SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449945|ref|YP_005237304.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449945|ref|YP_005237304.1|
Domain Number 1 Region: 13-207
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.2e-55
Family DnaQ-like 3'-5' exonuclease 0.000000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378449945|ref|YP_005237304.1|
Sequence length 215
Comment ribonuclease T [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSDNAQLSGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDMTLHF
HVEPFAGANLQPEALAFNGIDPSNPLRGAVSEYEALHAIFKMVRKGIKDSGCSRAIMVAH
NATFDHSFMMAAAERASLKRNPFHPFVTFDTAALSGLALGQTVLSKACLAAGMEFDGEKA
HSALYDTERTAVLFCEIVNRWKRLGGWPLPLPTDK
Download sequence
Identical sequences A0A0F6B126 A0A0F7J8D2 A0A0H3NCS9 A0A0L9F5K0 A0A0M0QS46 A0A0M2IU43 A0A0N1QZJ5 A0A0T7RNH1 A0A0U1JN48 A0A1S0ZLC6 A0A1X2V496 A0A221YKF0 A0A265B692 A0A267S8B2 A0A271CIK0 A0A2D1Y629 A0A2D3API3 A0A2G1PBD6 A0A2H9YHM1 A0A2I6MZX2 A0A2K3A2Y7 B5F6L3 E8XHC7 G4C688 G5LP94 G5MIW8 G5PNM0 G5QJG2 G5RVT0 G5SCA8 P66684 P66685 Q5PH07 S5HTB4 V1XPY6 V7IRR4 V7UZR1
gi|378449945|ref|YP_005237304.1| gi|197251543|ref|YP_002146611.1| gi|29141761|ref|NP_805103.1| gi|538362014|ref|YP_008505299.1| gi|550900798|ref|YP_008669890.1| gi|197362521|ref|YP_002142158.1| 209261.t1302 220341.STY1688 295319.SPA1419 439843.SeSA_A1531 454166.SeAg_B1740 454169.SeHA_C1604 554290.SSPA1319 99287.STM1434 gi|379700605|ref|YP_005242333.1| gi|482903242|ref|YP_007901802.1| gi|526220103|ref|YP_008265632.1| gi|378983989|ref|YP_005247144.1| gi|525826770|ref|YP_008249227.1| gi|563653146|ref|YP_008861211.1| gi|525838353|ref|YP_008255371.1| ABAK02000001|CDS_828898-828251 ABAM02000001|CDS_1972243-1971596 ABAN01000011|CDS_53003-53650 ABAO01000036|CDS_10500-9853 ABEI01000002|CDS_10409-9762 ABEJ01000003|CDS_10544-9897 ABEL01000002|CDS_97670-97023 ABFG01000024|CDS_4903-4256 ABFH02000002|CDS_588106-588753 AE006468|CDS_1512349-1511702 AE014613|CDS_1366754-1366107 AL513382|CDS_1614382-1615029 CP000026|CDS_1499948-1500595 CP001120|CDS_1559469-1558822 CP001127|CDS_1476264-1475617 CP001138|CDS_1703636-1704283 CP001363|CDS_1522325-1521678 FM200053|CDS_1495129-1495776 FN424405|CDS_1508861-1508214 NZ_ACBF01000021|CDS_19496-20143 gi|194737431|ref|YP_002114446.1| gi|525857546|ref|YP_008260623.1| gi|16760479|ref|NP_456096.1| gi|56413597|ref|YP_150672.1| gi|525817321|ref|YP_008247339.1| gi|549724068|ref|YP_008644258.1| gi|378959461|ref|YP_005216947.1| NP_456096.1.84458 NP_460397.1.58477 WP_001282267.1.100007 WP_001282267.1.100008 WP_001282267.1.100010 WP_001282267.1.100036 WP_001282267.1.100079 WP_001282267.1.10013 WP_001282267.1.100196 WP_001282267.1.1002 WP_001282267.1.100234 WP_001282267.1.100266 WP_001282267.1.100284 WP_001282267.1.100288 WP_001282267.1.100313 WP_001282267.1.100314 WP_001282267.1.100321 WP_001282267.1.100354 WP_001282267.1.100376 WP_001282267.1.100421 WP_001282267.1.100424 WP_001282267.1.100432 WP_001282267.1.100436 WP_001282267.1.100438 WP_001282267.1.100446 WP_001282267.1.100450 WP_001282267.1.100484 WP_001282267.1.100488 WP_001282267.1.100589 WP_001282267.1.100592 WP_001282267.1.100597 WP_001282267.1.100610 WP_001282267.1.100642 WP_001282267.1.100650 WP_001282267.1.100707 WP_001282267.1.100721 WP_001282267.1.100730 WP_001282267.1.100732 WP_001282267.1.100733 WP_001282267.1.100739 WP_001282267.1.10074 WP_001282267.1.10076 WP_001282267.1.100764 WP_001282267.1.100781 WP_001282267.1.100790 WP_001282267.1.100793 WP_001282267.1.100799 WP_001282267.1.100814 WP_001282267.1.100869 WP_001282267.1.100871 WP_001282267.1.100882 WP_001282267.1.100886 WP_001282267.1.100932 WP_001282267.1.100941 WP_001282267.1.100944 WP_001282267.1.100953 WP_001282267.1.101007 WP_001282267.1.101011 WP_001282267.1.101020 WP_001282267.1.101074 WP_001282267.1.101078 WP_001282267.1.10108 WP_001282267.1.101094 WP_001282267.1.101111 WP_001282267.1.101147 WP_001282267.1.101180 WP_001282267.1.101185 WP_001282267.1.101199 WP_001282267.1.101223 WP_001282267.1.101226 WP_001282267.1.101239 WP_001282267.1.10124 WP_001282267.1.101259 WP_001282267.1.101271 WP_001282267.1.101284 WP_001282267.1.101291 WP_001282267.1.1013 WP_001282267.1.101312 WP_001282267.1.101322 WP_001282267.1.101353 WP_001282267.1.101374 WP_001282267.1.101386 WP_001282267.1.101404 WP_001282267.1.101420 WP_001282267.1.101473 WP_001282267.1.101519 WP_001282267.1.101589 WP_001282267.1.101612 WP_001282267.1.101616 WP_001282267.1.101639 WP_001282267.1.101707 WP_001282267.1.101734 WP_001282267.1.101741 WP_001282267.1.101744 WP_001282267.1.101815 WP_001282267.1.101839 WP_001282267.1.101868 WP_001282267.1.101878 WP_001282267.1.101890 WP_001282267.1.101904 WP_001282267.1.101941 WP_001282267.1.101949 WP_001282267.1.101953 WP_001282267.1.102050 WP_001282267.1.102087 WP_001282267.1.102103 WP_001282267.1.10220 WP_001282267.1.10231 WP_001282267.1.10266 WP_001282267.1.10276 WP_001282267.1.10310 WP_001282267.1.10338 WP_001282267.1.1038 WP_001282267.1.104 WP_001282267.1.10401 WP_001282267.1.10428 WP_001282267.1.10429 WP_001282267.1.10439 WP_001282267.1.10459 WP_001282267.1.10475 WP_001282267.1.10507 WP_001282267.1.10511 WP_001282267.1.10514 WP_001282267.1.10530 WP_001282267.1.10532 WP_001282267.1.10547 WP_001282267.1.10566 WP_001282267.1.10568 WP_001282267.1.10595 WP_001282267.1.10642 WP_001282267.1.10654 WP_001282267.1.10677 WP_001282267.1.10678 WP_001282267.1.10720 WP_001282267.1.10753 WP_001282267.1.10797 WP_001282267.1.10857 WP_001282267.1.10873 WP_001282267.1.10926 WP_001282267.1.10936 WP_001282267.1.10992 WP_001282267.1.11012 WP_001282267.1.11024 WP_001282267.1.11031 WP_001282267.1.11041 WP_001282267.1.11055 WP_001282267.1.11098 WP_001282267.1.1110 WP_001282267.1.11126 WP_001282267.1.11142 WP_001282267.1.11156 WP_001282267.1.11168 WP_001282267.1.11190 WP_001282267.1.11213 WP_001282267.1.11239 WP_001282267.1.11253 WP_001282267.1.11254 WP_001282267.1.11295 WP_001282267.1.113 WP_001282267.1.11314 WP_001282267.1.11369 WP_001282267.1.1137 WP_001282267.1.11385 WP_001282267.1.1142 WP_001282267.1.11426 WP_001282267.1.11429 WP_001282267.1.11455 WP_001282267.1.11458 WP_001282267.1.11511 WP_001282267.1.11518 WP_001282267.1.11532 WP_001282267.1.11543 WP_001282267.1.11557 WP_001282267.1.11565 WP_001282267.1.11567 WP_001282267.1.11588 