SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449862|ref|YP_005237221.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449862|ref|YP_005237221.1|
Domain Number 1 Region: 232-284
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000381
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 2 Region: 17-94
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000000236
Family TM1287-like 0.044
Further Details:      
 
Domain Number 3 Region: 181-230
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000166
Family AraC type transcriptional activator 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449862|ref|YP_005237221.1|
Sequence length 296
Comment putative transcriptional regulator [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MYQRCFDSAAETIFEQDKTPRFSRFVISDDPNWESGHHMHDNETELIYVKKGIARLIIDS
SLYVAHADDIVVVERGRLHAVASDSNSPATTYTCALYGFCFPGWEENQLLQSHSCPVVSV
VQGKGVIKSIFNELSVLLPQGKNVLASSVYDAFAYTLTALYYENFKNAYRSEQGYIKKDV
LIKDVLVYLNNNYREKITLDQLSKKFRASVSYICHEFAKEYHISPINYVIQRRMTEAKFA
LTNTESPLAEISWRVGYENVDHFAKLFMRHVGCSPNDYRKQFKNSLVEQAYLLPNT
Download sequence
Identical sequences A0A0D6GCI6 A0A0F6B0U7 A0A0F7J5W7 A0A0H3NCK5 A0A0U1GN36 A0A0W3L0P7 A0A2D3AP79 A0A2H9YHE2 E8XGG2 Q8ZPR7
NP_460321.1.58477 WP_000284836.1.100010 WP_000284836.1.100234 WP_000284836.1.100376 WP_000284836.1.100424 WP_000284836.1.100436 WP_000284836.1.100484 WP_000284836.1.100488 WP_000284836.1.100597 WP_000284836.1.10076 WP_000284836.1.100781 WP_000284836.1.100793 WP_000284836.1.100869 WP_000284836.1.100871 WP_000284836.1.100882 WP_000284836.1.101020 WP_000284836.1.101074 WP_000284836.1.101078 WP_000284836.1.101180 WP_000284836.1.101259 WP_000284836.1.101284 WP_000284836.1.101291 WP_000284836.1.101353 WP_000284836.1.101386 WP_000284836.1.101404 WP_000284836.1.101589 WP_000284836.1.101734 WP_000284836.1.101953 WP_000284836.1.10220 WP_000284836.1.10266 WP_000284836.1.10429 WP_000284836.1.10439 WP_000284836.1.10678 WP_000284836.1.10753 WP_000284836.1.10992 WP_000284836.1.11024 WP_000284836.1.11031 WP_000284836.1.11098 WP_000284836.1.11168 WP_000284836.1.11190 WP_000284836.1.11295 WP_000284836.1.11455 WP_000284836.1.11458 WP_000284836.1.11518 WP_000284836.1.11532 WP_000284836.1.11763 WP_000284836.1.11772 WP_000284836.1.11897 WP_000284836.1.12114 WP_000284836.1.12351 WP_000284836.1.12370 WP_000284836.1.12546 WP_000284836.1.1264 WP_000284836.1.12728 WP_000284836.1.12879 WP_000284836.1.12936 WP_000284836.1.12995 WP_000284836.1.13027 WP_000284836.1.13106 WP_000284836.1.13130 WP_000284836.1.13414 WP_000284836.1.13488 WP_000284836.1.13509 WP_000284836.1.13669 WP_000284836.1.13741 WP_000284836.1.13908 WP_000284836.1.13932 WP_000284836.1.13968 WP_000284836.1.14001 WP_000284836.1.14151 WP_000284836.1.14239 WP_000284836.1.14320 WP_000284836.1.14379 WP_000284836.1.14406 WP_000284836.1.14410 WP_000284836.1.14466 WP_000284836.1.14524 WP_000284836.1.14554 WP_000284836.1.14725 WP_000284836.1.14852 WP_000284836.1.1489 WP_000284836.1.14932 WP_000284836.1.15055 