393.1.59439 WP_000983393.1.59458 WP_000983393.1.59486 WP_000983393.1.5949 WP_000983393.1.59490 WP_000983393.1.59501 WP_000983393.1.59508 WP_000983393.1.59510 WP_000983393.1.59512 WP_000983393.1.59521 WP_000983393.1.5953 WP_000983393.1.59538 WP_000983393.1.59548 WP_000983393.1.59562 WP_000983393.1.59587 WP_000983393.1.59604 WP_000983393.1.59636 WP_000983393.1.59641 WP_000983393.1.59646 WP_000983393.1.59648 WP_000983393.1.59684 WP_000983393.1.5969 WP_000983393.1.59694 WP_000983393.1.59709 WP_000983393.1.59710 WP_000983393.1.59751 WP_000983393.1.59755 WP_000983393.1.59771 WP_000983393.1.5979 WP_000983393.1.59827 WP_000983393.1.59829 WP_000983393.1.59830 WP_000983393.1.59847 WP_000983393.1.59848 WP_000983393.1.59863 WP_000983393.1.59928 WP_000983393.1.5993 WP_000983393.1.59933 WP_000983393.1.59953 WP_000983393.1.59969 WP_000983393.1.59979 WP_000983393.1.59994 WP_000983393.1.60004 WP_000983393.1.60008 WP_000983393.1.60015 WP_000983393.1.60021 WP_000983393.1.60045 WP_000983393.1.60052 WP_000983393.1.60069 WP_000983393.1.60076 WP_000983393.1.60106 WP_000983393.1.60114 WP_000983393.1.60126 WP_000983393.1.60137 WP_000983393.1.60140 WP_000983393.1.60154 WP_000983393.1.60155 WP_000983393.1.60168 WP_000983393.1.60192 WP_000983393.1.60199 WP_000983393.1.60209 WP_000983393.1.60212 WP_000983393.1.60213 WP_000983393.1.60226 WP_000983393.1.60231 WP_000983393.1.60253 WP_000983393.1.60285 WP_000983393.1.60320 WP_000983393.1.60322 WP_000983393.1.60324 WP_000983393.1.6033 WP_000983393.1.60330 WP_000983393.1.60356 WP_000983393.1.60370 WP_000983393.1.60379 WP_000983393.1.6038 WP_000983393.1.60380 WP_000983393.1.6041 WP_000983393.1.60424 WP_000983393.1.60425 WP_000983393.1.60464 WP_000983393.1.60469 WP_000983393.1.60481 WP_000983393.1.60486 WP_000983393.1.605 WP_000983393.1.60503 WP_000983393.1.60507 WP_000983393.1.6052 WP_000983393.1.60545 WP_000983393.1.60560 WP_000983393.1.60561 WP_000983393.1.6058 WP_000983393.1.60584 WP_000983393.1.60597 WP_000983393.1.6060 WP_000983393.1.60608 WP_000983393.1.60622 WP_000983393.1.60643 WP_000983393.1.60661 WP_000983393.1.60676 WP_000983393.1.60708 WP_000983393.1.60713 WP_000983393.1.60725 WP_000983393.1.60746 WP_000983393.1.60760 WP_000983393.1.60772 WP_000983393.1.60783 WP_000983393.1.60792 WP_000983393.1.60794 WP_000983393.1.608 WP_000983393.1.60807 WP_000983393.1.60809 WP_000983393.1.60838 WP_000983393.1.60851 WP_000983393.1.60855 WP_000983393.1.60857 WP_000983393.1.6086 WP_000983393.1.60863 WP_000983393.1.60866 WP_000983393.1.60874 WP_000983393.1.60882 WP_000983393.1.60889 WP_000983393.1.60897 WP_000983393.1.6090 WP_000983393.1.60919 WP_000983393.1.60926 WP_000983393.1.60941 WP_000983393.1.60950 WP_000983393.1.60976 WP_000983393.1.60988 WP_000983393.1.60990 WP_000983393.1.6104 WP_000983393.1.61044 WP_000983393.1.61045 WP_000983393.1.61076 WP_000983393.1.61078 WP_000983393.1.6108 WP_000983393.1.61087 WP_000983393.1.61114 WP_000983393.1.61123 WP_000983393.1.6114 WP_000983393.1.61146 WP_000983393.1.61147 WP_000983393.1.61168 WP_000983393.1.61184 WP_000983393.1.61200 WP_000983393.1.61201 WP_000983393.1.61210 WP_000983393.1.61232 WP_000983393.1.61233 WP_000983393.1.6129 WP_000983393.1.61296 WP_000983393.1.61309 WP_000983393.1.61345 WP_000983393.1.61356 WP_000983393.1.61357 WP_000983393.1.61381 WP_000983393.1.61417 WP_000983393.1.6143 WP_000983393.1.61434 WP_000983393.1.61497 WP_000983393.1.61501 WP_000983393.1.61509 WP_000983393.1.61511 WP_000983393.1.61519 WP_000983393.1.61539 WP_000983393.1.61542 WP_000983393.1.61553 WP_000983393.1.61574 WP_000983393.1.61582 WP_000983393.1.61594 WP_000983393.1.61595 WP_000983393.1.61609 WP_000983393.1.6164 WP_000983393.1.61649 WP_000983393.1.61652 WP_000983393.1.61662 WP_000983393.1.61667 WP_000983393.1.61671 WP_000983393.1.61694 WP_000983393.1.61697 WP_000983393.1.61712 WP_000983393.1.61714 WP_000983393.1.61730 WP_000983393.1.61732 WP_000983393.1.61737 WP_000983393.1.61743 WP_000983393.1.61783 WP_000983393.1.61809 WP_000983393.1.61857 WP_000983393.1.61877 WP_000983393.1.6190 WP_000983393.1.61908 WP_000983393.1.61918 WP_000983393.1.61920 WP_000983393.1.61924 WP_000983393.1.61952 WP_000983393.1.61968 WP_000983393.1.62007 WP_000983393.1.62020 WP_000983393.1.62025 WP_000983393.1.62063 WP_000983393.1.62076 WP_000983393.1.6209 WP_000983393.1.6210 WP_000983393.1.62108 WP_000983393.1.62120 WP_000983393.1.62122 WP_000983393.1.62124 WP_000983393.1.62142 WP_000983393.1.62144 WP_000983393.1.62158 WP_000983393.1.62184 WP_000983393.1.62195 WP_000983393.1.62199 WP_000983393.1.62201 WP_000983393.1.62204 WP_000983393.1.62210 WP_000983393.1.62219 WP_000983393.1.62222 WP_000983393.1.62223 WP_000983393.1.62241 WP_000983393.1.62245 WP_000983393.1.62257 WP_000983393.1.62271 WP_000983393.1.62302 WP_000983393.1.62304 WP_000983393.1.62310 WP_000983393.1.62314 WP_000983393.1.62323 WP_000983393.1.62333 WP_000983393.1.62338 WP_000983393.1.62339 WP_000983393.1.62344 WP_000983393.1.62361 WP_000983393.1.62364 WP_000983393.1.62374 WP_000983393.1.62380 WP_000983393.1.62403 WP_000983393.1.62404 WP_000983393.1.62411 WP_000983393.1.62412 WP_000983393.1.62436 WP_000983393.1.62475 WP_000983393.1.62486 WP_000983393.1.62488 WP_000983393.1.62504 WP_000983393.1.62522 WP_000983393.1.6253 WP_000983393.1.62536 WP_000983393.1.62564 WP_000983393.1.62570 WP_000983393.1.62619 WP_000983393.1.62640 WP_000983393.1.62648 WP_000983393.1.62677 WP_000983393.1.62686 WP_000983393.1.62693 WP_000983393.1.627 WP_000983393.1.62725 WP_000983393.1.62745 WP_000983393.1.62751 WP_000983393.1.62757 WP_000983393.1.62798 WP_000983393.1.62825 WP_000983393.1.62828 WP_000983393.1.62853 WP_000983393.1.62903 WP_000983393.1.62910 WP_000983393.1.62913 WP_000983393.1.6292 WP_000983393.1.62932 WP_000983393.1.62955 WP_000983393.1.62960 WP_000983393.1.62976 WP_000983393.1.62983 WP_000983393.1.62988 WP_000983393.1.63016 WP_000983393.1.63025 WP_000983393.1.63043 WP_000983393.1.63045 WP_000983393.1.63063 WP_000983393.1.63069 WP_000983393.1.63087 WP_000983393.1.63102 WP_000983393.1.63118 WP_000983393.1.63129 WP_000983393.1.63135 WP_000983393.1.63150 WP_000983393.1.63155 WP_000983393.1.63169 WP_000983393.1.63181 WP_000983393.1.63186 WP_000983393.1.63203 WP_000983393.1.63229 WP_000983393.1.63243 WP_000983393.1.63250 WP_000983393.1.63256 WP_000983393.1.63290 WP_000983393.1.63297 WP_000983393.1.63358 WP_000983393.1.63382 WP_000983393.1.63422 WP_000983393.1.63432 WP_000983393.1.63448 WP_000983393.1.63455 WP_000983393.1.63461 WP_000983393.1.63479 WP_000983393.1.63497 WP_000983393.1.63499 WP_000983393.1.63509 WP_000983393.1.63513 WP_000983393.1.63514 WP_000983393.1.63529 WP_000983393.1.63532 WP_000983393.1.63568 WP_000983393.1.6357 WP_000983393.1.63577 WP_000983393.1.63583 WP_000983393.1.63585 WP_000983393.1.63592 WP_000983393.1.63603 WP_000983393.1.63663 WP_000983393.1.63664 WP_000983393.1.6367 WP_000983393.1.63677 WP_000983393.1.63690 WP_000983393.1.6370 WP_000983393.1.63718 WP_000983393.1.63731 WP_000983393.1.63736 WP_000983393.1.63748 WP_000983393.1.6375 WP_000983393.1.63757 WP_000983393.1.63766 WP_000983393.1.63781 WP_000983393.1.63782 WP_000983393.1.63797 WP_000983393.1.63816 WP_000983393.1.63824 WP_000983393.1.63831 WP_000983393.1.63834 WP_000983393.1.63851 WP_000983393.1.63860 WP_000983393.1.63863 WP_000983393.1.63864 WP_000983393.1.63866 WP_000983393.1.63876 WP_000983393.1.6389 WP_000983393.1.63901 WP_000983393.1.63903 WP_000983393.1.63912 WP_000983393.1.63934 WP_000983393.1.63955 WP_000983393.1.63958 WP_000983393.1.63963 WP_000983393.1.63977 WP_000983393.1.6399 WP_000983393.1.63992 WP_000983393.1.64007 WP_000983393.1.64010 WP_000983393.1.64018 WP_000983393.1.64032 WP_000983393.1.64034 WP_000983393.1.64046 WP_000983393.1.64072 WP_000983393.1.64085 WP_000983393.1.64087 WP_000983393.1.64109 WP_000983393.1.64121 WP_000983393.1.6415 WP_000983393.1.64157 WP_000983393.1.64208 WP_000983393.1.64217 WP_000983393.1.64229 WP_000983393.1.6423 WP_000983393.1.64242 WP_000983393.1.64244 WP_000983393.1.64266 WP_000983393.1.64293 WP_000983393.1.64294 WP_000983393.1.64332 WP_000983393.1.64350 WP_000983393.1.6437 WP_000983393.1.64374 WP_000983393.1.64376 WP_000983393.1.64385 WP_000983393.1.64387 