WP_001282267.1.11621 WP_001282267.1.11638 WP_001282267.1.11677 WP_001282267.1.11687 WP_001282267.1.11735 WP_001282267.1.11763 WP_001282267.1.11772 WP_001282267.1.11810 WP_001282267.1.11834 WP_001282267.1.11868 WP_001282267.1.11875 WP_001282267.1.11883 WP_001282267.1.11897 WP_001282267.1.11908 WP_001282267.1.11914 WP_001282267.1.11936 WP_001282267.1.11938 WP_001282267.1.12017 WP_001282267.1.12040 WP_001282267.1.12047 WP_001282267.1.12059 WP_001282267.1.12061 WP_001282267.1.12063 WP_001282267.1.1207 WP_001282267.1.12114 WP_001282267.1.12141 WP_001282267.1.12144 WP_001282267.1.12159 WP_001282267.1.12172 WP_001282267.1.12192 WP_001282267.1.12210 WP_001282267.1.1224 WP_001282267.1.12280 WP_001282267.1.12308 WP_001282267.1.12351 WP_001282267.1.12364 WP_001282267.1.12370 WP_001282267.1.12396 WP_001282267.1.12397 WP_001282267.1.12398 WP_001282267.1.12441 WP_001282267.1.12472 WP_001282267.1.12484 WP_001282267.1.12546 WP_001282267.1.12581 WP_001282267.1.12620 WP_001282267.1.1264 WP_001282267.1.12648 WP_001282267.1.12650 WP_001282267.1.12683 WP_001282267.1.12718 WP_001282267.1.12726 WP_001282267.1.12727 WP_001282267.1.12728 WP_001282267.1.12741 WP_001282267.1.12834 WP_001282267.1.12864 WP_001282267.1.12865 WP_001282267.1.12877 WP_001282267.1.12879 WP_001282267.1.12936 WP_001282267.1.12995 WP_001282267.1.13027 WP_001282267.1.13106 WP_001282267.1.13108 WP_001282267.1.13130 WP_001282267.1.13161 WP_001282267.1.13207 WP_001282267.1.1321 WP_001282267.1.13262 WP_001282267.1.13268 WP_001282267.1.13291 WP_001282267.1.133 WP_001282267.1.13314 WP_001282267.1.13338 WP_001282267.1.13342 WP_001282267.1.13352 WP_001282267.1.13406 WP_001282267.1.13414 WP_001282267.1.13440 WP_001282267.1.13443 WP_001282267.1.13446 WP_001282267.1.13476 WP_001282267.1.13488 WP_001282267.1.13509 WP_001282267.1.13543 WP_001282267.1.13599 WP_001282267.1.13602 WP_001282267.1.13661 WP_001282267.1.13669 WP_001282267.1.13677 WP_001282267.1.13686 WP_001282267.1.13691 WP_001282267.1.1372 WP_001282267.1.13732 WP_001282267.1.13741 WP_001282267.1.13764 WP_001282267.1.1382 WP_001282267.1.13827 WP_001282267.1.13829 WP_001282267.1.13848 WP_001282267.1.13857 WP_001282267.1.13908 WP_001282267.1.13932 WP_001282267.1.13967 WP_001282267.1.13968 WP_001282267.1.1397 WP_001282267.1.13972 WP_001282267.1.140 WP_001282267.1.14001 WP_001282267.1.1401 WP_001282267.1.14011 WP_001282267.1.1408 WP_001282267.1.14089 WP_001282267.1.14099 WP_001282267.1.14111 WP_001282267.1.14120 WP_001282267.1.14123 WP_001282267.1.14150 WP_001282267.1.14151 WP_001282267.1.14191 WP_001282267.1.14197 WP_001282267.1.14212 WP_001282267.1.14239 WP_001282267.1.14280 WP_001282267.1.14296 WP_001282267.1.14320 WP_001282267.1.14333 WP_001282267.1.14369 WP_001282267.1.14379 WP_001282267.1.14399 WP_001282267.1.1440 WP_001282267.1.14406 WP_001282267.1.14410 WP_001282267.1.14436 WP_001282267.1.14444 WP_001282267.1.14458 WP_001282267.1.14466 WP_001282267.1.14467 WP_001282267.1.14474 WP_001282267.1.14495 WP_001282267.1.14500 WP_001282267.1.14519 WP_001282267.1.14524 WP_001282267.1.14526 WP_001282267.1.14528 WP_001282267.1.14550 WP_001282267.1.14554 WP_001282267.1.14575 WP_001282267.1.14618 WP_001282267.1.14688 WP_001282267.1.14701 WP_001282267.1.14703 WP_001282267.1.14719 WP_001282267.1.14725 WP_001282267.1.1473 WP_001282267.1.14765 WP_001282267.1.14789 WP_001282267.1.14808 WP_001282267.1.14810 WP_001282267.1.14852 WP_001282267.1.14877 WP_001282267.1.14884 WP_001282267.1.1489 WP_001282267.1.14894 WP_001282267.1.14927 WP_001282267.1.14930 WP_001282267.1.14932 WP_001282267.1.14936 WP_001282267.1.14947 WP_001282267.1.14948 WP_001282267.1.14964 WP_001282267.1.15011 WP_001282267.1.15054 WP_001282267.1.15055 WP_001282267.1.15079 WP_001282267.1.15100 WP_001282267.1.15102 WP_001282267.1.15124 WP_001282267.1.15184 WP_001282267.1.15223 WP_001282267.1.15226 WP_001282267.1.15244 WP_001282267.1.15265 WP_001282267.1.15316 WP_001282267.1.15362 WP_001282267.1.15369 WP_001282267.1.1540 WP_001282267.1.15415 WP_001282267.1.15423 WP_001282267.1.15433 WP_001282267.1.15439 WP_001282267.1.15479 WP_001282267.1.15487 WP_001282267.1.15508 WP_001282267.1.15535 WP_001282267.1.15581 WP_001282267.1.15586 WP_001282267.1.15597 WP_001282267.1.15710 WP_001282267.1.15717 WP_001282267.1.15784 WP_001282267.1.15830 WP_001282267.1.15835 WP_001282267.1.15862 WP_001282267.1.15905 WP_001282267.1.15909 WP_001282267.1.15910 WP_001282267.1.15912 WP_001282267.1.1592 WP_001282267.1.15922 WP_001282267.1.15938 WP_001282267.1.15970 WP_001282267.1.15978 WP_001282267.1.15986 WP_001282267.1.15995 WP_001282267.1.16004 WP_001282267.1.16028 WP_001282267.1.16032 WP_001282267.1.16046 WP_001282267.1.16047 WP_001282267.1.16051 WP_001282267.1.16052 WP_001282267.1.16058 WP_001282267.1.16062 WP_001282267.1.16063 WP_001282267.1.16103 WP_001282267.1.1611 WP_001282267.1.16150 WP_001282267.1.16155 WP_001282267.1.16158 WP_001282267.1.16172 WP_001282267.1.16201 WP_001282267.1.16226 WP_001282267.1.16233 WP_001282267.1.1626 WP_001282267.1.16264 WP_001282267.1.16284 WP_001282267.1.16328 WP_001282267.1.16344 WP_001282267.1.1635 WP_001282267.1.16361 WP_001282267.1.16452 WP_001282267.1.16461 WP_001282267.1.16462 WP_001282267.1.16465 WP_001282267.1.16468 WP_001282267.1.16522 WP_001282267.1.16525 WP_001282267.1.16581 WP_001282267.1.16588 WP_001282267.1.16614 WP_001282267.1.16650 WP_001282267.1.16656 WP_001282267.1.16658 WP_001282267.1.16666 WP_001282267.1.16673 WP_001282267.1.1668 WP_001282267.1.16686 WP_001282267.1.16691 WP_001282267.1.16710 WP_001282267.1.16732 WP_001282267.1.16735 WP_001282267.1.16736 WP_001282267.1.1674 WP_001282267.1.16767 WP_001282267.1.16781 WP_001282267.1.16786 WP_001282267.1.16804 WP_001282267.1.16826 WP_001282267.1.16846 WP_001282267.1.16855 WP_001282267.1.16858 WP_001282267.1.16873 WP_001282267.1.16879 WP_001282267.1.1689 WP_001282267.1.16893 WP_001282267.1.16896 WP_001282267.1.16903 WP_001282267.1.16905 WP_001282267.1.16944 WP_001282267.1.16948 WP_001282267.1.16965 WP_001282267.1.16998 WP_001282267.1.1700 WP_001282267.1.17049 WP_001282267.1.17058 WP_001282267.1.17078 WP_001282267.1.17093 WP_001282267.1.17202 WP_001282267.1.17219 WP_001282267.1.1722 WP_001282267.1.17270 WP_001282267.1.17302 WP_001282267.1.17307 WP_001282267.1.17308 WP_001282267.1.17368 