WP_000284836.1.15079 WP_000284836.1.15124 WP_000284836.1.15223 WP_000284836.1.15226 WP_000284836.1.15316 WP_000284836.1.1540 WP_000284836.1.15508 WP_000284836.1.15830 WP_000284836.1.15909 WP_000284836.1.16062 WP_000284836.1.16063 WP_000284836.1.16103 WP_000284836.1.16233 WP_000284836.1.16284 WP_000284836.1.16328 WP_000284836.1.1635 WP_000284836.1.16468 WP_000284836.1.16614 WP_000284836.1.16650 WP_000284836.1.16732 WP_000284836.1.16735 WP_000284836.1.16786 WP_000284836.1.16858 WP_000284836.1.16896 WP_000284836.1.16916 WP_000284836.1.16965 WP_000284836.1.1700 WP_000284836.1.17307 WP_000284836.1.174 WP_000284836.1.17480 WP_000284836.1.17546 WP_000284836.1.17702 WP_000284836.1.17705 WP_000284836.1.18019 WP_000284836.1.18111 WP_000284836.1.18163 WP_000284836.1.18265 WP_000284836.1.18267 WP_000284836.1.18282 WP_000284836.1.18468 WP_000284836.1.18607 WP_000284836.1.18715 WP_000284836.1.18776 WP_000284836.1.18822 WP_000284836.1.18881 WP_000284836.1.18940 WP_000284836.1.18949 WP_000284836.1.19053 WP_000284836.1.19320 WP_000284836.1.19458 WP_000284836.1.19460 WP_000284836.1.19461 WP_000284836.1.19614 WP_000284836.1.19702 WP_000284836.1.19706 WP_000284836.1.19724 WP_000284836.1.19749 WP_000284836.1.19784 WP_000284836.1.19802 WP_000284836.1.19809 WP_000284836.1.19867 WP_000284836.1.1998 WP_000284836.1.20 WP_000284836.1.2010 WP_000284836.1.20212 WP_000284836.1.20266 WP_000284836.1.20271 WP_000284836.1.20362 WP_000284836.1.20418 WP_000284836.1.20443 WP_000284836.1.20525 WP_000284836.1.2054 WP_000284836.1.20553 WP_000284836.1.20626 WP_000284836.1.20646 WP_000284836.1.20908 WP_000284836.1.21049 WP_000284836.1.21146 WP_000284836.1.21245 WP_000284836.1.21246 WP_000284836.1.21269 WP_000284836.1.21400 WP_000284836.1.21497 WP_000284836.1.21499 WP_000284836.1.21603 WP_000284836.1.21751 WP_000284836.1.21757 WP_000284836.1.22024 WP_000284836.1.2205 WP_000284836.1.22062 WP_000284836.1.22067 WP_000284836.1.2221 WP_000284836.1.2235 WP_000284836.1.22379 WP_000284836.1.22427 WP_000284836.1.2246 WP_000284836.1.22485 WP_000284836.1.22620 WP_000284836.1.22870 WP_000284836.1.22979 WP_000284836.1.23102 WP_000284836.1.23114 WP_000284836.1.2314 WP_000284836.1.23192 WP_000284836.1.23259 WP_000284836.1.23460 WP_000284836.1.23472 WP_000284836.1.23482 WP_000284836.1.23634 WP_000284836.1.2364 WP_000284836.1.23932 WP_000284836.1.24017 WP_000284836.1.24206 WP_000284836.1.24308 WP_000284836.1.24578 WP_000284836.1.24737 WP_000284836.1.24779 WP_000284836.1.25008 WP_000284836.1.25015 WP_000284836.1.25405 WP_000284836.1.25454 WP_000284836.1.25493 WP_000284836.1.25668 WP_000284836.1.25690 WP_000284836.1.2570 WP_000284836.1.25740 WP_000284836.1.25793 WP_000284836.1.25814 WP_000284836.1.25988 WP_000284836.1.26282 WP_000284836.1.26311 WP_000284836.1.26319 WP_000284836.1.26429 WP_000284836.1.26440 WP_000284836.1.26493 WP_000284836.1.26551 WP_000284836.1.26567 WP_000284836.1.27173 WP_000284836.1.27206 WP_000284836.1.27423 WP_000284836.1.27561 WP_000284836.1.2763 