WP_000983393.1.64389 WP_000983393.1.644 WP_000983393.1.64403 WP_000983393.1.64412 WP_000983393.1.64462 WP_000983393.1.64471 WP_000983393.1.64500 WP_000983393.1.64501 WP_000983393.1.6451 WP_000983393.1.64538 WP_000983393.1.64569 WP_000983393.1.64597 WP_000983393.1.64632 WP_000983393.1.64645 WP_000983393.1.64648 WP_000983393.1.64649 WP_000983393.1.64654 WP_000983393.1.64662 WP_000983393.1.64663 WP_000983393.1.64667 WP_000983393.1.64674 WP_000983393.1.64690 WP_000983393.1.64702 WP_000983393.1.64709 WP_000983393.1.64710 WP_000983393.1.64711 WP_000983393.1.64744 WP_000983393.1.64757 WP_000983393.1.64758 WP_000983393.1.64763 WP_000983393.1.64781 WP_000983393.1.64798 WP_000983393.1.64817 WP_000983393.1.64831 WP_000983393.1.64847 WP_000983393.1.6487 WP_000983393.1.6489 WP_000983393.1.64891 WP_000983393.1.64894 WP_000983393.1.64919 WP_000983393.1.64920 WP_000983393.1.64944 WP_000983393.1.64972 WP_000983393.1.64974 WP_000983393.1.64977 WP_000983393.1.65011 WP_000983393.1.65016 WP_000983393.1.65018 WP_000983393.1.65022 WP_000983393.1.65027 WP_000983393.1.65028 WP_000983393.1.65052 WP_000983393.1.65054 WP_000983393.1.65075 WP_000983393.1.6514 WP_000983393.1.65163 WP_000983393.1.65168 WP_000983393.1.65171 WP_000983393.1.65172 WP_000983393.1.65191 WP_000983393.1.65200 WP_000983393.1.65211 WP_000983393.1.65218 WP_000983393.1.65226 WP_000983393.1.65238 WP_000983393.1.65248 WP_000983393.1.65249 WP_000983393.1.6525 WP_000983393.1.65266 WP_000983393.1.65269 WP_000983393.1.65295 WP_000983393.1.65348 WP_000983393.1.6535 WP_000983393.1.65363 WP_000983393.1.65394 WP_000983393.1.65395 WP_000983393.1.65437 WP_000983393.1.65459 WP_000983393.1.65463 WP_000983393.1.65474 WP_000983393.1.65475 WP_000983393.1.65487 WP_000983393.1.6549 WP_000983393.1.65499 WP_000983393.1.6550 WP_000983393.1.65508 WP_000983393.1.65538 WP_000983393.1.6554 WP_000983393.1.65558 WP_000983393.1.65572 WP_000983393.1.6560 WP_000983393.1.65601 WP_000983393.1.6561 WP_000983393.1.65633 WP_000983393.1.6565 WP_000983393.1.65650 WP_000983393.1.65687 WP_000983393.1.65696 WP_000983393.1.65697 WP_000983393.1.65698 WP_000983393.1.65699 WP_000983393.1.6572 WP_000983393.1.65737 WP_000983393.1.6575 WP_000983393.1.65755 WP_000983393.1.65771 WP_000983393.1.65782 WP_000983393.1.65790 WP_000983393.1.65795 WP_000983393.1.65812 WP_000983393.1.65818 WP_000983393.1.65838 WP_000983393.1.65846 WP_000983393.1.65849 WP_000983393.1.65863 WP_000983393.1.65881 WP_000983393.1.65883 WP_000983393.1.65901 WP_000983393.1.6594 WP_000983393.1.65940 WP_000983393.1.65945 WP_000983393.1.6595 WP_000983393.1.65956 WP_000983393.1.65968 WP_000983393.1.65985 WP_000983393.1.66021 WP_000983393.1.66031 WP_000983393.1.66049 WP_000983393.1.66052 WP_000983393.1.66064 WP_000983393.1.66082 WP_000983393.1.66085 WP_000983393.1.66109 WP_000983393.1.66122 WP_000983393.1.66129 WP_000983393.1.66145 WP_000983393.1.66167 WP_000983393.1.66171 WP_000983393.1.66183 WP_000983393.1.6620 WP_000983393.1.66216 WP_000983393.1.66234 WP_000983393.1.66235 WP_000983393.1.66250 WP_000983393.1.66270 WP_000983393.1.66272 WP_000983393.1.66273 WP_000983393.1.66289 WP_000983393.1.6630 WP_000983393.1.66314 WP_000983393.1.66315 WP_000983393.1.66324 WP_000983393.1.6634 WP_000983393.1.66358 WP_000983393.1.66361 WP_000983393.1.66362 WP_000983393.1.66365 WP_000983393.1.66368 WP_000983393.1.6638 WP_000983393.1.66385 WP_000983393.1.6640 WP_000983393.1.66400 WP_000983393.1.66428 WP_000983393.1.66446 WP_000983393.1.66462 WP_000983393.1.6647 WP_000983393.1.66480 WP_000983393.1.66492 WP_000983393.1.66506 WP_000983393.1.66534 WP_000983393.1.66539 WP_000983393.1.66600 WP_000983393.1.66630 WP_000983393.1.66665 WP_000983393.1.66678 WP_000983393.1.66681 WP_000983393.1.66684 WP_000983393.1.66698 WP_000983393.1.66702 WP_000983393.1.66733 WP_000983393.1.66755 WP_000983393.1.66759 WP_000983393.1.66779 WP_000983393.1.6680 WP_000983393.1.66800 WP_000983393.1.66801 WP_000983393.1.66807 WP_000983393.1.66820 WP_000983393.1.66824 WP_000983393.1.66825 WP_000983393.1.66834 WP_000983393.1.66860 WP_000983393.1.66876 WP_000983393.1.66901 WP_000983393.1.6692 WP_000983393.1.66937 WP_000983393.1.66953 WP_000983393.1.66955 WP_000983393.1.66959 WP_000983393.1.66962 WP_000983393.1.67 WP_000983393.1.67024 WP_000983393.1.67037 WP_000983393.1.67042 WP_000983393.1.67045 WP_000983393.1.67075 WP_000983393.1.6710 WP_000983393.1.67100 WP_000983393.1.67101 WP_000983393.1.67143 WP_000983393.1.67173 WP_000983393.1.67175 WP_000983393.1.67181 WP_000983393.1.67184 WP_000983393.1.67201 WP_000983393.1.67211 WP_000983393.1.67228 WP_000983393.1.67235 WP_000983393.1.67237 WP_000983393.1.67268 WP_000983393.1.67279 WP_000983393.1.67288 WP_000983393.1.67336 WP_000983393.1.67339 WP_000983393.1.67347 WP_000983393.1.67374 WP_000983393.1.67387 WP_000983393.1.6739 WP_000983393.1.67394 WP_000983393.1.67397 WP_000983393.1.67403 WP_000983393.1.67424 WP_000983393.1.67430 WP_000983393.1.67442 WP_000983393.1.67465 WP_000983393.1.67539 WP_000983393.1.67552 WP_000983393.1.67556 WP_000983393.1.67576 WP_000983393.1.6760 WP_000983393.1.67603 WP_000983393.1.67604 WP_000983393.1.67617 WP_000983393.1.67619 WP_000983393.1.67625 WP_000983393.1.67627 WP_000983393.1.67633 WP_000983393.1.67637 WP_000983393.1.67641 WP_000983393.1.67657 WP_000983393.1.67673 WP_000983393.1.67682 WP_000983393.1.67700 WP_000983393.1.67707 WP_000983393.1.67718 WP_000983393.1.67729 WP_000983393.1.67731 WP_000983393.1.67772 WP_000983393.1.67774 WP_000983393.1.67776 WP_000983393.1.67803 WP_000983393.1.67814 WP_000983393.1.6782 WP_000983393.1.67820 WP_000983393.1.67825 WP_000983393.1.67827 WP_000983393.1.67829 WP_000983393.1.6785 WP_000983393.1.67887 WP_000983393.1.67905 WP_000983393.1.67910 WP_000983393.1.67924 WP_000983393.1.67932 WP_000983393.1.67942 WP_000983393.1.67954 WP_000983393.1.67969 WP_000983393.1.67970 WP_000983393.1.67977 WP_000983393.1.68 WP_000983393.1.68036 WP_000983393.1.68043 WP_000983393.1.68073 WP_000983393.1.68075 WP_000983393.1.6809 WP_000983393.1.68105 WP_000983393.1.68113 WP_000983393.1.68115 WP_000983393.1.68131 WP_000983393.1.68140 WP_000983393.1.68147 WP_000983393.1.68159 WP_000983393.1.68167 WP_000983393.1.68182 WP_000983393.1.6819 WP_000983393.1.68201 WP_000983393.1.68206 WP_000983393.1.68210 WP_000983393.1.6827 WP_000983393.1.68275 WP_000983393.1.68285 WP_000983393.1.6833 WP_000983393.1.68359 WP_000983393.1.68401 WP_000983393.1.68420 WP_000983393.1.68477 WP_000983393.1.68478 WP_000983393.1.6849 WP_000983393.1.685 WP_000983393.1.68514 WP_000983393.1.68532 WP_000983393.1.68547 WP_000983393.1.68564 WP_000983393.1.6857 WP_000983393.1.6858 WP_000983393.1.68589 WP_000983393.1.68591 WP_000983393.1.68629 WP_000983393.1.68652 WP_000983393.1.68655 WP_000983393.1.68656 WP_000983393.1.68658 WP_000983393.1.68677 WP_000983393.1.68688 WP_000983393.1.6869 WP_000983393.1.68690 WP_000983393.1.68742 WP_000983393.1.6875 WP_000983393.1.68770 WP_000983393.1.68778 WP_000983393.1.68787 WP_000983393.1.6879 WP_000983393.1.68809 WP_000983393.1.68816 WP_000983393.1.6882 WP_000983393.1.6883 WP_000983393.1.68893 WP_000983393.1.68894 WP_000983393.1.68895 WP_000983393.1.68914 WP_000983393.1.68928 WP_000983393.1.68958 WP_000983393.1.68966 WP_000983393.1.68975 WP_000983393.1.68999 WP_000983393.1.69001 WP_000983393.1.69006 WP_000983393.1.69011 WP_000983393.1.69029 WP_000983393.1.6904 WP_000983393.1.6905 WP_000983393.1.69053 WP_000983393.1.69058 WP_000983393.1.6907 WP_000983393.1.69080 WP_000983393.1.69086 WP_000983393.1.6913 WP_000983393.1.69131 WP_000983393.1.69139 WP_000983393.1.69146 WP_000983393.1.69151 WP_000983393.1.69170 WP_000983393.1.69210 WP_000983393.1.69236 WP_000983393.1.69255 WP_000983393.1.69270 WP_000983393.1.69273 WP_000983393.1.69282 WP_000983393.1.69288 WP_000983393.1.69296 WP_000983393.1.69320 WP_000983393.1.69346 WP_000983393.1.69357 WP_000983393.1.69359 WP_000983393.1.69371 WP_000983393.1.69376 WP_000983393.1.69385 WP_000983393.1.69396 WP_000983393.1.69397 WP_000983393.1.69433 WP_000983393.1.69465 WP_000983393.1.69466 WP_000983393.1.69485 WP_000983393.1.6954 WP_000983393.1.69554 WP_000983393.1.69564 WP_000983393.1.69575 WP_000983393.1.69597 WP_000983393.1.69611 WP_000983393.1.69616 