WP_001282267.1.174 WP_001282267.1.17405 WP_001282267.1.17406 WP_001282267.1.17480 WP_001282267.1.1749 WP_001282267.1.17504 WP_001282267.1.17513 WP_001282267.1.17543 WP_001282267.1.17546 WP_001282267.1.17563 WP_001282267.1.17578 WP_001282267.1.17622 WP_001282267.1.17659 WP_001282267.1.17667 WP_001282267.1.17686 WP_001282267.1.17693 WP_001282267.1.17702 WP_001282267.1.17703 WP_001282267.1.17705 WP_001282267.1.17741 WP_001282267.1.17743 WP_001282267.1.17755 WP_001282267.1.17840 WP_001282267.1.17865 WP_001282267.1.17891 WP_001282267.1.17919 WP_001282267.1.17949 WP_001282267.1.17956 WP_001282267.1.1798 WP_001282267.1.18005 WP_001282267.1.1801 WP_001282267.1.18019 WP_001282267.1.18021 WP_001282267.1.18089 WP_001282267.1.18099 WP_001282267.1.18111 WP_001282267.1.18122 WP_001282267.1.18124 WP_001282267.1.18144 WP_001282267.1.18163 WP_001282267.1.18173 WP_001282267.1.18177 WP_001282267.1.18178 WP_001282267.1.1818 WP_001282267.1.18192 WP_001282267.1.18254 WP_001282267.1.18265 WP_001282267.1.18267 WP_001282267.1.18270 WP_001282267.1.18277 WP_001282267.1.18280 WP_001282267.1.18282 WP_001282267.1.18328 WP_001282267.1.18355 WP_001282267.1.18358 WP_001282267.1.18370 WP_001282267.1.18406 WP_001282267.1.18445 WP_001282267.1.18468 WP_001282267.1.18474 WP_001282267.1.18485 WP_001282267.1.18513 WP_001282267.1.18607 WP_001282267.1.18610 WP_001282267.1.18678 WP_001282267.1.18705 WP_001282267.1.18715 WP_001282267.1.18722 WP_001282267.1.18766 WP_001282267.1.18776 WP_001282267.1.1880 WP_001282267.1.18822 WP_001282267.1.1885 WP_001282267.1.18860 WP_001282267.1.18881 WP_001282267.1.18895 WP_001282267.1.18919 WP_001282267.1.18922 WP_001282267.1.18940 WP_001282267.1.18949 WP_001282267.1.18959 WP_001282267.1.19001 WP_001282267.1.19006 WP_001282267.1.19030 WP_001282267.1.19044 WP_001282267.1.19053 WP_001282267.1.19084 WP_001282267.1.19174 WP_001282267.1.19187 WP_001282267.1.19228 WP_001282267.1.19273 WP_001282267.1.19288 WP_001282267.1.19291 WP_001282267.1.19300 WP_001282267.1.19320 WP_001282267.1.19405 WP_001282267.1.19422 WP_001282267.1.19454 WP_001282267.1.19456 WP_001282267.1.19458 WP_001282267.1.19460 WP_001282267.1.19461 WP_001282267.1.19469 WP_001282267.1.19496 WP_001282267.1.19535 WP_001282267.1.19538 WP_001282267.1.19588 WP_001282267.1.19589 WP_001282267.1.19614 WP_001282267.1.19616 WP_001282267.1.19642 WP_001282267.1.19663 WP_001282267.1.19686 WP_001282267.1.19702 WP_001282267.1.19706 WP_001282267.1.19724 WP_001282267.1.19731 WP_001282267.1.19749 WP_001282267.1.19784 WP_001282267.1.19793 WP_001282267.1.19794 WP_001282267.1.19802 WP_001282267.1.19809 WP_001282267.1.19851 WP_001282267.1.19867 WP_001282267.1.19882 WP_001282267.1.1992 WP_001282267.1.19970 WP_001282267.1.19975 WP_001282267.1.1998 WP_001282267.1.19999 WP_001282267.1.20 WP_001282267.1.20023 WP_001282267.1.20081 WP_001282267.1.20089 WP_001282267.1.2010 WP_001282267.1.20119 WP_001282267.1.20212 WP_001282267.1.20218 WP_001282267.1.20254 WP_001282267.1.20255 WP_001282267.1.20266 WP_001282267.1.20271 WP_001282267.1.20296 WP_001282267.1.20339 WP_001282267.1.2036 WP_001282267.1.20362 WP_001282267.1.20418 WP_001282267.1.20419 WP_001282267.1.20443 WP_001282267.1.20446 WP_001282267.1.20465 WP_001282267.1.20492 WP_001282267.1.20503 WP_001282267.1.20525 WP_001282267.1.2053 WP_001282267.1.2054 WP_001282267.1.20553 WP_001282267.1.20564 WP_001282267.1.20614 WP_001282267.1.20626 WP_001282267.1.20635 WP_001282267.1.20646 WP_001282267.1.20700 WP_001282267.1.20718 WP_001282267.1.2073 WP_001282267.1.20740 WP_001282267.1.20795 WP_001282267.1.20810 WP_001282267.1.20828 WP_001282267.1.20839 WP_001282267.1.2087 WP_001282267.1.20883 WP_001282267.1.20886 WP_001282267.1.20894 WP_001282267.1.20908 WP_001282267.1.20947 WP_001282267.1.20953 WP_001282267.1.21010 WP_001282267.1.21049 WP_001282267.1.2106 WP_001282267.1.21062 WP_001282267.1.21089 WP_001282267.1.21136 WP_001282267.1.21144 WP_001282267.1.21146 WP_001282267.1.21162 WP_001282267.1.21181 WP_001282267.1.21184 WP_001282267.1.21185 WP_001282267.1.21245 WP_001282267.1.21246 WP_001282267.1.21260 WP_001282267.1.21269 WP_001282267.1.21286 WP_001282267.1.21351 WP_001282267.1.21366 WP_001282267.1.2139 WP_001282267.1.21399 WP_001282267.1.21400 WP_001282267.1.21443 WP_001282267.1.21453 WP_001282267.1.21473 WP_001282267.1.21492 WP_001282267.1.21497 WP_001282267.1.21499 WP_001282267.1.21534 WP_001282267.1.21603 WP_001282267.1.2166 WP_001282267.1.21674 WP_001282267.1.21692 WP_001282267.1.21751 WP_001282267.1.21757 WP_001282267.1.21845 WP_001282267.1.21910 WP_001282267.1.21940 WP_001282267.1.21946 WP_001282267.1.21966 WP_001282267.1.21981 WP_001282267.1.21991 WP_001282267.1.22019 WP_001282267.1.22024 WP_001282267.1.2205 WP_001282267.1.22062 WP_001282267.1.22064 WP_001282267.1.22067 WP_001282267.1.22117 WP_001282267.1.22118 WP_001282267.1.22126 WP_001282267.1.2216 WP_001282267.1.22205 WP_001282267.1.22208 WP_001282267.1.2221 WP_001282267.1.22235 WP_001282267.1.22240 WP_001282267.1.2227 WP_001282267.1.2235 WP_001282267.1.22373 WP_001282267.1.22379 WP_001282267.1.22427 WP_001282267.1.22451 WP_001282267.1.2246 WP_001282267.1.22476 WP_001282267.1.22485 WP_001282267.1.22565 WP_001282267.1.22566 WP_001282267.1.22582 WP_001282267.1.22614 WP_001282267.1.22620 WP_001282267.1.22623 WP_001282267.1.22652 WP_001282267.1.22676 WP_001282267.1.22683 WP_001282267.1.22692 WP_001282267.1.22758 WP_001282267.1.2284 WP_001282267.1.22855 WP_001282267.1.22864 WP_001282267.1.22870 WP_001282267.1.22895 WP_001282267.1.22926 WP_001282267.1.22943 WP_001282267.1.22966 WP_001282267.1.22967 WP_001282267.1.22979 WP_001282267.1.23040 WP_001282267.1.23058 WP_001282267.1.23080 WP_001282267.1.23102 WP_001282267.1.23114 WP_001282267.1.2314 WP_001282267.1.23148 WP_001282267.1.23175 WP_001282267.1.23192 WP_001282267.1.23218 WP_001282267.1.23258 WP_001282267.1.23259 WP_001282267.1.23279 WP_001282267.1.2331 WP_001282267.1.23311 WP_001282267.1.2332 WP_001282267.1.23340 WP_001282267.1.23343 WP_001282267.1.2336 WP_001282267.1.23365 WP_001282267.1.23379 WP_001282267.1.23412 WP_001282267.1.23426 WP_001282267.1.23460 WP_001282267.1.23472 WP_001282267.1.23482 WP_001282267.1.23492 WP_001282267.1.23500 WP_001282267.1.23503 WP_001282267.1.23509 WP_001282267.1.23513 WP_001282267.1.23515 WP_001282267.1.23529 