WP_000284836.1.27665 WP_000284836.1.27707 WP_000284836.1.27761 WP_000284836.1.27857 WP_000284836.1.28094 WP_000284836.1.28170 WP_000284836.1.28302 WP_000284836.1.2835 WP_000284836.1.28538 WP_000284836.1.28575 WP_000284836.1.28625 WP_000284836.1.28655 WP_000284836.1.28694 WP_000284836.1.2879 WP_000284836.1.2890 WP_000284836.1.28938 WP_000284836.1.28946 WP_000284836.1.29006 WP_000284836.1.29010 WP_000284836.1.2910 WP_000284836.1.29588 WP_000284836.1.29601 WP_000284836.1.29606 WP_000284836.1.29615 WP_000284836.1.29704 WP_000284836.1.29969 WP_000284836.1.30006 WP_000284836.1.30027 WP_000284836.1.30180 WP_000284836.1.30469 WP_000284836.1.30507 WP_000284836.1.30535 WP_000284836.1.30547 WP_000284836.1.30794 WP_000284836.1.30833 WP_000284836.1.30835 WP_000284836.1.30972 WP_000284836.1.31 WP_000284836.1.3113 WP_000284836.1.31185 WP_000284836.1.3119 WP_000284836.1.31190 WP_000284836.1.31195 WP_000284836.1.31196 WP_000284836.1.31281 WP_000284836.1.31504 WP_000284836.1.31515 WP_000284836.1.31578 WP_000284836.1.31658 WP_000284836.1.31940 WP_000284836.1.31967 WP_000284836.1.31972 WP_000284836.1.32192 WP_000284836.1.32206 WP_000284836.1.32438 WP_000284836.1.32515 WP_000284836.1.32660 WP_000284836.1.32702 WP_000284836.1.32714 WP_000284836.1.32786 WP_000284836.1.32804 WP_000284836.1.32907 WP_000284836.1.33030 WP_000284836.1.33127 WP_000284836.1.33143 WP_000284836.1.33248 WP_000284836.1.33261 WP_000284836.1.333 WP_000284836.1.33492 WP_000284836.1.33553 WP_000284836.1.33592 WP_000284836.1.33894 WP_000284836.1.34043 WP_000284836.1.34075 WP_000284836.1.34257 WP_000284836.1.34279 WP_000284836.1.34319 WP_000284836.1.34453 WP_000284836.1.34610 WP_000284836.1.34856 WP_000284836.1.34975 WP_000284836.1.35045 WP_000284836.1.35129 WP_000284836.1.35184 WP_000284836.1.35404 WP_000284836.1.35408 WP_000284836.1.35425 WP_000284836.1.35446 WP_000284836.1.35503 WP_000284836.1.35509 WP_000284836.1.35590 WP_000284836.1.35940 WP_000284836.1.36003 WP_000284836.1.3601 WP_000284836.1.36609 WP_000284836.1.36690 WP_000284836.1.3670 WP_000284836.1.36705 WP_000284836.1.36918 WP_000284836.1.36931 WP_000284836.1.37073 WP_000284836.1.37111 WP_000284836.1.37112 WP_000284836.1.37256 WP_000284836.1.37293 WP_000284836.1.37370 WP_000284836.1.37376 WP_000284836.1.3744 WP_000284836.1.37498 WP_000284836.1.37504 WP_000284836.1.37618 WP_000284836.1.37968 WP_000284836.1.37978 WP_000284836.1.38125 WP_000284836.1.38145 WP_000284836.1.383 WP_000284836.1.3848 WP_000284836.1.38613 WP_000284836.1.38673 WP_000284836.1.38693 WP_000284836.1.38773 WP_000284836.1.38882 WP_000284836.1.38913 WP_000284836.1.39003 WP_000284836.1.39136 WP_000284836.1.39229 WP_000284836.1.39405 WP_000284836.1.39420 WP_000284836.1.39449 WP_000284836.1.39512 WP_000284836.1.39629 WP_000284836.1.39763 WP_000284836.1.39862 WP_000284836.1.39923 WP_000284836.1.40017 WP_000284836.1.40072 WP_000284836.1.40073 WP_000284836.1.4011 WP_000284836.1.40208 WP_000284836.1.40240 WP_000284836.1.40257 WP_000284836.1.40292 