WP_000983393.1.69636 WP_000983393.1.69642 WP_000983393.1.69644 WP_000983393.1.69656 WP_000983393.1.69657 WP_000983393.1.69690 WP_000983393.1.69696 WP_000983393.1.69704 WP_000983393.1.69710 WP_000983393.1.69754 WP_000983393.1.69758 WP_000983393.1.69760 WP_000983393.1.69767 WP_000983393.1.69785 WP_000983393.1.69787 WP_000983393.1.69790 WP_000983393.1.69807 WP_000983393.1.69808 WP_000983393.1.69817 WP_000983393.1.69839 WP_000983393.1.69848 WP_000983393.1.69890 WP_000983393.1.69923 WP_000983393.1.69948 WP_000983393.1.69953 WP_000983393.1.69965 WP_000983393.1.69975 WP_000983393.1.69977 WP_000983393.1.69982 WP_000983393.1.70003 WP_000983393.1.70010 WP_000983393.1.70028 WP_000983393.1.70047 WP_000983393.1.70049 WP_000983393.1.70058 WP_000983393.1.70061 WP_000983393.1.70087 WP_000983393.1.70088 WP_000983393.1.7010 WP_000983393.1.7014 WP_000983393.1.7016 WP_000983393.1.70169 WP_000983393.1.70183 WP_000983393.1.70205 WP_000983393.1.7021 WP_000983393.1.70240 WP_000983393.1.70241 WP_000983393.1.70248 WP_000983393.1.70249 WP_000983393.1.70261 WP_000983393.1.70269 WP_000983393.1.70272 WP_000983393.1.70281 WP_000983393.1.70289 WP_000983393.1.70290 WP_000983393.1.70303 WP_000983393.1.70314 WP_000983393.1.70321 WP_000983393.1.70326 WP_000983393.1.70327 WP_000983393.1.7033 WP_000983393.1.70355 WP_000983393.1.70427 WP_000983393.1.70433 WP_000983393.1.7044 WP_000983393.1.70440 WP_000983393.1.70447 WP_000983393.1.70485 WP_000983393.1.70488 WP_000983393.1.70491 WP_000983393.1.70523 WP_000983393.1.70531 WP_000983393.1.70545 WP_000983393.1.70547 WP_000983393.1.7055 WP_000983393.1.70580 WP_000983393.1.70596 WP_000983393.1.7060 WP_000983393.1.70623 WP_000983393.1.70643 WP_000983393.1.70644 WP_000983393.1.70671 WP_000983393.1.70678 WP_000983393.1.70679 WP_000983393.1.70683 WP_000983393.1.70685 WP_000983393.1.70708 WP_000983393.1.70712 WP_000983393.1.70717 WP_000983393.1.70731 WP_000983393.1.70732 WP_000983393.1.70733 WP_000983393.1.70761 WP_000983393.1.70772 WP_000983393.1.70785 WP_000983393.1.70792 WP_000983393.1.70797 WP_000983393.1.70837 WP_000983393.1.70845 WP_000983393.1.70846 WP_000983393.1.70869 WP_000983393.1.70883 WP_000983393.1.70899 WP_000983393.1.70914 WP_000983393.1.70922 WP_000983393.1.70929 WP_000983393.1.7093 WP_000983393.1.70948 WP_000983393.1.70959 WP_000983393.1.70969 WP_000983393.1.70977 WP_000983393.1.70981 WP_000983393.1.70985 WP_000983393.1.70986 WP_000983393.1.70995 WP_000983393.1.71007 WP_000983393.1.71010 WP_000983393.1.71023 WP_000983393.1.71039 WP_000983393.1.71057 WP_000983393.1.71069 WP_000983393.1.71081 WP_000983393.1.71088 WP_000983393.1.7110 WP_000983393.1.71116 WP_000983393.1.71117 WP_000983393.1.71120 WP_000983393.1.71146 WP_000983393.1.71150 WP_000983393.1.71165 WP_000983393.1.71171 WP_000983393.1.71172 WP_000983393.1.71184 WP_000983393.1.71186 WP_000983393.1.71188 WP_000983393.1.71201 WP_000983393.1.71202 WP_000983393.1.71243 WP_000983393.1.71248 WP_000983393.1.71268 WP_000983393.1.71299 WP_000983393.1.71305 WP_000983393.1.71306 WP_000983393.1.71337 WP_000983393.1.7134 WP_000983393.1.71363 WP_000983393.1.71368 WP_000983393.1.71378 WP_000983393.1.714 WP_000983393.1.71401 WP_000983393.1.71407 WP_000983393.1.7142 WP_000983393.1.71446 WP_000983393.1.71450 WP_000983393.1.71452 WP_000983393.1.71455 WP_000983393.1.71456 WP_000983393.1.71481 WP_000983393.1.71487 WP_000983393.1.71500 WP_000983393.1.71523 WP_000983393.1.71542 WP_000983393.1.71566 WP_000983393.1.71583 WP_000983393.1.71600 WP_000983393.1.71626 WP_000983393.1.71636 WP_000983393.1.71640 WP_000983393.1.71649 WP_000983393.1.71651 WP_000983393.1.71653 WP_000983393.1.71656 WP_000983393.1.71667 WP_000983393.1.71691 WP_000983393.1.71702 WP_000983393.1.71716 WP_000983393.1.7174 WP_000983393.1.71746 WP_000983393.1.71750 WP_000983393.1.71756 WP_000983393.1.71798 WP_000983393.1.71845 WP_000983393.1.71848 WP_000983393.1.71872 WP_000983393.1.71881 WP_000983393.1.71908 WP_000983393.1.71923 WP_000983393.1.71929 WP_000983393.1.71941 WP_000983393.1.71950 WP_000983393.1.71952 WP_000983393.1.71954 WP_000983393.1.71973 WP_000983393.1.71979 WP_000983393.1.71984 WP_000983393.1.71985 WP_000983393.1.720 WP_000983393.1.72003 WP_000983393.1.72065 WP_000983393.1.72068 WP_000983393.1.72073 WP_000983393.1.72100 WP_000983393.1.72105 WP_000983393.1.72107 WP_000983393.1.72119 WP_000983393.1.72121 WP_000983393.1.72182 WP_000983393.1.72188 WP_000983393.1.72190 WP_000983393.1.72203 WP_000983393.1.72220 WP_000983393.1.72221 WP_000983393.1.72226 WP_000983393.1.72234 WP_000983393.1.72243 WP_000983393.1.72254 WP_000983393.1.72269 WP_000983393.1.72277 WP_000983393.1.72281 WP_000983393.1.72283 WP_000983393.1.72300 WP_000983393.1.72307 WP_000983393.1.72325 WP_000983393.1.72339 WP_000983393.1.72350 WP_000983393.1.72351 WP_000983393.1.72372 WP_000983393.1.72376 WP_000983393.1.72382 WP_000983393.1.72383 WP_000983393.1.72403 WP_000983393.1.72412 WP_000983393.1.7243 WP_000983393.1.72438 WP_000983393.1.72461 WP_000983393.1.72470 WP_000983393.1.72527 WP_000983393.1.72532 WP_000983393.1.7255 WP_000983393.1.72594 WP_000983393.1.72602 WP_000983393.1.72625 WP_000983393.1.72629 WP_000983393.1.72631 WP_000983393.1.72638 WP_000983393.1.72642 WP_000983393.1.72667 WP_000983393.1.72671 WP_000983393.1.72674 WP_000983393.1.72689 WP_000983393.1.72716 WP_000983393.1.72718 WP_000983393.1.72724 WP_000983393.1.72728 WP_000983393.1.72789 WP_000983393.1.72793 WP_000983393.1.72797 WP_000983393.1.72827 WP_000983393.1.72828 WP_000983393.1.72843 WP_000983393.1.72850 WP_000983393.1.72865 WP_000983393.1.72871 WP_000983393.1.72872 WP_000983393.1.72887 WP_000983393.1.72892 WP_000983393.1.72894 WP_000983393.1.72896 WP_000983393.1.72897 WP_000983393.1.72944 WP_000983393.1.72946 WP_000983393.1.7295 WP_000983393.1.72968 WP_000983393.1.72969 WP_000983393.1.72975 WP_000983393.1.72987 WP_000983393.1.73052 WP_000983393.1.73062 WP_000983393.1.73068 WP_000983393.1.73102 WP_000983393.1.7311 WP_000983393.1.73114 WP_000983393.1.73125 WP_000983393.1.73144 WP_000983393.1.7315 WP_000983393.1.7316 WP_000983393.1.73164 WP_000983393.1.73177 WP_000983393.1.73180 WP_000983393.1.73200 WP_000983393.1.73258 WP_000983393.1.73270 WP_000983393.1.73285 WP_000983393.1.7332 WP_000983393.1.73328 WP_000983393.1.7333 WP_000983393.1.7334 WP_000983393.1.73352 WP_000983393.1.73362 WP_000983393.1.73377 WP_000983393.1.73379 WP_000983393.1.73389 WP_000983393.1.7341 WP_000983393.1.73425 WP_000983393.1.73461 WP_000983393.1.73481 WP_000983393.1.73488 WP_000983393.1.73504 WP_000983393.1.73512 WP_000983393.1.7353 WP_000983393.1.73535 WP_000983393.1.73544 WP_000983393.1.7356 WP_000983393.1.73561 WP_000983393.1.73581 WP_000983393.1.73596 WP_000983393.1.73598 WP_000983393.1.7361 WP_000983393.1.73617 WP_000983393.1.73648 WP_000983393.1.73667 WP_000983393.1.73669 WP_000983393.1.73701 WP_000983393.1.73708 WP_000983393.1.7374 WP_000983393.1.73753 WP_000983393.1.73758 WP_000983393.1.73764 WP_000983393.1.73768 WP_000983393.1.73804 WP_000983393.1.73831 WP_000983393.1.73847 WP_000983393.1.73849 WP_000983393.1.7386 WP_000983393.1.7387 WP_000983393.1.73901 WP_000983393.1.73924 WP_000983393.1.73926 WP_000983393.1.73945 WP_000983393.1.73948 WP_000983393.1.73956 WP_000983393.1.73958 WP_000983393.1.73999 WP_000983393.1.74024 WP_000983393.1.74028 WP_000983393.1.74029 WP_000983393.1.74030 WP_000983393.1.74038 WP_000983393.1.74040 WP_000983393.1.74043 WP_000983393.1.74049 WP_000983393.1.74058 WP_000983393.1.74070 WP_000983393.1.74077 WP_000983393.1.74089 WP_000983393.1.74117 WP_000983393.1.74135 WP_000983393.1.74174 WP_000983393.1.74181 WP_000983393.1.74191 WP_000983393.1.74207 WP_000983393.1.74214 WP_000983393.1.74228 WP_000983393.1.74241 WP_000983393.1.74248 WP_000983393.1.74285 WP_000983393.1.743 WP_000983393.1.7430 WP_000983393.1.74300 WP_000983393.1.74317 WP_000983393.1.7433 WP_000983393.1.74379 WP_000983393.1.74402 WP_000983393.1.74410 WP_000983393.1.74414 WP_000983393.1.74415 WP_000983393.1.74418 WP_000983393.1.74422 WP_000983393.1.74428 WP_000983393.1.7444 WP_000983393.1.74454 WP_000983393.1.74466 WP_000983393.1.74469 WP_000983393.1.74481 WP_000983393.1.745 WP_000983393.1.74500 WP_000983393.1.74529 WP_000983393.1.74545 