WP_001282267.1.23548 WP_001282267.1.23571 WP_001282267.1.23604 WP_001282267.1.23634 WP_001282267.1.23639 WP_001282267.1.2364 WP_001282267.1.23675 WP_001282267.1.23679 WP_001282267.1.237 WP_001282267.1.23707 WP_001282267.1.23720 WP_001282267.1.23728 WP_001282267.1.2375 WP_001282267.1.23783 WP_001282267.1.23786 WP_001282267.1.23787 WP_001282267.1.2380 WP_001282267.1.23801 WP_001282267.1.23819 WP_001282267.1.23932 WP_001282267.1.23959 WP_001282267.1.24017 WP_001282267.1.24028 WP_001282267.1.24061 WP_001282267.1.24082 WP_001282267.1.24083 WP_001282267.1.24117 WP_001282267.1.24125 WP_001282267.1.24138 WP_001282267.1.2415 WP_001282267.1.24153 WP_001282267.1.24206 WP_001282267.1.24259 WP_001282267.1.24291 WP_001282267.1.24308 WP_001282267.1.24322 WP_001282267.1.24355 WP_001282267.1.24375 WP_001282267.1.24376 WP_001282267.1.24394 WP_001282267.1.24400 WP_001282267.1.24412 WP_001282267.1.24420 WP_001282267.1.24521 WP_001282267.1.24555 WP_001282267.1.24567 WP_001282267.1.24578 WP_001282267.1.24619 WP_001282267.1.24643 WP_001282267.1.24686 WP_001282267.1.24688 WP_001282267.1.24696 WP_001282267.1.24716 WP_001282267.1.24727 WP_001282267.1.24737 WP_001282267.1.24779 WP_001282267.1.2481 WP_001282267.1.24832 WP_001282267.1.24837 WP_001282267.1.24839 WP_001282267.1.24964 WP_001282267.1.25008 WP_001282267.1.25015 WP_001282267.1.25017 WP_001282267.1.25032 WP_001282267.1.25036 WP_001282267.1.25041 WP_001282267.1.25053 WP_001282267.1.25064 WP_001282267.1.25119 WP_001282267.1.25140 WP_001282267.1.25185 WP_001282267.1.25196 WP_001282267.1.25205 WP_001282267.1.25210 WP_001282267.1.25219 WP_001282267.1.2525 WP_001282267.1.25297 WP_001282267.1.25304 WP_001282267.1.25374 WP_001282267.1.25397 WP_001282267.1.25405 WP_001282267.1.25454 WP_001282267.1.25475 WP_001282267.1.25490 WP_001282267.1.25493 WP_001282267.1.25508 WP_001282267.1.25512 WP_001282267.1.25514 WP_001282267.1.25564 WP_001282267.1.25596 WP_001282267.1.25603 WP_001282267.1.2562 WP_001282267.1.25666 WP_001282267.1.25668 WP_001282267.1.25690 WP_001282267.1.2570 WP_001282267.1.25708 WP_001282267.1.25740 WP_001282267.1.25793 WP_001282267.1.25807 WP_001282267.1.2581 WP_001282267.1.25814 WP_001282267.1.25821 WP_001282267.1.25825 WP_001282267.1.25833 WP_001282267.1.25835 WP_001282267.1.25846 WP_001282267.1.25882 WP_001282267.1.25911 WP_001282267.1.25932 WP_001282267.1.25962 WP_001282267.1.25963 WP_001282267.1.25988 WP_001282267.1.26001 WP_001282267.1.26027 WP_001282267.1.26034 WP_001282267.1.26107 WP_001282267.1.26122 WP_001282267.1.26123 WP_001282267.1.2615 WP_001282267.1.26199 WP_001282267.1.26217 WP_001282267.1.26230 WP_001282267.1.26232 WP_001282267.1.26272 WP_001282267.1.26282 WP_001282267.1.26286 WP_001282267.1.26288 WP_001282267.1.26311 WP_001282267.1.26319 WP_001282267.1.26394 WP_001282267.1.26429 WP_001282267.1.26440 WP_001282267.1.26491 WP_001282267.1.26493 WP_001282267.1.26512 WP_001282267.1.2654 WP_001282267.1.26551 WP_001282267.1.26554 WP_001282267.1.26567 WP_001282267.1.26576 WP_001282267.1.26636 WP_001282267.1.26689 WP_001282267.1.26741 WP_001282267.1.26750 WP_001282267.1.26787 WP_001282267.1.2679 WP_001282267.1.26833 WP_001282267.1.26856 WP_001282267.1.26883 WP_001282267.1.26892 WP_001282267.1.26908 WP_001282267.1.26919 WP_001282267.1.2692 WP_001282267.1.26928 WP_001282267.1.26980 WP_001282267.1.270 WP_001282267.1.27008 WP_001282267.1.27010 WP_001282267.1.27027 WP_001282267.1.27051 WP_001282267.1.27070 WP_001282267.1.27077 WP_001282267.1.27084 WP_001282267.1.27086 WP_001282267.1.27087 WP_001282267.1.27111 WP_001282267.1.27115 WP_001282267.1.2713 WP_001282267.1.27169 WP_001282267.1.2717 WP_001282267.1.27173 WP_001282267.1.272 WP_001282267.1.27206 WP_001282267.1.27223 WP_001282267.1.27228 WP_001282267.1.2723 WP_001282267.1.27255 WP_001282267.1.27282 WP_001282267.1.27285 WP_001282267.1.27309 WP_001282267.1.27329 WP_001282267.1.27361 WP_001282267.1.27423 WP_001282267.1.27523 WP_001282267.1.27535 WP_001282267.1.27544 WP_001282267.1.27561 WP_001282267.1.27565 WP_001282267.1.27595 WP_001282267.1.27598 WP_001282267.1.2763 WP_001282267.1.27655 WP_001282267.1.27665 WP_001282267.1.27706 WP_001282267.1.27707 WP_001282267.1.27755 WP_001282267.1.27761 WP_001282267.1.2777 WP_001282267.1.27775 WP_001282267.1.27776 WP_001282267.1.27785 WP_001282267.1.27798 WP_001282267.1.27815 WP_001282267.1.27857 WP_001282267.1.27900 WP_001282267.1.27928 WP_001282267.1.27945 WP_001282267.1.27977 WP_001282267.1.28002 WP_001282267.1.28004 WP_001282267.1.28032 WP_001282267.1.2806 WP_001282267.1.28073 WP_001282267.1.2809 WP_001282267.1.28094 WP_001282267.1.28155 WP_001282267.1.28170 WP_001282267.1.28174 WP_001282267.1.28198 WP_001282267.1.2822 WP_001282267.1.28225 WP_001282267.1.28229 WP_001282267.1.28235 WP_001282267.1.28301 WP_001282267.1.28302 WP_001282267.1.2835 WP_001282267.1.28370 WP_001282267.1.28384 WP_001282267.1.28386 WP_001282267.1.28393 WP_001282267.1.28395 WP_001282267.1.284 WP_001282267.1.2845 WP_001282267.1.28479 WP_001282267.1.28514 WP_001282267.1.28538 WP_001282267.1.28575 WP_001282267.1.28625 WP_001282267.1.28627 WP_001282267.1.28655 WP_001282267.1.28673 WP_001282267.1.28692 WP_001282267.1.28694 WP_001282267.1.287 WP_001282267.1.2873 WP_001282267.1.28775 WP_001282267.1.2879 WP_001282267.1.28811 WP_001282267.1.2890 WP_001282267.1.28902 WP_001282267.1.28917 WP_001282267.1.28921 WP_001282267.1.28938 WP_001282267.1.28946 WP_001282267.1.28962 WP_001282267.1.28963 WP_001282267.1.28977 WP_001282267.1.29006 WP_001282267.1.29010 WP_001282267.1.29023 WP_001282267.1.29042 WP_001282267.1.2905 WP_001282267.1.2907 WP_001282267.1.29081 WP_001282267.1.29089 WP_001282267.1.2910 WP_001282267.1.29113 WP_001282267.1.29153 WP_001282267.1.29203 WP_001282267.1.29237 WP_001282267.1.29248 WP_001282267.1.29288 WP_001282267.1.29389 WP_001282267.1.29439 WP_001282267.1.29454 WP_001282267.1.2946 WP_001282267.1.29462 WP_001282267.1.29509 WP_001282267.1.29563 WP_001282267.1.29588 WP_001282267.1.29601 WP_001282267.1.29606 WP_001282267.1.29615 WP_001282267.1.29619 WP_001282267.1.29704 WP_001282267.1.29727 WP_001282267.1.29732 WP_001282267.1.29743 WP_001282267.1.29774 WP_001282267.1.29775 WP_001282267.1.29782 WP_001282267.1.29827 WP_001282267.1.29833 WP_001282267.1.2984 WP_001282267.1.29845 WP_001282267.1.29851 