WP_000284836.1.40305 WP_000284836.1.40311 WP_000284836.1.40380 WP_000284836.1.40395 WP_000284836.1.40465 WP_000284836.1.40710 WP_000284836.1.4087 WP_000284836.1.40877 WP_000284836.1.41017 WP_000284836.1.41086 WP_000284836.1.41091 WP_000284836.1.41226 WP_000284836.1.41279 WP_000284836.1.41516 WP_000284836.1.41554 WP_000284836.1.41572 WP_000284836.1.41591 WP_000284836.1.41662 WP_000284836.1.41708 WP_000284836.1.41761 WP_000284836.1.41882 WP_000284836.1.41979 WP_000284836.1.41985 WP_000284836.1.42104 WP_000284836.1.42320 WP_000284836.1.42342 WP_000284836.1.42422 WP_000284836.1.4276 WP_000284836.1.42864 WP_000284836.1.4288 WP_000284836.1.43018 WP_000284836.1.43041 WP_000284836.1.43244 WP_000284836.1.43312 WP_000284836.1.43334 WP_000284836.1.43437 WP_000284836.1.43522 WP_000284836.1.43613 WP_000284836.1.43668 WP_000284836.1.43886 WP_000284836.1.44005 WP_000284836.1.44043 WP_000284836.1.44099 WP_000284836.1.44121 WP_000284836.1.44310 WP_000284836.1.44479 WP_000284836.1.44640 WP_000284836.1.4467 WP_000284836.1.44747 WP_000284836.1.4485 WP_000284836.1.44877 WP_000284836.1.44927 WP_000284836.1.45067 WP_000284836.1.45074 WP_000284836.1.45079 WP_000284836.1.45098 WP_000284836.1.45177 WP_000284836.1.45184 WP_000284836.1.45259 WP_000284836.1.45344 WP_000284836.1.45349 WP_000284836.1.45365 WP_000284836.1.45550 WP_000284836.1.45585 WP_000284836.1.45660 WP_000284836.1.45690 WP_000284836.1.458 WP_000284836.1.46011 WP_000284836.1.46069 WP_000284836.1.46112 WP_000284836.1.46173 WP_000284836.1.46174 WP_000284836.1.46187 WP_000284836.1.46303 WP_000284836.1.46595 WP_000284836.1.46675 WP_000284836.1.47057 WP_000284836.1.47214 WP_000284836.1.47429 WP_000284836.1.47448 WP_000284836.1.4747 WP_000284836.1.47472 WP_000284836.1.47478 WP_000284836.1.47621 WP_000284836.1.47799 WP_000284836.1.47928 WP_000284836.1.48242 WP_000284836.1.48253 WP_000284836.1.48367 WP_000284836.1.48377 WP_000284836.1.4853 WP_000284836.1.48788 WP_000284836.1.4885 WP_000284836.1.48876 WP_000284836.1.48894 WP_000284836.1.48919 WP_000284836.1.49084 WP_000284836.1.49155 WP_000284836.1.49239 WP_000284836.1.49256 WP_000284836.1.49290 WP_000284836.1.49340 WP_000284836.1.49366 WP_000284836.1.49490 WP_000284836.1.49515 WP_000284836.1.49572 WP_000284836.1.4979 WP_000284836.1.49803 WP_000284836.1.49805 WP_000284836.1.49929 WP_000284836.1.50080 WP_000284836.1.50161 WP_000284836.1.50211 WP_000284836.1.50376 WP_000284836.1.50389 WP_000284836.1.50676 WP_000284836.1.50774 WP_000284836.1.50804 WP_000284836.1.50808 WP_000284836.1.5088 WP_000284836.1.50908 WP_000284836.1.50941 WP_000284836.1.51014 WP_000284836.1.51022 WP_000284836.1.51179 WP_000284836.1.51182 WP_000284836.1.51186 WP_000284836.1.51394 WP_000284836.1.51487 WP_000284836.1.51488 WP_000284836.1.51634 WP_000284836.1.51649 WP_000284836.1.51686 WP_000284836.1.51756 WP_000284836.1.51911 WP_000284836.1.51932 WP_000284836.1.51989 WP_000284836.1.52121 WP_000284836.1.52353 WP_000284836.1.52361 WP_000284836.1.52653 WP_000284836.1.52656 