WP_000983393.1.74570 WP_000983393.1.74578 WP_000983393.1.7458 WP_000983393.1.74616 WP_000983393.1.74620 WP_000983393.1.74621 WP_000983393.1.74632 WP_000983393.1.74639 WP_000983393.1.74644 WP_000983393.1.74647 WP_000983393.1.74661 WP_000983393.1.74677 WP_000983393.1.74699 WP_000983393.1.74702 WP_000983393.1.74741 WP_000983393.1.74745 WP_000983393.1.74757 WP_000983393.1.74806 WP_000983393.1.74807 WP_000983393.1.74826 WP_000983393.1.74831 WP_000983393.1.74876 WP_000983393.1.74894 WP_000983393.1.7491 WP_000983393.1.74929 WP_000983393.1.74939 WP_000983393.1.74946 WP_000983393.1.74972 WP_000983393.1.74973 WP_000983393.1.74992 WP_000983393.1.74996 WP_000983393.1.75009 WP_000983393.1.75051 WP_000983393.1.75056 WP_000983393.1.75058 WP_000983393.1.7507 WP_000983393.1.75089 WP_000983393.1.75114 WP_000983393.1.75116 WP_000983393.1.75134 WP_000983393.1.75148 WP_000983393.1.75159 WP_000983393.1.75168 WP_000983393.1.75177 WP_000983393.1.75180 WP_000983393.1.75187 WP_000983393.1.75237 WP_000983393.1.75273 WP_000983393.1.75288 WP_000983393.1.75296 WP_000983393.1.75301 WP_000983393.1.7531 WP_000983393.1.75334 WP_000983393.1.75362 WP_000983393.1.75371 WP_000983393.1.75385 WP_000983393.1.75392 WP_000983393.1.75400 WP_000983393.1.75402 WP_000983393.1.75413 WP_000983393.1.7543 WP_000983393.1.75433 WP_000983393.1.75450 WP_000983393.1.75494 WP_000983393.1.75532 WP_000983393.1.75565 WP_000983393.1.7558 WP_000983393.1.75585 WP_000983393.1.75593 WP_000983393.1.75607 WP_000983393.1.75609 WP_000983393.1.75610 WP_000983393.1.75626 WP_000983393.1.75633 WP_000983393.1.75664 WP_000983393.1.75703 WP_000983393.1.75716 WP_000983393.1.75718 WP_000983393.1.75740 WP_000983393.1.75745 WP_000983393.1.75751 WP_000983393.1.75760 WP_000983393.1.75764 WP_000983393.1.75793 WP_000983393.1.75794 WP_000983393.1.75810 WP_000983393.1.75828 WP_000983393.1.75837 WP_000983393.1.75844 WP_000983393.1.75863 WP_000983393.1.75873 WP_000983393.1.75874 WP_000983393.1.75884 WP_000983393.1.75886 WP_000983393.1.75898 WP_000983393.1.75902 WP_000983393.1.75932 WP_000983393.1.75945 WP_000983393.1.75957 WP_000983393.1.76 WP_000983393.1.76020 WP_000983393.1.76024 WP_000983393.1.76055 WP_000983393.1.76081 WP_000983393.1.76097 WP_000983393.1.76102 WP_000983393.1.76108 WP_000983393.1.76115 WP_000983393.1.76116 WP_000983393.1.76122 WP_000983393.1.76137 WP_000983393.1.76156 WP_000983393.1.76162 WP_000983393.1.76164 WP_000983393.1.76170 WP_000983393.1.76186 WP_000983393.1.76197 WP_000983393.1.76208 WP_000983393.1.76252 WP_000983393.1.76256 WP_000983393.1.7629 WP_000983393.1.76301 WP_000983393.1.76327 WP_000983393.1.7633 WP_000983393.1.76339 WP_000983393.1.7634 WP_000983393.1.76345 WP_000983393.1.76364 WP_000983393.1.76366 WP_000983393.1.76417 WP_000983393.1.76434 WP_000983393.1.76445 WP_000983393.1.76451 WP_000983393.1.7646 WP_000983393.1.76471 WP_000983393.1.76495 WP_000983393.1.76510 WP_000983393.1.76529 WP_000983393.1.76532 WP_000983393.1.76548 WP_000983393.1.7655 WP_000983393.1.76558 WP_000983393.1.7657 WP_000983393.1.76572 WP_000983393.1.76576 WP_000983393.1.7660 WP_000983393.1.76611 WP_000983393.1.76641 WP_000983393.1.76651 WP_000983393.1.76653 WP_000983393.1.76673 WP_000983393.1.76706 WP_000983393.1.7672 WP_000983393.1.76721 WP_000983393.1.76724 WP_000983393.1.76738 WP_000983393.1.76756 WP_000983393.1.76760 WP_000983393.1.76776 WP_000983393.1.76788 WP_000983393.1.76799 WP_000983393.1.76806 WP_000983393.1.7684 WP_000983393.1.76854 WP_000983393.1.76866 WP_000983393.1.76875 WP_000983393.1.76880 WP_000983393.1.76899 WP_000983393.1.76913 WP_000983393.1.76916 WP_000983393.1.76932 WP_000983393.1.76968 WP_000983393.1.76973 WP_000983393.1.76988 WP_000983393.1.77016 WP_000983393.1.77017 WP_000983393.1.77033 WP_000983393.1.77038 WP_000983393.1.77047 WP_000983393.1.77067 WP_000983393.1.77080 WP_000983393.1.77087 WP_000983393.1.77090 WP_000983393.1.77111 WP_000983393.1.7712 WP_000983393.1.77177 WP_000983393.1.77180 WP_000983393.1.77184 WP_000983393.1.77193 WP_000983393.1.77241 WP_000983393.1.77244 WP_000983393.1.77267 WP_000983393.1.77271 WP_000983393.1.77292 WP_000983393.1.77299 WP_000983393.1.77306 WP_000983393.1.77313 WP_000983393.1.77349 WP_000983393.1.77356 WP_000983393.1.77384 WP_000983393.1.77390 WP_000983393.1.77414 WP_000983393.1.77431 WP_000983393.1.77436 WP_000983393.1.77440 WP_000983393.1.77475 WP_000983393.1.77496 WP_000983393.1.77501 WP_000983393.1.77512 WP_000983393.1.77513 WP_000983393.1.77514 WP_000983393.1.77529 WP_000983393.1.77543 WP_000983393.1.77549 WP_000983393.1.77555 WP_000983393.1.77563 WP_000983393.1.77565 WP_000983393.1.77575 WP_000983393.1.77596 WP_000983393.1.77629 WP_000983393.1.77646 WP_000983393.1.77692 WP_000983393.1.77702 WP_000983393.1.77710 WP_000983393.1.77713 WP_000983393.1.7772 WP_000983393.1.77729 WP_000983393.1.77754 WP_000983393.1.77761 WP_000983393.1.7782 WP_000983393.1.77825 WP_000983393.1.77837 WP_000983393.1.7784 WP_000983393.1.77846 WP_000983393.1.77851 WP_000983393.1.77871 WP_000983393.1.77898 WP_000983393.1.77900 WP_000983393.1.77918 WP_000983393.1.7792 WP_000983393.1.77923 WP_000983393.1.7793 WP_000983393.1.77951 WP_000983393.1.77960 WP_000983393.1.77971 WP_000983393.1.77975 WP_000983393.1.77983 WP_000983393.1.77987 WP_000983393.1.77989 WP_000983393.1.78 WP_000983393.1.78016 WP_000983393.1.7802 WP_000983393.1.78026 WP_000983393.1.78033 WP_000983393.1.78035 WP_000983393.1.78048 WP_000983393.1.78053 WP_000983393.1.78076 WP_000983393.1.78096 WP_000983393.1.78100 WP_000983393.1.78107 WP_000983393.1.78110 WP_000983393.1.78120 WP_000983393.1.7814 WP_000983393.1.78166 WP_000983393.1.78168 WP_000983393.1.78180 WP_000983393.1.78192 WP_000983393.1.78195 WP_000983393.1.78201 WP_000983393.1.78245 WP_000983393.1.78259 WP_000983393.1.78291 WP_000983393.1.78301 WP_000983393.1.78309 WP_000983393.1.78320 WP_000983393.1.78339 WP_000983393.1.78352 WP_000983393.1.78366 WP_000983393.1.78372 WP_000983393.1.78382 WP_000983393.1.78383 WP_000983393.1.78388 WP_000983393.1.78407 WP_000983393.1.78410 WP_000983393.1.78496 WP_000983393.1.78501 WP_000983393.1.78502 WP_000983393.1.78602 WP_000983393.1.78603 WP_000983393.1.7861 WP_000983393.1.78618 WP_000983393.1.7862 WP_000983393.1.78626 WP_000983393.1.78632 WP_000983393.1.78658 WP_000983393.1.78661 WP_000983393.1.78673 WP_000983393.1.78674 WP_000983393.1.78676 WP_000983393.1.78697 WP_000983393.1.78715 WP_000983393.1.78734 WP_000983393.1.78735 WP_000983393.1.78738 WP_000983393.1.78761 WP_000983393.1.7877 WP_000983393.1.78771 WP_000983393.1.78789 WP_000983393.1.78802 WP_000983393.1.78815 WP_000983393.1.78830 WP_000983393.1.78835 WP_000983393.1.78838 WP_000983393.1.78862 WP_000983393.1.78871 WP_000983393.1.78874 WP_000983393.1.78877 WP_000983393.1.78881 WP_000983393.1.78896 WP_000983393.1.789 WP_000983393.1.7891 WP_000983393.1.78913 WP_000983393.1.78918 WP_000983393.1.78928 WP_000983393.1.78930 WP_000983393.1.78951 WP_000983393.1.78959 WP_000983393.1.78993 WP_000983393.1.79011 WP_000983393.1.79012 WP_000983393.1.79032 WP_000983393.1.79069 WP_000983393.1.79074 WP_000983393.1.79081 WP_000983393.1.79098 WP_000983393.1.79099 WP_000983393.1.79140 WP_000983393.1.79151 WP_000983393.1.79155 WP_000983393.1.79164 WP_000983393.1.79167 WP_000983393.1.79189 WP_000983393.1.79203 WP_000983393.1.79204 WP_000983393.1.79235 WP_000983393.1.79280 WP_000983393.1.79289 WP_000983393.1.79297 WP_000983393.1.79302 WP_000983393.1.79335 WP_000983393.1.79370 WP_000983393.1.79397 WP_000983393.1.794 WP_000983393.1.79427 WP_000983393.1.79456 WP_000983393.1.79462 WP_000983393.1.79466 WP_000983393.1.79468 WP_000983393.1.79472 WP_000983393.1.79490 WP_000983393.1.79495 WP_000983393.1.79529 WP_000983393.1.79531 WP_000983393.1.79532 WP_000983393.1.79547 WP_000983393.1.7956 WP_000983393.1.79570 WP_000983393.1.79580 WP_000983393.1.79586 WP_000983393.1.7964 WP_000983393.1.79642 WP_000983393.1.79645 WP_000983393.1.79654 WP_000983393.1.79659 WP_000983393.1.79668 WP_000983393.1.7970 WP_000983393.1.79708 WP_000983393.1.7972 WP_000983393.1.79722 WP_000983393.1.79734 WP_000983393.1.79738 WP_000983393.1.79757 WP_000983393.1.79772 WP_000983393.1.79778 WP_000983393.1.7979 WP_000983393.1.7982 WP_000983393.1.79832 