WP_001282267.1.29865 WP_001282267.1.29886 WP_001282267.1.29898 WP_001282267.1.29919 WP_001282267.1.2994 WP_001282267.1.29964 WP_001282267.1.29969 WP_001282267.1.29983 WP_001282267.1.29990 WP_001282267.1.30006 WP_001282267.1.30009 WP_001282267.1.30013 WP_001282267.1.3002 WP_001282267.1.30022 WP_001282267.1.30027 WP_001282267.1.30034 WP_001282267.1.30049 WP_001282267.1.30058 WP_001282267.1.30093 WP_001282267.1.3017 WP_001282267.1.30170 WP_001282267.1.30172 WP_001282267.1.30179 WP_001282267.1.30180 WP_001282267.1.30185 WP_001282267.1.30195 WP_001282267.1.30202 WP_001282267.1.30225 WP_001282267.1.30246 WP_001282267.1.30331 WP_001282267.1.30354 WP_001282267.1.30357 WP_001282267.1.30362 WP_001282267.1.30389 WP_001282267.1.3042 WP_001282267.1.30421 WP_001282267.1.30425 WP_001282267.1.30440 WP_001282267.1.30448 WP_001282267.1.30469 WP_001282267.1.30489 WP_001282267.1.30505 WP_001282267.1.30507 WP_001282267.1.30517 WP_001282267.1.30535 WP_001282267.1.30542 WP_001282267.1.30544 WP_001282267.1.30547 WP_001282267.1.30555 WP_001282267.1.30556 WP_001282267.1.30572 WP_001282267.1.30585 WP_001282267.1.30602 WP_001282267.1.30618 WP_001282267.1.3066 WP_001282267.1.30664 WP_001282267.1.30688 WP_001282267.1.30696 WP_001282267.1.30794 WP_001282267.1.3080 WP_001282267.1.30802 WP_001282267.1.30806 WP_001282267.1.30819 WP_001282267.1.30823 WP_001282267.1.30833 WP_001282267.1.30835 WP_001282267.1.30967 WP_001282267.1.30972 WP_001282267.1.31 WP_001282267.1.31001 WP_001282267.1.31011 WP_001282267.1.31046 WP_001282267.1.31066 WP_001282267.1.31069 WP_001282267.1.31078 WP_001282267.1.31086 WP_001282267.1.31092 WP_001282267.1.31122 WP_001282267.1.3113 WP_001282267.1.31139 WP_001282267.1.31145 WP_001282267.1.31155 WP_001282267.1.31171 WP_001282267.1.31182 WP_001282267.1.31185 WP_001282267.1.3119 WP_001282267.1.31190 WP_001282267.1.31195 WP_001282267.1.31196 WP_001282267.1.31198 WP_001282267.1.31205 WP_001282267.1.3121 WP_001282267.1.31222 WP_001282267.1.31223 WP_001282267.1.3124 WP_001282267.1.31251 WP_001282267.1.31281 WP_001282267.1.31303 WP_001282267.1.3131 WP_001282267.1.31352 WP_001282267.1.31362 WP_001282267.1.31389 WP_001282267.1.31413 WP_001282267.1.31446 WP_001282267.1.31451 WP_001282267.1.31504 WP_001282267.1.31515 WP_001282267.1.31533 WP_001282267.1.31546 WP_001282267.1.31578 WP_001282267.1.31658 WP_001282267.1.3170 WP_001282267.1.31725 WP_001282267.1.31799 WP_001282267.1.31836 WP_001282267.1.3185 WP_001282267.1.31854 WP_001282267.1.31927 WP_001282267.1.31940 WP_001282267.1.31951 WP_001282267.1.31967 WP_001282267.1.31972 WP_001282267.1.32006 WP_001282267.1.32038 WP_001282267.1.32041 WP_001282267.1.32042 WP_001282267.1.32054 WP_001282267.1.32056 WP_001282267.1.3207 WP_001282267.1.32170 WP_001282267.1.32189 WP_001282267.1.32192 WP_001282267.1.32202 WP_001282267.1.32206 WP_001282267.1.32260 WP_001282267.1.32263 WP_001282267.1.32293 WP_001282267.1.32299 WP_001282267.1.32357 WP_001282267.1.32368 WP_001282267.1.32408 WP_001282267.1.32422 WP_001282267.1.32423 WP_001282267.1.32424 WP_001282267.1.32425 WP_001282267.1.32438 WP_001282267.1.32458 WP_001282267.1.32459 WP_001282267.1.32460 WP_001282267.1.32515 WP_001282267.1.32527 WP_001282267.1.32529 WP_001282267.1.32545 WP_001282267.1.32563 WP_001282267.1.32578 WP_001282267.1.32617 WP_001282267.1.32624 WP_001282267.1.32629 WP_001282267.1.32643 WP_001282267.1.32660 WP_001282267.1.3270 WP_001282267.1.32702 WP_001282267.1.32714 WP_001282267.1.32725 WP_001282267.1.3278 WP_001282267.1.32786 WP_001282267.1.32804 WP_001282267.1.32838 WP_001282267.1.32848 WP_001282267.1.32868 WP_001282267.1.329 WP_001282267.1.3290 WP_001282267.1.32907 WP_001282267.1.32930 WP_001282267.1.32940 WP_001282267.1.32941 WP_001282267.1.3296 WP_001282267.1.32961 WP_001282267.1.32966 WP_001282267.1.32985 WP_001282267.1.33030 WP_001282267.1.33037 WP_001282267.1.3305 WP_001282267.1.33051 WP_001282267.1.33065 WP_001282267.1.33122 WP_001282267.1.33127 WP_001282267.1.33143 WP_001282267.1.3315 WP_001282267.1.33208 WP_001282267.1.33214 WP_001282267.1.33247 WP_001282267.1.33248 WP_001282267.1.33261 WP_001282267.1.33280 WP_001282267.1.33283 WP_001282267.1.333 WP_001282267.1.33313 WP_001282267.1.33339 WP_001282267.1.33382 WP_001282267.1.33420 WP_001282267.1.33486 WP_001282267.1.33490 WP_001282267.1.33492 WP_001282267.1.33501 WP_001282267.1.33504 WP_001282267.1.33529 WP_001282267.1.33553 WP_001282267.1.33580 WP_001282267.1.33592 WP_001282267.1.33629 WP_001282267.1.33689 WP_001282267.1.33693 WP_001282267.1.3370 WP_001282267.1.33730 WP_001282267.1.33741 WP_001282267.1.33825 WP_001282267.1.33840 WP_001282267.1.33894 WP_001282267.1.3392 WP_001282267.1.33926 WP_001282267.1.3394 WP_001282267.1.3395 WP_001282267.1.33957 WP_001282267.1.33969 WP_001282267.1.34001 WP_001282267.1.34022 WP_001282267.1.34043 WP_001282267.1.34059 WP_001282267.1.34075 WP_001282267.1.34081 WP_001282267.1.34084 WP_001282267.1.34107 WP_001282267.1.34118 WP_001282267.1.34126 WP_001282267.1.34179 WP_001282267.1.34211 WP_001282267.1.34214 WP_001282267.1.34234 WP_001282267.1.34257 WP_001282267.1.34279 WP_001282267.1.34284 WP_001282267.1.34304 WP_001282267.1.34319 WP_001282267.1.34376 WP_001282267.1.34382 WP_001282267.1.34417 WP_001282267.1.34424 WP_001282267.1.34453 WP_001282267.1.34484 WP_001282267.1.34517 WP_001282267.1.34530 WP_001282267.1.34610 WP_001282267.1.34647 WP_001282267.1.34659 WP_001282267.1.34665 WP_001282267.1.34694 WP_001282267.1.34703 WP_001282267.1.34707 WP_001282267.1.34745 WP_001282267.1.34751 WP_001282267.1.3476 WP_001282267.1.34801 WP_001282267.1.34808 WP_001282267.1.34824 WP_001282267.1.34834 WP_001282267.1.34856 WP_001282267.1.34881 WP_001282267.1.34932 WP_001282267.1.34962 WP_001282267.1.34975 WP_001282267.1.35001 WP_001282267.1.35040 WP_001282267.1.35045 WP_001282267.1.35074 WP_001282267.1.35125 WP_001282267.1.35129 WP_001282267.1.35175 WP_001282267.1.35184 WP_001282267.1.35193 WP_001282267.1.35240 WP_001282267.1.35274 WP_001282267.1.35294 WP_001282267.1.35331 WP_001282267.1.35404 WP_001282267.1.35408 WP_001282267.1.35425 WP_001282267.1.35429 WP_001282267.1.35446 WP_001282267.1.35463 WP_001282267.1.35503 WP_001282267.1.35507 WP_001282267.1.35509 WP_001282267.1.35532 WP_001282267.1.35560 WP_001282267.1.3557 WP_001282267.1.35590 