WP_000284836.1.52743 WP_000284836.1.52857 WP_000284836.1.52898 WP_000284836.1.52915 WP_000284836.1.53190 WP_000284836.1.53406 WP_000284836.1.53466 WP_000284836.1.53529 WP_000284836.1.53543 WP_000284836.1.53757 WP_000284836.1.53812 WP_000284836.1.54033 WP_000284836.1.54075 WP_000284836.1.54196 WP_000284836.1.54209 WP_000284836.1.54271 WP_000284836.1.54274 WP_000284836.1.54319 WP_000284836.1.54364 WP_000284836.1.54400 WP_000284836.1.54644 WP_000284836.1.54662 WP_000284836.1.54722 WP_000284836.1.54749 WP_000284836.1.54764 WP_000284836.1.55008 WP_000284836.1.55152 WP_000284836.1.55156 WP_000284836.1.55285 WP_000284836.1.55475 WP_000284836.1.55647 WP_000284836.1.55743 WP_000284836.1.55768 WP_000284836.1.55782 WP_000284836.1.55796 WP_000284836.1.56002 WP_000284836.1.56012 WP_000284836.1.56105 WP_000284836.1.56238 WP_000284836.1.56304 WP_000284836.1.56414 WP_000284836.1.56438 WP_000284836.1.56560 WP_000284836.1.56597 WP_000284836.1.56601 WP_000284836.1.56614 WP_000284836.1.56671 WP_000284836.1.56682 WP_000284836.1.56875 WP_000284836.1.56877 WP_000284836.1.57168 WP_000284836.1.57187 WP_000284836.1.57377 WP_000284836.1.57418 WP_000284836.1.57433 WP_000284836.1.57515 WP_000284836.1.57529 WP_000284836.1.57576 WP_000284836.1.57601 WP_000284836.1.57607 WP_000284836.1.57763 WP_000284836.1.57890 WP_000284836.1.57891 WP_000284836.1.57978 WP_000284836.1.5801 WP_000284836.1.58041 WP_000284836.1.58418 WP_000284836.1.58548 WP_000284836.1.5858 WP_000284836.1.58662 WP_000284836.1.58669 WP_000284836.1.58745 WP_000284836.1.58803 WP_000284836.1.5886 WP_000284836.1.59094 WP_000284836.1.59224 WP_000284836.1.59321 WP_000284836.1.59375 WP_000284836.1.59458 WP_000284836.1.59490 WP_000284836.1.59508 WP_000284836.1.59684 WP_000284836.1.59694 WP_000284836.1.59771 WP_000284836.1.5979 WP_000284836.1.59953 WP_000284836.1.60008 WP_000284836.1.60021 WP_000284836.1.60052 WP_000284836.1.60069 WP_000284836.1.60140 WP_000284836.1.60155 WP_000284836.1.60285 WP_000284836.1.60379 WP_000284836.1.60464 WP_000284836.1.60874 WP_000284836.1.60941 WP_000284836.1.61078 WP_000284836.1.6114 WP_000284836.1.61232 WP_000284836.1.6129 WP_000284836.1.61345 WP_000284836.1.61417 WP_000284836.1.61574 WP_000284836.1.61712 WP_000284836.1.61714 WP_000284836.1.61730 WP_000284836.1.61857 WP_000284836.1.61918 WP_000284836.1.61952 WP_000284836.1.62007 WP_000284836.1.62025 WP_000284836.1.62204 WP_000284836.1.62304 WP_000284836.1.62364 WP_000284836.1.62374 WP_000284836.1.62403 WP_000284836.1.6253 WP_000284836.1.62903 WP_000284836.1.62955 WP_000284836.1.63181 WP_000284836.1.63203 WP_000284836.1.63256 WP_000284836.1.63290 WP_000284836.1.63382 WP_000284836.1.63432 WP_000284836.1.63461 WP_000284836.1.63479 WP_000284836.1.63577 WP_000284836.1.63718 WP_000284836.1.6375 WP_000284836.1.63757 WP_000284836.1.63834 WP_000284836.1.64046 WP_000284836.1.6423 WP_000284836.1.64244 WP_000284836.1.64403 WP_000284836.1.64649 WP_000284836.1.64702 WP_000284836.1.64757 WP_000284836.1.64781 