WP_000983393.1.79845 WP_000983393.1.79867 WP_000983393.1.79880 WP_000983393.1.79892 WP_000983393.1.7991 WP_000983393.1.79910 WP_000983393.1.79914 WP_000983393.1.79916 WP_000983393.1.79929 WP_000983393.1.79934 WP_000983393.1.7994 WP_000983393.1.79942 WP_000983393.1.79945 WP_000983393.1.79951 WP_000983393.1.79966 WP_000983393.1.79974 WP_000983393.1.79977 WP_000983393.1.79996 WP_000983393.1.80065 WP_000983393.1.80077 WP_000983393.1.80103 WP_000983393.1.80137 WP_000983393.1.80149 WP_000983393.1.80182 WP_000983393.1.80229 WP_000983393.1.8024 WP_000983393.1.80249 WP_000983393.1.80250 WP_000983393.1.80254 WP_000983393.1.80273 WP_000983393.1.80282 WP_000983393.1.80293 WP_000983393.1.80296 WP_000983393.1.80307 WP_000983393.1.80333 WP_000983393.1.80354 WP_000983393.1.80366 WP_000983393.1.80368 WP_000983393.1.80380 WP_000983393.1.80386 WP_000983393.1.80400 WP_000983393.1.80441 WP_000983393.1.80443 WP_000983393.1.80448 WP_000983393.1.80462 WP_000983393.1.80473 WP_000983393.1.80479 WP_000983393.1.80480 WP_000983393.1.8049 WP_000983393.1.80492 WP_000983393.1.80496 WP_000983393.1.80529 WP_000983393.1.80542 WP_000983393.1.80569 WP_000983393.1.80586 WP_000983393.1.80609 WP_000983393.1.80629 WP_000983393.1.80638 WP_000983393.1.80651 WP_000983393.1.80664 WP_000983393.1.80667 WP_000983393.1.80674 WP_000983393.1.80696 WP_000983393.1.80707 WP_000983393.1.80723 WP_000983393.1.80725 WP_000983393.1.80741 WP_000983393.1.80750 WP_000983393.1.80757 WP_000983393.1.80760 WP_000983393.1.80780 WP_000983393.1.80803 WP_000983393.1.80819 WP_000983393.1.80827 WP_000983393.1.80831 WP_000983393.1.80840 WP_000983393.1.80850 WP_000983393.1.80857 WP_000983393.1.80874 WP_000983393.1.80881 WP_000983393.1.80927 WP_000983393.1.80939 WP_000983393.1.8096 WP_000983393.1.80973 WP_000983393.1.80984 WP_000983393.1.81037 WP_000983393.1.81041 WP_000983393.1.8106 WP_000983393.1.81062 WP_000983393.1.81067 WP_000983393.1.81069 WP_000983393.1.81084 WP_000983393.1.81107 WP_000983393.1.81109 WP_000983393.1.81110 WP_000983393.1.81118 WP_000983393.1.81131 WP_000983393.1.81149 WP_000983393.1.81175 WP_000983393.1.81187 WP_000983393.1.8119 WP_000983393.1.81193 WP_000983393.1.81197 WP_000983393.1.81225 WP_000983393.1.81231 WP_000983393.1.81262 WP_000983393.1.81268 WP_000983393.1.81269 WP_000983393.1.8127 WP_000983393.1.81271 WP_000983393.1.8130 WP_000983393.1.81302 WP_000983393.1.81305 WP_000983393.1.8131 WP_000983393.1.81320 WP_000983393.1.81321 WP_000983393.1.81328 WP_000983393.1.81333 WP_000983393.1.8134 WP_000983393.1.81342 WP_000983393.1.81354 WP_000983393.1.81364 WP_000983393.1.81388 WP_000983393.1.81404 WP_000983393.1.81409 WP_000983393.1.81410 WP_000983393.1.81425 WP_000983393.1.81455 WP_000983393.1.81472 WP_000983393.1.81494 WP_000983393.1.81504 WP_000983393.1.81528 WP_000983393.1.81548 WP_000983393.1.81557 WP_000983393.1.81568 WP_000983393.1.81667 WP_000983393.1.81668 WP_000983393.1.81676 WP_000983393.1.8168 WP_000983393.1.81681 WP_000983393.1.8170 WP_000983393.1.81727 WP_000983393.1.81735 WP_000983393.1.81736 WP_000983393.1.81743 WP_000983393.1.81746 WP_000983393.1.81750 WP_000983393.1.81760 WP_000983393.1.81763 WP_000983393.1.81768 WP_000983393.1.81785 WP_000983393.1.81795 WP_000983393.1.81798 WP_000983393.1.81855 WP_000983393.1.81902 WP_000983393.1.81921 WP_000983393.1.81931 WP_000983393.1.81936 WP_000983393.1.81941 WP_000983393.1.81949 WP_000983393.1.8196 WP_000983393.1.81965 WP_000983393.1.81974 WP_000983393.1.81977 WP_000983393.1.81995 WP_000983393.1.82037 WP_000983393.1.82070 WP_000983393.1.82076 WP_000983393.1.82099 WP_000983393.1.82131 WP_000983393.1.82141 WP_000983393.1.82144 WP_000983393.1.82149 WP_000983393.1.82156 WP_000983393.1.8218 WP_000983393.1.82180 WP_000983393.1.82192 WP_000983393.1.82201 WP_000983393.1.82214 WP_000983393.1.82225 WP_000983393.1.82232 WP_000983393.1.82258 WP_000983393.1.82269 WP_000983393.1.82337 WP_000983393.1.82347 WP_000983393.1.82352 WP_000983393.1.8236 WP_000983393.1.82369 WP_000983393.1.82395 WP_000983393.1.8240 WP_000983393.1.82401 WP_000983393.1.82408 WP_000983393.1.82416 WP_000983393.1.8242 WP_000983393.1.82420 WP_000983393.1.82434 WP_000983393.1.82456 WP_000983393.1.82464 WP_000983393.1.82465 WP_000983393.1.8247 WP_000983393.1.82473 WP_000983393.1.82474 WP_000983393.1.82479 WP_000983393.1.82503 WP_000983393.1.82515 WP_000983393.1.82529 WP_000983393.1.82530 WP_000983393.1.82553 WP_000983393.1.82562 WP_000983393.1.82569 WP_000983393.1.82570 WP_000983393.1.82584 WP_000983393.1.82636 WP_000983393.1.82637 WP_000983393.1.82646 WP_000983393.1.82648 WP_000983393.1.82670 WP_000983393.1.82676 WP_000983393.1.82692 WP_000983393.1.82731 WP_000983393.1.82761 WP_000983393.1.82812 WP_000983393.1.8282 WP_000983393.1.82841 WP_000983393.1.82843 WP_000983393.1.82850 WP_000983393.1.82867 WP_000983393.1.82872 WP_000983393.1.82886 WP_000983393.1.82895 WP_000983393.1.82899 WP_000983393.1.82908 WP_000983393.1.82937 WP_000983393.1.8294 WP_000983393.1.82944 WP_000983393.1.82946 WP_000983393.1.82956 WP_000983393.1.82959 WP_000983393.1.82964 WP_000983393.1.82992 WP_000983393.1.83005 WP_000983393.1.83006 WP_000983393.1.83007 WP_000983393.1.8304 WP_000983393.1.83061 WP_000983393.1.83092 WP_000983393.1.83119 WP_000983393.1.83128 WP_000983393.1.83139 WP_000983393.1.83163 WP_000983393.1.83180 WP_000983393.1.83204 WP_000983393.1.8322 WP_000983393.1.83221 WP_000983393.1.83229 WP_000983393.1.83235 WP_000983393.1.83247 WP_000983393.1.83252 WP_000983393.1.83258 WP_000983393.1.83280 WP_000983393.1.83290 WP_000983393.1.83301 WP_000983393.1.83305 WP_000983393.1.83331 WP_000983393.1.83333 WP_000983393.1.83354 WP_000983393.1.83356 WP_000983393.1.83360 WP_000983393.1.83365 WP_000983393.1.83378 WP_000983393.1.83382 WP_000983393.1.83388 WP_000983393.1.83407 WP_000983393.1.83413 WP_000983393.1.83491 WP_000983393.1.83510 WP_000983393.1.83516 WP_000983393.1.83523 WP_000983393.1.8354 WP_000983393.1.83558 WP_000983393.1.83598 WP_000983393.1.83650 WP_000983393.1.83651 WP_000983393.1.83657 WP_000983393.1.83677 WP_000983393.1.83710 WP_000983393.1.83721 WP_000983393.1.83739 WP_000983393.1.8375 WP_000983393.1.83759 WP_000983393.1.83760 WP_000983393.1.83806 WP_000983393.1.83854 WP_000983393.1.83897 WP_000983393.1.83923 WP_000983393.1.83960 WP_000983393.1.83979 WP_000983393.1.8399 WP_000983393.1.83994 WP_000983393.1.83995 WP_000983393.1.84 WP_000983393.1.84000 WP_000983393.1.84001 WP_000983393.1.84011 WP_000983393.1.84031 WP_000983393.1.8406 WP_000983393.1.84075 WP_000983393.1.84076 WP_000983393.1.84077 WP_000983393.1.84083 WP_000983393.1.84086 WP_000983393.1.84100 WP_000983393.1.84103 WP_000983393.1.84106 WP_000983393.1.84110 WP_000983393.1.84115 WP_000983393.1.84127 WP_000983393.1.84150 WP_000983393.1.84154 WP_000983393.1.84168 WP_000983393.1.84179 WP_000983393.1.84198 WP_000983393.1.84205 WP_000983393.1.84209 WP_000983393.1.84229 WP_000983393.1.84230 WP_000983393.1.8425 WP_000983393.1.84252 WP_000983393.1.84283 WP_000983393.1.84291 WP_000983393.1.84300 WP_000983393.1.8431 WP_000983393.1.84325 WP_000983393.1.84345 WP_000983393.1.84355 WP_000983393.1.84369 WP_000983393.1.84373 WP_000983393.1.84392 WP_000983393.1.84397 WP_000983393.1.84401 WP_000983393.1.84403 WP_000983393.1.8441 WP_000983393.1.84435 WP_000983393.1.84459 WP_000983393.1.84461 WP_000983393.1.84475 WP_000983393.1.84497 WP_000983393.1.84515 WP_000983393.1.84523 WP_000983393.1.84532 WP_000983393.1.84551 WP_000983393.1.84554 WP_000983393.1.84567 WP_000983393.1.84572 WP_000983393.1.84598 WP_000983393.1.84631 WP_000983393.1.84644 WP_000983393.1.84659 WP_000983393.1.84683 WP_000983393.1.84693 WP_000983393.1.84711 WP_000983393.1.84721 WP_000983393.1.84727 WP_000983393.1.84744 WP_000983393.1.84745 WP_000983393.1.84773 WP_000983393.1.84814 WP_000983393.1.84872 WP_000983393.1.84876 WP_000983393.1.84879 WP_000983393.1.84899 WP_000983393.1.849 WP_000983393.1.84945 WP_000983393.1.84967 WP_000983393.1.8497 WP_000983393.1.84983 WP_000983393.1.850 WP_000983393.1.85004 WP_000983393.1.85014 WP_000983393.1.8502 WP_000983393.1.85031 WP_000983393.1.85039 WP_000983393.1.85040 WP_000983393.1.85079 WP_000983393.1.85094 WP_000983393.1.85120 WP_000983393.1.85126 WP_000983393.1.85134 