WP_001282267.1.35628 WP_001282267.1.35648 WP_001282267.1.3566 WP_001282267.1.3570 WP_001282267.1.35712 WP_001282267.1.35713 WP_001282267.1.35736 WP_001282267.1.35777 WP_001282267.1.35791 WP_001282267.1.35795 WP_001282267.1.35835 WP_001282267.1.35868 WP_001282267.1.35870 WP_001282267.1.35892 WP_001282267.1.35916 WP_001282267.1.35938 WP_001282267.1.35940 WP_001282267.1.35966 WP_001282267.1.35993 WP_001282267.1.36000 WP_001282267.1.36003 WP_001282267.1.3601 WP_001282267.1.36011 WP_001282267.1.36017 WP_001282267.1.36034 WP_001282267.1.36036 WP_001282267.1.36057 WP_001282267.1.36069 WP_001282267.1.36229 WP_001282267.1.36236 WP_001282267.1.36286 WP_001282267.1.36291 WP_001282267.1.36298 WP_001282267.1.36308 WP_001282267.1.36323 WP_001282267.1.36343 WP_001282267.1.36425 WP_001282267.1.36460 WP_001282267.1.3649 WP_001282267.1.36495 WP_001282267.1.36526 WP_001282267.1.36542 WP_001282267.1.36547 WP_001282267.1.36564 WP_001282267.1.36567 WP_001282267.1.36579 WP_001282267.1.36586 WP_001282267.1.36609 WP_001282267.1.36617 WP_001282267.1.36618 WP_001282267.1.36643 WP_001282267.1.36663 WP_001282267.1.36690 WP_001282267.1.3670 WP_001282267.1.36701 WP_001282267.1.36705 WP_001282267.1.36725 WP_001282267.1.36779 WP_001282267.1.36798 WP_001282267.1.36802 WP_001282267.1.36821 WP_001282267.1.36839 WP_001282267.1.36853 WP_001282267.1.36875 WP_001282267.1.36885 WP_001282267.1.36899 WP_001282267.1.36918 WP_001282267.1.36931 WP_001282267.1.36949 WP_001282267.1.36950 WP_001282267.1.37013 WP_001282267.1.37014 WP_001282267.1.37021 WP_001282267.1.37063 WP_001282267.1.37073 WP_001282267.1.37100 WP_001282267.1.37111 WP_001282267.1.37112 WP_001282267.1.37133 WP_001282267.1.37147 WP_001282267.1.37158 WP_001282267.1.37176 WP_001282267.1.37199 WP_001282267.1.37200 WP_001282267.1.37256 WP_001282267.1.37258 WP_001282267.1.37267 WP_001282267.1.3728 WP_001282267.1.37293 WP_001282267.1.37303 WP_001282267.1.37320 WP_001282267.1.37351 WP_001282267.1.37376 WP_001282267.1.3744 WP_001282267.1.37498 WP_001282267.1.37504 WP_001282267.1.3751 WP_001282267.1.37513 WP_001282267.1.37584 WP_001282267.1.37590 WP_001282267.1.37593 WP_001282267.1.37600 WP_001282267.1.37613 WP_001282267.1.37618 WP_001282267.1.37659 WP_001282267.1.37662 WP_001282267.1.37666 WP_001282267.1.37675 WP_001282267.1.37691 WP_001282267.1.37761 WP_001282267.1.37775 WP_001282267.1.37777 WP_001282267.1.378 WP_001282267.1.37808 WP_001282267.1.379 WP_001282267.1.37911 WP_001282267.1.37941 WP_001282267.1.37968 WP_001282267.1.37978 WP_001282267.1.37985 WP_001282267.1.38026 WP_001282267.1.38055 WP_001282267.1.38061 WP_001282267.1.38064 WP_001282267.1.38108 WP_001282267.1.38125 WP_001282267.1.38145 WP_001282267.1.3816 WP_001282267.1.38207 WP_001282267.1.38261 WP_001282267.1.38266 WP_001282267.1.3828 WP_001282267.1.383 WP_001282267.1.38310 WP_001282267.1.38322 WP_001282267.1.3834 WP_001282267.1.38349 WP_001282267.1.38351 WP_001282267.1.3838 WP_001282267.1.38381 WP_001282267.1.38393 WP_001282267.1.38440 WP_001282267.1.38452 WP_001282267.1.3848 WP_001282267.1.38486 WP_001282267.1.38512 WP_001282267.1.38515 WP_001282267.1.38569 WP_001282267.1.38595 WP_001282267.1.3860 WP_001282267.1.38609 WP_001282267.1.38613 WP_001282267.1.38620 WP_001282267.1.38622 WP_001282267.1.38642 WP_001282267.1.38673 WP_001282267.1.38693 WP_001282267.1.38734 WP_001282267.1.38740 WP_001282267.1.38773 WP_001282267.1.38781 WP_001282267.1.38830 WP_001282267.1.38877 WP_001282267.1.38882 WP_001282267.1.38898 WP_001282267.1.3891 WP_001282267.1.38913 WP_001282267.1.38983 WP_001282267.1.38995 WP_001282267.1.38996 WP_001282267.1.39003 WP_001282267.1.39056 WP_001282267.1.39059 WP_001282267.1.3907 WP_001282267.1.39082 WP_001282267.1.39105 WP_001282267.1.39112 WP_001282267.1.39113 WP_001282267.1.39128 WP_001282267.1.39136 WP_001282267.1.3914 WP_001282267.1.39147 WP_001282267.1.39161 WP_001282267.1.39197 WP_001282267.1.39210 WP_001282267.1.39229 WP_001282267.1.39235 WP_001282267.1.39265 WP_001282267.1.39275 WP_001282267.1.3931 WP_001282267.1.39311 WP_001282267.1.39405 WP_001282267.1.39420 WP_001282267.1.39435 WP_001282267.1.39449 WP_001282267.1.39471 WP_001282267.1.39502 WP_001282267.1.39512 WP_001282267.1.39530 WP_001282267.1.39553 WP_001282267.1.39584 WP_001282267.1.39619 WP_001282267.1.39620 WP_001282267.1.39624 WP_001282267.1.39629 WP_001282267.1.39659 WP_001282267.1.39667 WP_001282267.1.39723 WP_001282267.1.39724 WP_001282267.1.39763 WP_001282267.1.39775 WP_001282267.1.39808 WP_001282267.1.39862 WP_001282267.1.39879 WP_001282267.1.39890 WP_001282267.1.39921 WP_001282267.1.39923 WP_001282267.1.39941 WP_001282267.1.39945 WP_001282267.1.39947 WP_001282267.1.39953 WP_001282267.1.40017 WP_001282267.1.40025 WP_001282267.1.40031 WP_001282267.1.40072 WP_001282267.1.40073 WP_001282267.1.40095 WP_001282267.1.40097 WP_001282267.1.401 WP_001282267.1.4011 WP_001282267.1.40160 WP_001282267.1.40167 WP_001282267.1.40170 WP_001282267.1.40208 WP_001282267.1.40224 WP_001282267.1.40240 WP_001282267.1.40257 WP_001282267.1.40279 WP_001282267.1.40292 WP_001282267.1.40305 WP_001282267.1.40311 WP_001282267.1.40341 WP_001282267.1.40361 WP_001282267.1.40380 WP_001282267.1.40395 WP_001282267.1.4042 WP_001282267.1.40465 WP_001282267.1.40467 WP_001282267.1.40496 WP_001282267.1.40508 WP_001282267.1.40517 WP_001282267.1.40528 WP_001282267.1.40688 WP_001282267.1.40693 WP_001282267.1.40698 WP_001282267.1.40710 WP_001282267.1.40722 WP_001282267.1.4075 WP_001282267.1.40750 WP_001282267.1.40763 WP_001282267.1.40788 WP_001282267.1.40854 WP_001282267.1.4087 WP_001282267.1.40877 WP_001282267.1.4089 WP_001282267.1.40910 WP_001282267.1.40924 WP_001282267.1.40932 WP_001282267.1.40935 WP_001282267.1.40946 WP_001282267.1.40979 WP_001282267.1.40996 WP_001282267.1.41004 WP_001282267.1.41017 WP_001282267.1.41018 WP_001282267.1.41048 WP_001282267.1.41050 WP_001282267.1.4106 WP_001282267.1.41070 WP_001282267.1.41074 WP_001282267.1.41075 WP_001282267.1.41086 WP_001282267.1.4109 WP_001282267.1.41091 WP_001282267.1.41097 WP_001282267.1.41132 WP_001282267.1.41176 WP_001282267.1.41226 WP_001282267.1.41251 WP_001282267.1.41258 WP_001282267.1.41265 WP_001282267.1.41279 WP_001282267.1.41299 WP_001282267.1.41305 WP_001282267.1.41308 WP_001282267.1.41310 WP_001282267.1.41321 WP_001282267.1.41333 