WP_000284836.1.64831 WP_000284836.1.6489 WP_000284836.1.65018 WP_000284836.1.65028 WP_000284836.1.65171 WP_000284836.1.65248 WP_000284836.1.6535 WP_000284836.1.65474 WP_000284836.1.65633 WP_000284836.1.6565 WP_000284836.1.65696 WP_000284836.1.6575 WP_000284836.1.65782 WP_000284836.1.6630 WP_000284836.1.66314 WP_000284836.1.66358 WP_000284836.1.66362 WP_000284836.1.6638 WP_000284836.1.6640 WP_000284836.1.66698 WP_000284836.1.66834 WP_000284836.1.66901 WP_000284836.1.67037 WP_000284836.1.67045 WP_000284836.1.67181 WP_000284836.1.67268 WP_000284836.1.67347 WP_000284836.1.67465 WP_000284836.1.67552 WP_000284836.1.67682 WP_000284836.1.67829 WP_000284836.1.67887 WP_000284836.1.68201 WP_000284836.1.68206 WP_000284836.1.6827 WP_000284836.1.68275 WP_000284836.1.6849 WP_000284836.1.68547 WP_000284836.1.68589 WP_000284836.1.68655 WP_000284836.1.68656 WP_000284836.1.68778 WP_000284836.1.68787 WP_000284836.1.68894 WP_000284836.1.68928 WP_000284836.1.68975 WP_000284836.1.69006 WP_000284836.1.6913 WP_000284836.1.69146 WP_000284836.1.69255 WP_000284836.1.69320 WP_000284836.1.69397 WP_000284836.1.69564 WP_000284836.1.69644 WP_000284836.1.69704 WP_000284836.1.69754 WP_000284836.1.7021 WP_000284836.1.70241 WP_000284836.1.70269 WP_000284836.1.70289 WP_000284836.1.70447 WP_000284836.1.70643 WP_000284836.1.70683 WP_000284836.1.70883 WP_000284836.1.70922 WP_000284836.1.70948 WP_000284836.1.71116 WP_000284836.1.71146 WP_000284836.1.71165 WP_000284836.1.71188 WP_000284836.1.71202 WP_000284836.1.71243 WP_000284836.1.71306 WP_000284836.1.71337 WP_000284836.1.71378 WP_000284836.1.71401 WP_000284836.1.71702 WP_000284836.1.71750 WP_000284836.1.71881 WP_000284836.1.71908 WP_000284836.1.71952 WP_000284836.1.71973 WP_000284836.1.72105 WP_000284836.1.72203 WP_000284836.1.72376 WP_000284836.1.72594 WP_000284836.1.72871 WP_000284836.1.72975 WP_000284836.1.7315 WP_000284836.1.73200 WP_000284836.1.7334 WP_000284836.1.73377 WP_000284836.1.73481 WP_000284836.1.7356 WP_000284836.1.73581 WP_000284836.1.73617 WP_000284836.1.73753 WP_000284836.1.73758 WP_000284836.1.73794 WP_000284836.1.7387 WP_000284836.1.74181 WP_000284836.1.74191 WP_000284836.1.7433 WP_000284836.1.74379 WP_000284836.1.74410 WP_000284836.1.74466 WP_000284836.1.74529 WP_000284836.1.74545 WP_000284836.1.74745 WP_000284836.1.75129 WP_000284836.1.75187 WP_000284836.1.75288 WP_000284836.1.75334 WP_000284836.1.75362 WP_000284836.1.75385 WP_000284836.1.75392 WP_000284836.1.75760 WP_000284836.1.75764 WP_000284836.1.75837 WP_000284836.1.75874 WP_000284836.1.75945 WP_000284836.1.76020 WP_000284836.1.76252 WP_000284836.1.76445 WP_000284836.1.7660 WP_000284836.1.76673 WP_000284836.1.76706 WP_000284836.1.76721 WP_000284836.1.76756 WP_000284836.1.76760 WP_000284836.1.76875 WP_000284836.1.76880 WP_000284836.1.76899 WP_000284836.1.77038 WP_000284836.1.77047 WP_000284836.1.77080 WP_000284836.1.7712 WP_000284836.1.77180 WP_000284836.1.77244 WP_000284836.1.77292 WP_000284836.1.77349 WP_000284836.1.77514 WP_000284836.1.77529 