WP_000983393.1.85147 WP_000983393.1.85153 WP_000983393.1.85178 WP_000983393.1.85180 WP_000983393.1.85190 WP_000983393.1.85192 WP_000983393.1.85217 WP_000983393.1.8526 WP_000983393.1.85271 WP_000983393.1.85273 WP_000983393.1.85301 WP_000983393.1.8533 WP_000983393.1.85338 WP_000983393.1.85339 WP_000983393.1.8537 WP_000983393.1.85408 WP_000983393.1.85433 WP_000983393.1.8545 WP_000983393.1.85456 WP_000983393.1.85469 WP_000983393.1.85481 WP_000983393.1.85483 WP_000983393.1.85511 WP_000983393.1.85512 WP_000983393.1.8552 WP_000983393.1.85541 WP_000983393.1.8556 WP_000983393.1.85568 WP_000983393.1.8557 WP_000983393.1.85606 WP_000983393.1.85615 WP_000983393.1.85617 WP_000983393.1.85635 WP_000983393.1.85646 WP_000983393.1.85654 WP_000983393.1.85663 WP_000983393.1.85665 WP_000983393.1.85669 WP_000983393.1.85671 WP_000983393.1.85672 WP_000983393.1.85675 WP_000983393.1.85688 WP_000983393.1.85703 WP_000983393.1.85723 WP_000983393.1.85728 WP_000983393.1.85742 WP_000983393.1.85746 WP_000983393.1.85759 WP_000983393.1.85777 WP_000983393.1.85780 WP_000983393.1.85784 WP_000983393.1.85797 WP_000983393.1.85811 WP_000983393.1.85854 WP_000983393.1.85855 WP_000983393.1.85864 WP_000983393.1.85886 WP_000983393.1.859 WP_000983393.1.85900 WP_000983393.1.85904 WP_000983393.1.8591 WP_000983393.1.85917 WP_000983393.1.8594 WP_000983393.1.85943 WP_000983393.1.85976 WP_000983393.1.85977 WP_000983393.1.85982 WP_000983393.1.860 WP_000983393.1.86007 WP_000983393.1.86010 WP_000983393.1.86017 WP_000983393.1.86043 WP_000983393.1.8605 WP_000983393.1.86084 WP_000983393.1.86092 WP_000983393.1.8610 WP_000983393.1.86120 WP_000983393.1.86126 WP_000983393.1.86138 WP_000983393.1.8614 WP_000983393.1.86156 WP_000983393.1.86157 WP_000983393.1.86159 WP_000983393.1.8616 WP_000983393.1.86173 WP_000983393.1.86206 WP_000983393.1.86224 WP_000983393.1.86240 WP_000983393.1.86259 WP_000983393.1.86284 WP_000983393.1.86285 WP_000983393.1.86306 WP_000983393.1.86310 WP_000983393.1.86316 WP_000983393.1.86323 WP_000983393.1.86335 WP_000983393.1.86342 WP_000983393.1.86347 WP_000983393.1.86356 WP_000983393.1.86380 WP_000983393.1.86389 WP_000983393.1.8640 WP_000983393.1.8642 WP_000983393.1.86426 WP_000983393.1.86442 WP_000983393.1.86450 WP_000983393.1.86453 WP_000983393.1.86466 WP_000983393.1.86469 WP_000983393.1.8647 WP_000983393.1.86489 WP_000983393.1.86514 WP_000983393.1.86530 WP_000983393.1.86580 WP_000983393.1.86588 WP_000983393.1.86593 WP_000983393.1.86601 WP_000983393.1.86610 WP_000983393.1.86634 WP_000983393.1.86656 WP_000983393.1.86658 WP_000983393.1.86661 WP_000983393.1.86663 WP_000983393.1.86676 WP_000983393.1.86699 WP_000983393.1.8671 WP_000983393.1.8672 WP_000983393.1.86735 WP_000983393.1.86744 WP_000983393.1.86770 WP_000983393.1.8678 WP_000983393.1.86794 WP_000983393.1.86800 WP_000983393.1.86807 WP_000983393.1.86810 WP_000983393.1.86811 WP_000983393.1.86815 WP_000983393.1.8684 WP_000983393.1.86860 WP_000983393.1.86895 WP_000983393.1.86902 WP_000983393.1.86906 WP_000983393.1.8691 WP_000983393.1.86915 WP_000983393.1.86921 WP_000983393.1.86945 WP_000983393.1.86982 WP_000983393.1.86989 WP_000983393.1.87023 WP_000983393.1.87034 WP_000983393.1.87038 WP_000983393.1.87041 WP_000983393.1.87051 WP_000983393.1.87095 WP_000983393.1.87136 WP_000983393.1.87143 WP_000983393.1.87148 WP_000983393.1.87155 WP_000983393.1.87187 WP_000983393.1.87219 WP_000983393.1.8722 WP_000983393.1.87220 WP_000983393.1.87258 WP_000983393.1.87265 WP_000983393.1.87276 WP_000983393.1.87282 WP_000983393.1.87283 WP_000983393.1.87293 WP_000983393.1.87323 WP_000983393.1.87346 WP_000983393.1.8736 WP_000983393.1.87365 WP_000983393.1.87370 WP_000983393.1.87376 WP_000983393.1.87420 WP_000983393.1.87460 WP_000983393.1.87484 WP_000983393.1.87493 WP_000983393.1.87500 WP_000983393.1.87528 WP_000983393.1.87552 WP_000983393.1.87560 WP_000983393.1.87583 WP_000983393.1.87584 WP_000983393.1.8760 WP_000983393.1.87600 WP_000983393.1.87609 WP_000983393.1.87612 WP_000983393.1.87615 WP_000983393.1.87618 WP_000983393.1.87626 WP_000983393.1.87651 WP_000983393.1.87653 WP_000983393.1.87659 WP_000983393.1.8767 WP_000983393.1.87687 WP_000983393.1.87695 WP_000983393.1.87698 WP_000983393.1.87706 WP_000983393.1.87712 WP_000983393.1.87739 WP_000983393.1.87741 WP_000983393.1.87742 WP_000983393.1.87760 WP_000983393.1.87779 WP_000983393.1.87813 WP_000983393.1.87852 WP_000983393.1.87875 WP_000983393.1.87891 WP_000983393.1.87899 WP_000983393.1.87905 WP_000983393.1.8792 WP_000983393.1.87933 WP_000983393.1.87936 WP_000983393.1.87945 WP_000983393.1.87949 WP_000983393.1.87999 WP_000983393.1.8800 WP_000983393.1.88014 WP_000983393.1.88019 WP_000983393.1.88025 WP_000983393.1.88026 WP_000983393.1.8805 WP_000983393.1.88052 WP_000983393.1.8806 WP_000983393.1.88073 WP_000983393.1.8809 WP_000983393.1.88092 WP_000983393.1.881 WP_000983393.1.88136 WP_000983393.1.88145 WP_000983393.1.88165 WP_000983393.1.88174 WP_000983393.1.88185 WP_000983393.1.88199 WP_000983393.1.88214 WP_000983393.1.88222 WP_000983393.1.88244 WP_000983393.1.88264 WP_000983393.1.88275 WP_000983393.1.88291 WP_000983393.1.88293 WP_000983393.1.88299 WP_000983393.1.88303 WP_000983393.1.88313 WP_000983393.1.88356 WP_000983393.1.88359 WP_000983393.1.8837 WP_000983393.1.88393 WP_000983393.1.88407 WP_000983393.1.88414 WP_000983393.1.88423 WP_000983393.1.88444 WP_000983393.1.88446 WP_000983393.1.88458 WP_000983393.1.88474 WP_000983393.1.88483 WP_000983393.1.8849 WP_000983393.1.88501 WP_000983393.1.88508 WP_000983393.1.88538 WP_000983393.1.88547 WP_000983393.1.88597 WP_000983393.1.886 WP_000983393.1.88609 WP_000983393.1.88620 WP_000983393.1.88624 WP_000983393.1.88647 WP_000983393.1.88648 WP_000983393.1.88651 WP_000983393.1.88675 WP_000983393.1.88683 WP_000983393.1.88692 WP_000983393.1.88698 WP_000983393.1.88703 WP_000983393.1.88707 WP_000983393.1.88727 WP_000983393.1.88731 WP_000983393.1.88762 WP_000983393.1.88772 WP_000983393.1.88776 WP_000983393.1.88792 WP_000983393.1.88817 WP_000983393.1.88845 WP_000983393.1.88850 WP_000983393.1.88854 WP_000983393.1.8889 WP_000983393.1.88892 WP_000983393.1.88894 WP_000983393.1.88902 WP_000983393.1.8891 WP_000983393.1.88942 WP_000983393.1.88957 WP_000983393.1.88966 WP_000983393.1.88967 WP_000983393.1.88968 WP_000983393.1.88970 WP_000983393.1.88980 WP_000983393.1.88981 WP_000983393.1.88982 WP_000983393.1.88995 WP_000983393.1.88998 WP_000983393.1.89008 WP_000983393.1.89054 WP_000983393.1.89114 WP_000983393.1.89116 WP_000983393.1.89119 WP_000983393.1.89120 WP_000983393.1.89138 WP_000983393.1.89174 WP_000983393.1.89177 WP_000983393.1.89182 WP_000983393.1.89188 WP_000983393.1.89215 WP_000983393.1.89221 WP_000983393.1.89291 WP_000983393.1.89298 WP_000983393.1.89304 WP_000983393.1.89308 WP_000983393.1.89311 WP_000983393.1.89314 WP_000983393.1.89328 WP_000983393.1.89332 WP_000983393.1.89343 WP_000983393.1.89354 WP_000983393.1.89355 WP_000983393.1.89362 WP_000983393.1.89395 WP_000983393.1.8940 WP_000983393.1.89408 WP_000983393.1.89425 WP_000983393.1.89449 WP_000983393.1.89452 WP_000983393.1.89462 WP_000983393.1.8947 WP_000983393.1.89503 WP_000983393.1.89512 WP_000983393.1.89527 WP_000983393.1.89570 WP_000983393.1.8958 WP_000983393.1.89580 WP_000983393.1.89591 WP_000983393.1.89604 WP_000983393.1.89606 WP_000983393.1.8961 WP_000983393.1.89612 WP_000983393.1.89622 WP_000983393.1.89632 WP_000983393.1.89634 WP_000983393.1.89647 WP_000983393.1.89657 WP_000983393.1.89659 WP_000983393.1.89668 WP_000983393.1.89680 WP_000983393.1.89706 WP_000983393.1.89713 WP_000983393.1.89733 WP_000983393.1.89746 WP_000983393.1.89764 WP_000983393.1.89765 WP_000983393.1.89777 WP_000983393.1.89789 WP_000983393.1.89796 WP_000983393.1.89804 WP_000983393.1.89815 WP_000983393.1.89817 WP_000983393.1.89832 WP_000983393.1.89845 WP_000983393.1.89870 WP_000983393.1.89888 WP_000983393.1.89902 WP_000983393.1.89911 WP_000983393.1.89914 WP_000983393.1.89940 WP_000983393.1.8995 WP_000983393.1.89952 WP_000983393.1.8996 WP_000983393.1.89965 WP_000983393.1.89975 WP_000983393.1.90007 WP_000983393.1.9002 WP_000983393.1.9003 WP_000983393.1.90033 WP_000983393.1.90084 WP_000983393.1.90097 WP_000983393.1.90108 WP_000983393.1.9011 WP_000983393.1.90196 