WP_001282267.1.41335 WP_001282267.1.4136 WP_001282267.1.41415 WP_001282267.1.41438 WP_001282267.1.41440 WP_001282267.1.41459 WP_001282267.1.41498 WP_001282267.1.41516 WP_001282267.1.41519 WP_001282267.1.41524 WP_001282267.1.41554 WP_001282267.1.41572 WP_001282267.1.41591 WP_001282267.1.41593 WP_001282267.1.41628 WP_001282267.1.41631 WP_001282267.1.41658 WP_001282267.1.41659 WP_001282267.1.41662 WP_001282267.1.41708 WP_001282267.1.41716 WP_001282267.1.41724 WP_001282267.1.41746 WP_001282267.1.41761 WP_001282267.1.41789 WP_001282267.1.41824 WP_001282267.1.41825 WP_001282267.1.41836 WP_001282267.1.4184 WP_001282267.1.41882 WP_001282267.1.41894 WP_001282267.1.41904 WP_001282267.1.41919 WP_001282267.1.41929 WP_001282267.1.41938 WP_001282267.1.4194 WP_001282267.1.41979 WP_001282267.1.41985 WP_001282267.1.42069 WP_001282267.1.42081 WP_001282267.1.42090 WP_001282267.1.42098 WP_001282267.1.42104 WP_001282267.1.42109 WP_001282267.1.42111 WP_001282267.1.42156 WP_001282267.1.42187 WP_001282267.1.42200 WP_001282267.1.42219 WP_001282267.1.4222 WP_001282267.1.42238 WP_001282267.1.42243 WP_001282267.1.42244 WP_001282267.1.42257 WP_001282267.1.42261 WP_001282267.1.42262 WP_001282267.1.42276 WP_001282267.1.4229 WP_001282267.1.42320 WP_001282267.1.42328 WP_001282267.1.42342 WP_001282267.1.42349 WP_001282267.1.42356 WP_001282267.1.42364 WP_001282267.1.42371 WP_001282267.1.42372 WP_001282267.1.42379 WP_001282267.1.42391 WP_001282267.1.42399 WP_001282267.1.42422 WP_001282267.1.42433 WP_001282267.1.42444 WP_001282267.1.42453 WP_001282267.1.42489 WP_001282267.1.42491 WP_001282267.1.42539 WP_001282267.1.42603 WP_001282267.1.42650 WP_001282267.1.42655 WP_001282267.1.4267 WP_001282267.1.42676 WP_001282267.1.42701 WP_001282267.1.42707 WP_001282267.1.4276 WP_001282267.1.42767 WP_001282267.1.42794 WP_001282267.1.42805 WP_001282267.1.42815 WP_001282267.1.42859 WP_001282267.1.42864 WP_001282267.1.4288 WP_001282267.1.4289 WP_001282267.1.4298 WP_001282267.1.42981 WP_001282267.1.43008 WP_001282267.1.43016 WP_001282267.1.43018 WP_001282267.1.43019 WP_001282267.1.43041 WP_001282267.1.43065 WP_001282267.1.43068 WP_001282267.1.43069 WP_001282267.1.43070 WP_001282267.1.43077 WP_001282267.1.43086 WP_001282267.1.43128 WP_001282267.1.43141 WP_001282267.1.43149 WP_001282267.1.43157 WP_001282267.1.43161 WP_001282267.1.43190 WP_001282267.1.43198 WP_001282267.1.43244 WP_001282267.1.4326 WP_001282267.1.43290 WP_001282267.1.43292 WP_001282267.1.43299 WP_001282267.1.43307 WP_001282267.1.43312 WP_001282267.1.43334 WP_001282267.1.43339 WP_001282267.1.43371 WP_001282267.1.43437 WP_001282267.1.43438 WP_001282267.1.43513 WP_001282267.1.43520 WP_001282267.1.43522 WP_001282267.1.43613 WP_001282267.1.43633 WP_001282267.1.43637 WP_001282267.1.43651 WP_001282267.1.43654 WP_001282267.1.43668 WP_001282267.1.43676 WP_001282267.1.43710 WP_001282267.1.43722 WP_001282267.1.4373 WP_001282267.1.43778 WP_001282267.1.43801 WP_001282267.1.43812 WP_001282267.1.43828 WP_001282267.1.43839 WP_001282267.1.43873 WP_001282267.1.43878 WP_001282267.1.43886 WP_001282267.1.43888 WP_001282267.1.43919 WP_001282267.1.43951 WP_001282267.1.43974 WP_001282267.1.44005 WP_001282267.1.44043 WP_001282267.1.44049 WP_001282267.1.44099 WP_001282267.1.44101 WP_001282267.1.44113 WP_001282267.1.44121 WP_001282267.1.44132 WP_001282267.1.44144 WP_001282267.1.44160 WP_001282267.1.44180 WP_001282267.1.44196 WP_001282267.1.44248 WP_001282267.1.44250 WP_001282267.1.44262 WP_001282267.1.44268 WP_001282267.1.4427 WP_001282267.1.44291 WP_001282267.1.44296 WP_001282267.1.44300 WP_001282267.1.44310 WP_001282267.1.44339 WP_001282267.1.44343 WP_001282267.1.44351 WP_001282267.1.44359 WP_001282267.1.44360 WP_001282267.1.44386 WP_001282267.1.4440 WP_001282267.1.44416 WP_001282267.1.44431 WP_001282267.1.44433 WP_001282267.1.44437 WP_001282267.1.44453 WP_001282267.1.44479 WP_001282267.1.44546 WP_001282267.1.44593 WP_001282267.1.44606 WP_001282267.1.44607 WP_001282267.1.44636 WP_001282267.1.44640 WP_001282267.1.4467 WP_001282267.1.4468 WP_001282267.1.44687 WP_001282267.1.44702 WP_001282267.1.44747 WP_001282267.1.44762 WP_001282267.1.44815 WP_001282267.1.44828 WP_001282267.1.4485 WP_001282267.1.44877 WP_001282267.1.44879 WP_001282267.1.44887 WP_001282267.1.44917 WP_001282267.1.44927 WP_001282267.1.44933 WP_001282267.1.44985 WP_001282267.1.44996 WP_001282267.1.4501 WP_001282267.1.45027 WP_001282267.1.45038 WP_001282267.1.45045 WP_001282267.1.4505 WP_001282267.1.45067 WP_001282267.1.45072 WP_001282267.1.45074 WP_001282267.1.45079 WP_001282267.1.45093 WP_001282267.1.45098 WP_001282267.1.45134 WP_001282267.1.45136 WP_001282267.1.45145 WP_001282267.1.45177 WP_001282267.1.45184 WP_001282267.1.45229 WP_001282267.1.45241 WP_001282267.1.45259 WP_001282267.1.45322 WP_001282267.1.45344 WP_001282267.1.45349 WP_001282267.1.45365 WP_001282267.1.45402 WP_001282267.1.45434 WP_001282267.1.45435 WP_001282267.1.45462 WP_001282267.1.45523 WP_001282267.1.45544 WP_001282267.1.45550 WP_001282267.1.45582 WP_001282267.1.45585 WP_001282267.1.45596 WP_001282267.1.45622 WP_001282267.1.45648 WP_001282267.1.45660 WP_001282267.1.45690 WP_001282267.1.458 WP_001282267.1.45829 WP_001282267.1.45848 WP_001282267.1.45871 WP_001282267.1.46011 WP_001282267.1.46030 WP_001282267.1.46069 WP_001282267.1.46077 WP_001282267.1.46112 WP_001282267.1.46169 WP_001282267.1.46173 WP_001282267.1.46174 WP_001282267.1.46187 WP_001282267.1.46225 WP_001282267.1.46232 WP_001282267.1.46241 WP_001282267.1.46243 WP_001282267.1.46278 WP_001282267.1.46299 WP_001282267.1.46303 WP_001282267.1.46307 WP_001282267.1.46355 WP_001282267.1.46358 WP_001282267.1.464 WP_001282267.1.46434 WP_001282267.1.46454 WP_001282267.1.46461 WP_001282267.1.46504 WP_001282267.1.46505 WP_001282267.1.46551 WP_001282267.1.46559 WP_001282267.1.46595 WP_001282267.1.46620 WP_001282267.1.46637 WP_001282267.1.46675 WP_001282267.1.46701 WP_001282267.1.46732 WP_001282267.1.46749 WP_001282267.1.46781 WP_001282267.1.46816 WP_001282267.1.46842 WP_001282267.1.4690 WP_001282267.1.46930 WP_001282267.1.46945 WP_001282267.1.47008 WP_001282267.1.47023 WP_001282267.1.47036 WP_001282267.1.47037 WP_001282267.1.47042 WP_001282267.1.47057 WP_001282267.1.47059 WP_001282267.1.47061 WP_001282267.1.47067 WP_001282267.1.47085 