WP_000284836.1.77549 WP_000284836.1.77692 WP_000284836.1.7782 WP_000284836.1.77898 WP_000284836.1.77918 WP_000284836.1.77960 WP_000284836.1.78033 WP_000284836.1.78076 WP_000284836.1.78096 WP_000284836.1.78100 WP_000284836.1.78110 WP_000284836.1.78120 WP_000284836.1.78383 WP_000284836.1.78407 WP_000284836.1.7861 WP_000284836.1.78618 WP_000284836.1.78673 WP_000284836.1.78735 WP_000284836.1.78802 WP_000284836.1.78830 WP_000284836.1.78835 WP_000284836.1.78874 WP_000284836.1.78918 WP_000284836.1.78930 WP_000284836.1.79151 WP_000284836.1.79167 WP_000284836.1.79335 WP_000284836.1.79462 WP_000284836.1.79472 WP_000284836.1.79490 WP_000284836.1.79495 WP_000284836.1.79529 WP_000284836.1.79570 WP_000284836.1.7964 WP_000284836.1.79659 WP_000284836.1.79668 WP_000284836.1.79708 WP_000284836.1.79845 WP_000284836.1.80077 WP_000284836.1.80137 WP_000284836.1.80182 WP_000284836.1.80296 WP_000284836.1.80366 WP_000284836.1.80831 WP_000284836.1.80850 WP_000284836.1.80881 WP_000284836.1.80939 WP_000284836.1.8096 WP_000284836.1.81037 WP_000284836.1.81149 WP_000284836.1.81175 WP_000284836.1.8119 WP_000284836.1.81193 WP_000284836.1.81354 WP_000284836.1.81425 WP_000284836.1.81750 WP_000284836.1.81785 WP_000284836.1.81902 WP_000284836.1.81974 WP_000284836.1.82337 WP_000284836.1.82479 WP_000284836.1.82503 WP_000284836.1.82515 WP_000284836.1.82584 WP_000284836.1.82676 WP_000284836.1.82761 WP_000284836.1.8282 WP_000284836.1.82944 WP_000284836.1.82956 WP_000284836.1.83092 WP_000284836.1.83163 WP_000284836.1.83305 WP_000284836.1.83413 WP_000284836.1.83491 WP_000284836.1.83523 WP_000284836.1.8354 WP_000284836.1.83721 WP_000284836.1.83760 WP_000284836.1.83995 WP_000284836.1.84103 WP_000284836.1.84283 WP_000284836.1.84392 WP_000284836.1.8441 WP_000284836.1.84532 WP_000284836.1.84554 WP_000284836.1.84659 WP_000284836.1.84899 WP_000284836.1.8497 WP_000284836.1.85178 WP_000284836.1.85180 WP_000284836.1.85190 WP_000284836.1.85481 WP_000284836.1.85483 WP_000284836.1.8556 WP_000284836.1.85615 WP_000284836.1.85617 WP_000284836.1.85663 WP_000284836.1.85671 WP_000284836.1.85672 WP_000284836.1.85886 WP_000284836.1.85900 WP_000284836.1.85904 WP_000284836.1.85976 WP_000284836.1.86306 WP_000284836.1.86356 WP_000284836.1.86450 WP_000284836.1.86469 WP_000284836.1.86580 WP_000284836.1.86588 WP_000284836.1.86661 WP_000284836.1.8678 WP_000284836.1.86810 WP_000284836.1.8684 WP_000284836.1.86895 WP_000284836.1.86906 WP_000284836.1.87095 WP_000284836.1.87323 WP_000284836.1.8736 WP_000284836.1.87552 WP_000284836.1.87779 WP_000284836.1.87945 WP_000284836.1.88019 WP_000284836.1.88073 WP_000284836.1.8809 WP_000284836.1.88291 WP_000284836.1.88293 WP_000284836.1.8837 WP_000284836.1.88393 WP_000284836.1.88792 WP_000284836.1.88902 WP_000284836.1.8891 WP_000284836.1.88981 WP_000284836.1.89008 WP_000284836.1.89116 WP_000284836.1.89138 WP_000284836.1.89304 WP_000284836.1.89512 WP_000284836.1.89527 WP_000284836.1.89570 WP_000284836.1.89604 WP_000284836.1.89622 