WP_000983393.1.90211 WP_000983393.1.90220 WP_000983393.1.90240 WP_000983393.1.90248 WP_000983393.1.90252 WP_000983393.1.90274 WP_000983393.1.90280 WP_000983393.1.90293 WP_000983393.1.90311 WP_000983393.1.90330 WP_000983393.1.90338 WP_000983393.1.90348 WP_000983393.1.90363 WP_000983393.1.90365 WP_000983393.1.90409 WP_000983393.1.90417 WP_000983393.1.90421 WP_000983393.1.90428 WP_000983393.1.90440 WP_000983393.1.90453 WP_000983393.1.90458 WP_000983393.1.90472 WP_000983393.1.90489 WP_000983393.1.90513 WP_000983393.1.90521 WP_000983393.1.90522 WP_000983393.1.90540 WP_000983393.1.90557 WP_000983393.1.90563 WP_000983393.1.90566 WP_000983393.1.90582 WP_000983393.1.90585 WP_000983393.1.90620 WP_000983393.1.90625 WP_000983393.1.9064 WP_000983393.1.90641 WP_000983393.1.90686 WP_000983393.1.90701 WP_000983393.1.90713 WP_000983393.1.90734 WP_000983393.1.90748 WP_000983393.1.90759 WP_000983393.1.90792 WP_000983393.1.90794 WP_000983393.1.90796 WP_000983393.1.90811 WP_000983393.1.90814 WP_000983393.1.90859 WP_000983393.1.90866 WP_000983393.1.90876 WP_000983393.1.90878 WP_000983393.1.9089 WP_000983393.1.9091 WP_000983393.1.9093 WP_000983393.1.90959 WP_000983393.1.90973 WP_000983393.1.90983 WP_000983393.1.90984 WP_000983393.1.90991 WP_000983393.1.91003 WP_000983393.1.91023 WP_000983393.1.91042 WP_000983393.1.91049 WP_000983393.1.91056 WP_000983393.1.91067 WP_000983393.1.91069 WP_000983393.1.91107 WP_000983393.1.91156 WP_000983393.1.91164 WP_000983393.1.91179 WP_000983393.1.91189 WP_000983393.1.91205 WP_000983393.1.91215 WP_000983393.1.91239 WP_000983393.1.91278 WP_000983393.1.91282 WP_000983393.1.91291 WP_000983393.1.9131 WP_000983393.1.91312 WP_000983393.1.91313 WP_000983393.1.91331 WP_000983393.1.91334 WP_000983393.1.9135 WP_000983393.1.9137 WP_000983393.1.91372 WP_000983393.1.91381 WP_000983393.1.91424 WP_000983393.1.91453 WP_000983393.1.91459 WP_000983393.1.91470 WP_000983393.1.91473 WP_000983393.1.91474 WP_000983393.1.91493 WP_000983393.1.91505 WP_000983393.1.91506 WP_000983393.1.91512 WP_000983393.1.91524 WP_000983393.1.91557 WP_000983393.1.91564 WP_000983393.1.91579 WP_000983393.1.91580 WP_000983393.1.91597 WP_000983393.1.91621 WP_000983393.1.91625 WP_000983393.1.91628 WP_000983393.1.91655 WP_000983393.1.9166 WP_000983393.1.91702 WP_000983393.1.91715 WP_000983393.1.91724 WP_000983393.1.91732 WP_000983393.1.91736 WP_000983393.1.91742 WP_000983393.1.91772 WP_000983393.1.91776 WP_000983393.1.91788 WP_000983393.1.91795 WP_000983393.1.91806 WP_000983393.1.91864 WP_000983393.1.9187 WP_000983393.1.91870 WP_000983393.1.91880 WP_000983393.1.91898 WP_000983393.1.91903 WP_000983393.1.91904 WP_000983393.1.91914 WP_000983393.1.91974 WP_000983393.1.91984 WP_000983393.1.92013 WP_000983393.1.92018 WP_000983393.1.92039 WP_000983393.1.92047 WP_000983393.1.92060 WP_000983393.1.92067 WP_000983393.1.92068 WP_000983393.1.92082 WP_000983393.1.92087 WP_000983393.1.92093 WP_000983393.1.92098 WP_000983393.1.92099 WP_000983393.1.92108 WP_000983393.1.92122 WP_000983393.1.92129 WP_000983393.1.92149 WP_000983393.1.92156 WP_000983393.1.92165 WP_000983393.1.92171 WP_000983393.1.92172 WP_000983393.1.92183 WP_000983393.1.92208 WP_000983393.1.92213 WP_000983393.1.9222 WP_000983393.1.92240 WP_000983393.1.92243 WP_000983393.1.92268 WP_000983393.1.92270 WP_000983393.1.92299 WP_000983393.1.92310 WP_000983393.1.92318 WP_000983393.1.92327 WP_000983393.1.92375 WP_000983393.1.92394 WP_000983393.1.92399 WP_000983393.1.92408 WP_000983393.1.92411 WP_000983393.1.92439 WP_000983393.1.92443 WP_000983393.1.92452 WP_000983393.1.92470 WP_000983393.1.92477 WP_000983393.1.92482 WP_000983393.1.92529 WP_000983393.1.9253 WP_000983393.1.92531 WP_000983393.1.92545 WP_000983393.1.92557 WP_000983393.1.92562 WP_000983393.1.92570 WP_000983393.1.92575 WP_000983393.1.92588 WP_000983393.1.926 WP_000983393.1.92628 WP_000983393.1.92633 WP_000983393.1.92646 WP_000983393.1.92649 WP_000983393.1.92659 WP_000983393.1.92669 WP_000983393.1.92671 WP_000983393.1.92676 WP_000983393.1.92705 WP_000983393.1.9271 WP_000983393.1.92729 WP_000983393.1.92734 WP_000983393.1.92738 WP_000983393.1.92754 WP_000983393.1.92758 WP_000983393.1.92786 WP_000983393.1.92806 WP_000983393.1.92810 WP_000983393.1.92823 WP_000983393.1.92827 WP_000983393.1.92832 WP_000983393.1.92836 WP_000983393.1.92842 WP_000983393.1.92843 WP_000983393.1.92875 WP_000983393.1.92879 WP_000983393.1.92883 WP_000983393.1.92890 WP_000983393.1.92893 WP_000983393.1.92895 WP_000983393.1.92926 WP_000983393.1.92929 WP_000983393.1.92936 WP_000983393.1.92939 WP_000983393.1.92975 WP_000983393.1.92987 WP_000983393.1.92988 WP_000983393.1.93007 WP_000983393.1.93022 WP_000983393.1.93059 WP_000983393.1.93061 WP_000983393.1.93076 WP_000983393.1.93086 WP_000983393.1.93101 WP_000983393.1.93103 WP_000983393.1.93105 WP_000983393.1.93111 WP_000983393.1.93118 WP_000983393.1.93121 WP_000983393.1.93136 WP_000983393.1.93155 WP_000983393.1.93168 WP_000983393.1.93184 WP_000983393.1.93213 WP_000983393.1.93215 WP_000983393.1.93221 WP_000983393.1.93223 WP_000983393.1.93239 WP_000983393.1.93275 WP_000983393.1.93302 WP_000983393.1.93322 WP_000983393.1.93339 WP_000983393.1.93350 WP_000983393.1.9336 WP_000983393.1.93365 WP_000983393.1.93376 WP_000983393.1.93387 WP_000983393.1.93410 WP_000983393.1.93469 WP_000983393.1.93511 WP_000983393.1.93512 WP_000983393.1.93524 WP_000983393.1.93543 WP_000983393.1.93577 WP_000983393.1.93596 WP_000983393.1.93604 WP_000983393.1.93635 WP_000983393.1.93648 WP_000983393.1.93650 WP_000983393.1.93656 WP_000983393.1.93657 WP_000983393.1.93662 WP_000983393.1.93671 WP_000983393.1.93691 WP_000983393.1.937 WP_000983393.1.93705 WP_000983393.1.9374 WP_000983393.1.93741 WP_000983393.1.9375 WP_000983393.1.93754 WP_000983393.1.93761 WP_000983393.1.93767 WP_000983393.1.93780 WP_000983393.1.9380 WP_000983393.1.93803 WP_000983393.1.93804 WP_000983393.1.93809 WP_000983393.1.93828 WP_000983393.1.93837 WP_000983393.1.93842 WP_000983393.1.93843 WP_000983393.1.93875 WP_000983393.1.9389 WP_000983393.1.93909 WP_000983393.1.93919 WP_000983393.1.93937 WP_000983393.1.93938 WP_000983393.1.93956 WP_000983393.1.93984 WP_000983393.1.9399 WP_000983393.1.93994 WP_000983393.1.94017 WP_000983393.1.94039 WP_000983393.1.94056 WP_000983393.1.94064 WP_000983393.1.94070 WP_000983393.1.94071 WP_000983393.1.94072 WP_000983393.1.94079 WP_000983393.1.94097 WP_000983393.1.94107 WP_000983393.1.94132 WP_000983393.1.94142 WP_000983393.1.94162 WP_000983393.1.94167 WP_000983393.1.94168 WP_000983393.1.94181 WP_000983393.1.94198 WP_000983393.1.94215 WP_000983393.1.94303 WP_000983393.1.9432 WP_000983393.1.94352 WP_000983393.1.94354 WP_000983393.1.94365 WP_000983393.1.94379 WP_000983393.1.94380 WP_000983393.1.94383 WP_000983393.1.94390 WP_000983393.1.9440 WP_000983393.1.94412 WP_000983393.1.94415 WP_000983393.1.94458 WP_000983393.1.94473 WP_000983393.1.94492 WP_000983393.1.94510 WP_000983393.1.94527 WP_000983393.1.94557 WP_000983393.1.94565 WP_000983393.1.94573 WP_000983393.1.94579 WP_000983393.1.94584 WP_000983393.1.94586 WP_000983393.1.94588 WP_000983393.1.94593 WP_000983393.1.94598 WP_000983393.1.94622 WP_000983393.1.9463 WP_000983393.1.94649 WP_000983393.1.94650 WP_000983393.1.94655 WP_000983393.1.94659 WP_000983393.1.94662 WP_000983393.1.94669 WP_000983393.1.94670 WP_000983393.1.94674 WP_000983393.1.94700 WP_000983393.1.94717 WP_000983393.1.94722 WP_000983393.1.94745 WP_000983393.1.94782 WP_000983393.1.94785 WP_000983393.1.94796 WP_000983393.1.94798 WP_000983393.1.9481 WP_000983393.1.94815 WP_000983393.1.94817 WP_000983393.1.94820 WP_000983393.1.94835 WP_000983393.1.94849 WP_000983393.1.94850 WP_000983393.1.94851 WP_000983393.1.94862 WP_000983393.1.94864 WP_000983393.1.94947 WP_000983393.1.94952 WP_000983393.1.94959 WP_000983393.1.94967 WP_000983393.1.94971 WP_000983393.1.94982 WP_000983393.1.94983 WP_000983393.1.94986 WP_000983393.1.94987 WP_000983393.1.95006 WP_000983393.1.9503 WP_000983393.1.95051 WP_000983393.1.95055 WP_000983393.1.95076 WP_000983393.1.95085 WP_000983393.1.95094 WP_000983393.1.95099 WP_000983393.1.95121 WP_000983393.1.95133 WP_000983393.1.95136 WP_000983393.1.95152 WP_000983393.1.9516 WP_000983393.1.95165 