WP_000284836.1.89902 WP_000284836.1.8996 WP_000284836.1.90097 WP_000284836.1.90252 WP_000284836.1.90417 WP_000284836.1.90453 WP_000284836.1.90458 WP_000284836.1.90557 WP_000284836.1.90641 WP_000284836.1.90734 WP_000284836.1.91003 WP_000284836.1.91278 WP_000284836.1.91512 WP_000284836.1.91564 WP_000284836.1.91628 WP_000284836.1.91655 WP_000284836.1.91724 WP_000284836.1.91732 WP_000284836.1.91788 WP_000284836.1.92013 WP_000284836.1.92093 WP_000284836.1.92108 WP_000284836.1.92183 WP_000284836.1.92208 WP_000284836.1.92268 WP_000284836.1.92310 WP_000284836.1.92443 WP_000284836.1.92482 WP_000284836.1.92531 WP_000284836.1.92671 WP_000284836.1.92738 WP_000284836.1.93086 WP_000284836.1.93136 WP_000284836.1.93155 WP_000284836.1.93365 WP_000284836.1.93543 WP_000284836.1.93650 WP_000284836.1.93656 WP_000284836.1.93662 WP_000284836.1.937 WP_000284836.1.93705 WP_000284836.1.93804 WP_000284836.1.9389 WP_000284836.1.93994 WP_000284836.1.94162 WP_000284836.1.94168 WP_000284836.1.94198 WP_000284836.1.9432 WP_000284836.1.94354 WP_000284836.1.94380 WP_000284836.1.94458 WP_000284836.1.94565 WP_000284836.1.94584 WP_000284836.1.94674 WP_000284836.1.94796 WP_000284836.1.94959 WP_000284836.1.95051 WP_000284836.1.95085 WP_000284836.1.95121 WP_000284836.1.95282 WP_000284836.1.95546 WP_000284836.1.95630 WP_000284836.1.95911 WP_000284836.1.96317 WP_000284836.1.96343 WP_000284836.1.9644 WP_000284836.1.96469 WP_000284836.1.96500 WP_000284836.1.96555 WP_000284836.1.96563 WP_000284836.1.96732 WP_000284836.1.96771 WP_000284836.1.97015 WP_000284836.1.97145 WP_000284836.1.97190 WP_000284836.1.97318 WP_000284836.1.97369 WP_000284836.1.97594 WP_000284836.1.97613 WP_000284836.1.97620 WP_000284836.1.97727 WP_000284836.1.97732 WP_000284836.1.97736 WP_000284836.1.9775 WP_000284836.1.97846 WP_000284836.1.98006 WP_000284836.1.98019 WP_000284836.1.98110 WP_000284836.1.98146 WP_000284836.1.98219 WP_000284836.1.9841 WP_000284836.1.98495 WP_000284836.1.98531 WP_000284836.1.98577 WP_000284836.1.98676 WP_000284836.1.98677 WP_000284836.1.98760 WP_000284836.1.98843 WP_000284836.1.9898 WP_000284836.1.99098 WP_000284836.1.99184 WP_000284836.1.99267 WP_000284836.1.99276 WP_000284836.1.99646 WP_000284836.1.99657 WP_000284836.1.99660 WP_000284836.1.99712 WP_000284836.1.99813 WP_000284836.1.99858 WP_000284836.1.99889 WP_000284836.1.99958 gi|482903165|ref|YP_007901725.1| gi|379700528|ref|YP_005242256.1| 391493 APC24431 gi|378983913|ref|YP_005247068.1| gi|378699244|ref|YP_005181201.1| gi|378444785|ref|YP_005232417.1| 99287.STM1355 gi|526220043|ref|YP_008265555.1| gi|16764706|ref|NP_460321.1| gi|549723993|ref|YP_008644183.1| gi|383496068|ref|YP_005396757.1| ABAM02000001|CDS_1895628-1896518 ABAO01000038|CDS_20766-21656 AE006468|CDS_1435737-1436627 CP001363|CDS_1445713-1446603 FN424405|CDS_1432249-1433139 gi|525838411|ref|YP_008255446.1| gi|378449862|ref|YP_005237221.1| gi|550900724|ref|YP_008669816.1| gi|378988696|ref|YP_005251860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]