WP_000983393.1.95171 WP_000983393.1.95235 WP_000983393.1.95239 WP_000983393.1.95246 WP_000983393.1.95248 WP_000983393.1.95249 WP_000983393.1.9525 WP_000983393.1.95255 WP_000983393.1.95265 WP_000983393.1.9527 WP_000983393.1.95277 WP_000983393.1.95282 WP_000983393.1.95289 WP_000983393.1.95298 WP_000983393.1.9530 WP_000983393.1.95320 WP_000983393.1.95338 WP_000983393.1.95388 WP_000983393.1.95404 WP_000983393.1.95412 WP_000983393.1.95434 WP_000983393.1.95447 WP_000983393.1.95456 WP_000983393.1.95465 WP_000983393.1.95530 WP_000983393.1.95546 WP_000983393.1.95547 WP_000983393.1.95558 WP_000983393.1.95590 WP_000983393.1.95607 WP_000983393.1.95623 WP_000983393.1.95625 WP_000983393.1.95630 WP_000983393.1.95641 WP_000983393.1.95656 WP_000983393.1.95670 WP_000983393.1.95675 WP_000983393.1.95691 WP_000983393.1.95701 WP_000983393.1.95703 WP_000983393.1.95716 WP_000983393.1.95729 WP_000983393.1.95744 WP_000983393.1.95757 WP_000983393.1.95776 WP_000983393.1.95803 WP_000983393.1.95805 WP_000983393.1.95826 WP_000983393.1.95840 WP_000983393.1.9586 WP_000983393.1.95866 WP_000983393.1.95884 WP_000983393.1.95890 WP_000983393.1.95901 WP_000983393.1.95906 WP_000983393.1.95911 WP_000983393.1.95939 WP_000983393.1.95940 WP_000983393.1.95963 WP_000983393.1.96004 WP_000983393.1.96025 WP_000983393.1.96042 WP_000983393.1.96044 WP_000983393.1.96045 WP_000983393.1.96054 WP_000983393.1.9609 WP_000983393.1.96094 WP_000983393.1.96107 WP_000983393.1.96127 WP_000983393.1.96139 WP_000983393.1.96141 WP_000983393.1.96144 WP_000983393.1.96162 WP_000983393.1.96172 WP_000983393.1.96188 WP_000983393.1.96190 WP_000983393.1.96203 WP_000983393.1.96211 WP_000983393.1.96212 WP_000983393.1.9624 WP_000983393.1.96260 WP_000983393.1.9627 WP_000983393.1.9628 WP_000983393.1.96317 WP_000983393.1.96319 WP_000983393.1.9633 WP_000983393.1.96335 WP_000983393.1.96340 WP_000983393.1.96343 WP_000983393.1.96348 WP_000983393.1.96349 WP_000983393.1.96359 WP_000983393.1.96380 WP_000983393.1.96404 WP_000983393.1.96429 WP_000983393.1.9644 WP_000983393.1.96469 WP_000983393.1.96490 WP_000983393.1.96497 WP_000983393.1.96500 WP_000983393.1.96521 WP_000983393.1.96533 WP_000983393.1.96537 WP_000983393.1.96539 WP_000983393.1.96552 WP_000983393.1.96555 WP_000983393.1.96563 WP_000983393.1.96584 WP_000983393.1.96588 WP_000983393.1.96590 WP_000983393.1.96600 WP_000983393.1.96610 WP_000983393.1.96625 WP_000983393.1.96635 WP_000983393.1.9664 WP_000983393.1.96640 WP_000983393.1.96642 WP_000983393.1.96662 WP_000983393.1.96675 WP_000983393.1.9670 WP_000983393.1.96721 WP_000983393.1.96731 WP_000983393.1.96732 WP_000983393.1.96735 WP_000983393.1.9674 WP_000983393.1.96750 WP_000983393.1.96758 WP_000983393.1.96761 WP_000983393.1.96771 WP_000983393.1.96792 WP_000983393.1.96798 WP_000983393.1.96801 WP_000983393.1.96803 WP_000983393.1.96810 WP_000983393.1.9686 WP_000983393.1.96876 WP_000983393.1.96890 WP_000983393.1.96902 WP_000983393.1.96917 WP_000983393.1.96925 WP_000983393.1.96938 WP_000983393.1.96946 WP_000983393.1.96957 WP_000983393.1.96978 WP_000983393.1.96993 WP_000983393.1.97005 WP_000983393.1.97015 WP_000983393.1.97026 WP_000983393.1.97028 WP_000983393.1.97043 WP_000983393.1.97047 WP_000983393.1.97079 WP_000983393.1.97089 WP_000983393.1.97103 WP_000983393.1.97109 WP_000983393.1.97143 WP_000983393.1.97145 WP_000983393.1.97154 WP_000983393.1.97184 WP_000983393.1.97185 WP_000983393.1.97190 WP_000983393.1.97224 WP_000983393.1.97260 WP_000983393.1.97287 WP_000983393.1.97291 WP_000983393.1.97297 WP_000983393.1.97318 WP_000983393.1.97322 WP_000983393.1.97328 WP_000983393.1.97337 WP_000983393.1.97368 WP_000983393.1.97369 WP_000983393.1.97386 WP_000983393.1.97413 WP_000983393.1.97422 WP_000983393.1.97441 WP_000983393.1.97477 WP_000983393.1.97480 WP_000983393.1.97487 WP_000983393.1.97496 WP_000983393.1.97497 WP_000983393.1.97505 WP_000983393.1.97534 WP_000983393.1.97547 WP_000983393.1.97594 WP_000983393.1.97597 WP_000983393.1.97599 WP_000983393.1.97606 WP_000983393.1.97613 WP_000983393.1.97615 WP_000983393.1.97620 WP_000983393.1.97626 WP_000983393.1.97628 WP_000983393.1.97631 WP_000983393.1.97640 WP_000983393.1.97646 WP_000983393.1.97648 WP_000983393.1.97656 WP_000983393.1.97690 WP_000983393.1.97691 WP_000983393.1.97693 WP_000983393.1.97704 WP_000983393.1.97725 WP_000983393.1.97726 WP_000983393.1.97727 WP_000983393.1.97732 WP_000983393.1.97736 WP_000983393.1.9774 WP_000983393.1.9775 WP_000983393.1.97768 WP_000983393.1.97772 WP_000983393.1.97800 WP_000983393.1.97819 WP_000983393.1.97840 WP_000983393.1.97846 WP_000983393.1.97873 WP_000983393.1.97907 WP_000983393.1.9793 WP_000983393.1.97938 WP_000983393.1.97981 WP_000983393.1.97983 WP_000983393.1.97986 WP_000983393.1.9799 WP_000983393.1.97991 WP_000983393.1.98006 WP_000983393.1.98019 WP_000983393.1.98022 WP_000983393.1.98036 WP_000983393.1.9805 WP_000983393.1.98080 WP_000983393.1.98086 WP_000983393.1.98107 WP_000983393.1.9811 WP_000983393.1.98110 WP_000983393.1.98119 WP_000983393.1.98124 WP_000983393.1.98146 WP_000983393.1.98158 WP_000983393.1.98170 WP_000983393.1.98201 WP_000983393.1.98219 WP_000983393.1.98236 WP_000983393.1.98250 WP_000983393.1.9826 WP_000983393.1.98263 WP_000983393.1.98314 WP_000983393.1.98338 WP_000983393.1.98392 WP_000983393.1.98402 WP_000983393.1.98403 WP_000983393.1.9841 WP_000983393.1.98418 WP_000983393.1.98438 WP_000983393.1.98440 WP_000983393.1.98446 WP_000983393.1.98448 WP_000983393.1.98457 WP_000983393.1.98472 WP_000983393.1.98483 WP_000983393.1.98495 WP_000983393.1.9850 WP_000983393.1.98502 WP_000983393.1.98513 WP_000983393.1.98531 WP_000983393.1.98551 WP_000983393.1.98570 WP_000983393.1.98577 WP_000983393.1.98607 WP_000983393.1.98608 WP_000983393.1.98627 WP_000983393.1.9863 WP_000983393.1.98634 WP_000983393.1.98676 WP_000983393.1.98677 WP_000983393.1.98726 WP_000983393.1.98731 WP_000983393.1.98751 WP_000983393.1.98760 WP_000983393.1.98762 WP_000983393.1.98763 WP_000983393.1.9877 WP_000983393.1.98779 WP_000983393.1.98801 WP_000983393.1.98818 WP_000983393.1.98843 WP_000983393.1.9887 WP_000983393.1.98899 WP_000983393.1.98931 WP_000983393.1.98947 WP_000983393.1.9898 WP_000983393.1.9899 WP_000983393.1.99040 WP_000983393.1.99057 WP_000983393.1.99071 WP_000983393.1.99072 WP_000983393.1.99073 WP_000983393.1.99083 WP_000983393.1.99097 WP_000983393.1.99098 WP_000983393.1.99107 WP_000983393.1.99163 WP_000983393.1.99164 WP_000983393.1.99184 WP_000983393.1.9919 WP_000983393.1.99197 WP_000983393.1.99198 WP_000983393.1.99215 WP_000983393.1.99219 WP_000983393.1.99255 WP_000983393.1.99267 WP_000983393.1.99276 WP_000983393.1.99278 WP_000983393.1.99327 WP_000983393.1.99335 WP_000983393.1.99339 WP_000983393.1.99350 WP_000983393.1.99360 WP_000983393.1.99363 WP_000983393.1.99369 WP_000983393.1.99370 WP_000983393.1.99388 WP_000983393.1.99397 WP_000983393.1.99456 WP_000983393.1.99463 WP_000983393.1.99469 WP_000983393.1.99483 WP_000983393.1.99490 WP_000983393.1.99493 WP_000983393.1.99531 WP_000983393.1.9954 WP_000983393.1.99546 WP_000983393.1.99561 WP_000983393.1.99577 WP_000983393.1.99579 WP_000983393.1.99595 WP_000983393.1.99613 WP_000983393.1.99626 WP_000983393.1.99630 WP_000983393.1.99637 WP_000983393.1.99646 WP_000983393.1.99657 WP_000983393.1.99660 WP_000983393.1.99671 WP_000983393.1.99676 WP_000983393.1.99712 WP_000983393.1.99725 WP_000983393.1.99747 WP_000983393.1.99764 WP_000983393.1.99783 WP_000983393.1.99813 WP_000983393.1.99824 WP_000983393.1.99829 WP_000983393.1.99837 WP_000983393.1.99841 WP_000983393.1.99858 WP_000983393.1.99889 WP_000983393.1.9992 WP_000983393.1.99924 WP_000983393.1.99958 WP_000983393.1.99961 WP_000983393.1.99996 gi|386591168|ref|YP_006087568.1| gi|194451325|ref|YP_002045323.1| gi|194445223|ref|YP_002040575.1| gi|525857451|ref|YP_008260506.1| gi|452120514|ref|YP_007470762.1| 209261.t1194 220341.STY1798 272994.SPAB_02025 321314.SC1336 423368.SNSL254_A1429 439843.SeSA_A1412 439851.SeD_A2029 454166.SeAg_B1856 454169.SeHA_C1444 476213.SPC_2415 99287.STM1315 gi|378954862|ref|YP_005212349.1| gi|161614280|ref|YP_001588245.1| gi|224584170|ref|YP_002637968.1| gi|529219553|ref|YP_008380556.1| gi|525817202|ref|YP_008247220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]