WP_001282267.1.47110 WP_001282267.1.47123 WP_001282267.1.47214 WP_001282267.1.47215 WP_001282267.1.47243 WP_001282267.1.47245 WP_001282267.1.47429 WP_001282267.1.47448 WP_001282267.1.47460 WP_001282267.1.4747 WP_001282267.1.47472 WP_001282267.1.47478 WP_001282267.1.47523 WP_001282267.1.47531 WP_001282267.1.47532 WP_001282267.1.47542 WP_001282267.1.47579 WP_001282267.1.47605 WP_001282267.1.47614 WP_001282267.1.47621 WP_001282267.1.47630 WP_001282267.1.47660 WP_001282267.1.4774 WP_001282267.1.47756 WP_001282267.1.47767 WP_001282267.1.47799 WP_001282267.1.4781 WP_001282267.1.47886 WP_001282267.1.47898 WP_001282267.1.47902 WP_001282267.1.47928 WP_001282267.1.48019 WP_001282267.1.48100 WP_001282267.1.48114 WP_001282267.1.48134 WP_001282267.1.48139 WP_001282267.1.48190 WP_001282267.1.48218 WP_001282267.1.48242 WP_001282267.1.48247 WP_001282267.1.48253 WP_001282267.1.48292 WP_001282267.1.483 WP_001282267.1.48324 WP_001282267.1.48367 WP_001282267.1.48377 WP_001282267.1.48426 WP_001282267.1.48430 WP_001282267.1.48436 WP_001282267.1.48510 WP_001282267.1.4853 WP_001282267.1.48586 WP_001282267.1.4859 WP_001282267.1.48591 WP_001282267.1.48610 WP_001282267.1.48631 WP_001282267.1.48647 WP_001282267.1.48663 WP_001282267.1.48690 WP_001282267.1.48734 WP_001282267.1.48751 WP_001282267.1.48756 WP_001282267.1.48768 WP_001282267.1.48778 WP_001282267.1.48788 WP_001282267.1.48841 WP_001282267.1.48849 WP_001282267.1.4885 WP_001282267.1.48894 WP_001282267.1.48918 WP_001282267.1.48919 WP_001282267.1.48931 WP_001282267.1.48955 WP_001282267.1.48963 WP_001282267.1.48973 WP_001282267.1.49004 WP_001282267.1.49084 WP_001282267.1.49090 WP_001282267.1.49106 WP_001282267.1.49113 WP_001282267.1.49117 WP_001282267.1.49121 WP_001282267.1.4914 WP_001282267.1.49140 WP_001282267.1.49153 WP_001282267.1.49155 WP_001282267.1.49166 WP_001282267.1.49175 WP_001282267.1.49204 WP_001282267.1.49214 WP_001282267.1.49239 WP_001282267.1.49256 WP_001282267.1.49262 WP_001282267.1.49276 WP_001282267.1.49290 WP_001282267.1.49309 WP_001282267.1.49340 WP_001282267.1.49355 WP_001282267.1.49366 WP_001282267.1.49429 WP_001282267.1.49430 WP_001282267.1.49434 WP_001282267.1.49450 WP_001282267.1.49490 WP_001282267.1.49494 WP_001282267.1.495 WP_001282267.1.49515 WP_001282267.1.49545 WP_001282267.1.49572 WP_001282267.1.49602 WP_001282267.1.49626 WP_001282267.1.49686 WP_001282267.1.49703 WP_001282267.1.49769 WP_001282267.1.49780 WP_001282267.1.4979 WP_001282267.1.49790 WP_001282267.1.49803 WP_001282267.1.49805 WP_001282267.1.49846 WP_001282267.1.49848 WP_001282267.1.4991 WP_001282267.1.49929 WP_001282267.1.49947 WP_001282267.1.49959 WP_001282267.1.49997 WP_001282267.1.50 WP_001282267.1.50014 WP_001282267.1.50030 WP_001282267.1.50043 WP_001282267.1.50080 WP_001282267.1.50103 WP_001282267.1.50153 WP_001282267.1.50158 WP_001282267.1.50161 WP_001282267.1.50198 WP_001282267.1.50211 WP_001282267.1.50247 WP_001282267.1.50308 WP_001282267.1.50309 WP_001282267.1.50374 WP_001282267.1.50376 WP_001282267.1.50386 WP_001282267.1.50387 WP_001282267.1.50389 WP_001282267.1.50404 WP_001282267.1.50406 WP_001282267.1.50413 WP_001282267.1.50468 WP_001282267.1.50478 WP_001282267.1.50480 WP_001282267.1.5051 WP_001282267.1.50529 WP_001282267.1.50566 WP_001282267.1.50570 WP_001282267.1.50576 WP_001282267.1.5058 WP_001282267.1.50593 WP_001282267.1.50626 WP_001282267.1.50676 WP_001282267.1.50726 WP_001282267.1.50750 WP_001282267.1.50771 WP_001282267.1.50774 WP_001282267.1.50782 WP_001282267.1.50800 WP_001282267.1.50804 WP_001282267.1.50808 WP_001282267.1.50875 WP_001282267.1.5088 WP_001282267.1.50885 WP_001282267.1.509 WP_001282267.1.50908 WP_001282267.1.50918 WP_001282267.1.50929 WP_001282267.1.50941 WP_001282267.1.50970 WP_001282267.1.50999 WP_001282267.1.51014 WP_001282267.1.51022 WP_001282267.1.51036 WP_001282267.1.51040 WP_001282267.1.51048 WP_001282267.1.51066 WP_001282267.1.51100 WP_001282267.1.51117 WP_001282267.1.51131 WP_001282267.1.51134 WP_001282267.1.51139 WP_001282267.1.5114 WP_001282267.1.51179 WP_001282267.1.51182 WP_001282267.1.51186 WP_001282267.1.51224 WP_001282267.1.51227 WP_001282267.1.5125 WP_001282267.1.5127 WP_001282267.1.51305 WP_001282267.1.51315 WP_001282267.1.51331 WP_001282267.1.5136 WP_001282267.1.51394 WP_001282267.1.51419 WP_001282267.1.51474 WP_001282267.1.51487 WP_001282267.1.51488 WP_001282267.1.51519 WP_001282267.1.51598 WP_001282267.1.51613 WP_001282267.1.51634 WP_001282267.1.51644 WP_001282267.1.51649 WP_001282267.1.51686 WP_001282267.1.51700 WP_001282267.1.51704 WP_001282267.1.51724 WP_001282267.1.51734 WP_001282267.1.51756 WP_001282267.1.51831 WP_001282267.1.51838 WP_001282267.1.5185 WP_001282267.1.51863 WP_001282267.1.51910 WP_001282267.1.51911 WP_001282267.1.51932 WP_001282267.1.51935 WP_001282267.1.51989 WP_001282267.1.52057 WP_001282267.1.52101 WP_001282267.1.52114 WP_001282267.1.52121 WP_001282267.1.52123 WP_001282267.1.52129 WP_001282267.1.52156 WP_001282267.1.52170 WP_001282267.1.52191 WP_001282267.1.52202 WP_001282267.1.52209 WP_001282267.1.52255 WP_001282267.1.52336 WP_001282267.1.52339 WP_001282267.1.52346 WP_001282267.1.52353 WP_001282267.1.52361 WP_001282267.1.52456 WP_001282267.1.52469 WP_001282267.1.52571 WP_001282267.1.526 WP_001282267.1.52647 WP_001282267.1.52653 WP_001282267.1.52656 WP_001282267.1.52692 WP_001282267.1.52742 WP_001282267.1.52743 WP_001282267.1.52773 WP_001282267.1.52795 WP_001282267.1.52807 WP_001282267.1.52857 WP_001282267.1.52866 WP_001282267.1.52887 WP_001282267.1.52898 WP_001282267.1.52915 WP_001282267.1.52949 WP_001282267.1.52985 WP_001282267.1.5301 WP_001282267.1.53016 WP_001282267.1.53092 WP_001282267.1.53141 WP_001282267.1.53151 WP_001282267.1.53154 WP_001282267.1.53159 WP_001282267.1.53190 WP_001282267.1.53203 WP_001282267.1.53210 WP_001282267.1.53233 WP_001282267.1.53272 WP_001282267.1.53274 WP_001282267.1.53286 WP_001282267.1.53307 WP_001282267.1.53315 WP_001282267.1.53321 WP_001282267.1.53368 WP_001282267.1.53375 WP_001282267.1.53406 WP_001282267.1.53450 WP_001282267.1.53466 WP_001282267.1.5349 WP_001282267.1.53529 WP_001282267.1.53540 WP_001282267.1.53543 WP_001282267.1.53555 WP_001282267.1.53559 WP_001282267.1.5356 WP_001282267.1.53571 WP_001282267.1.5358 WP_001282267.1.53675 WP_001282267.1.53692 WP_001282267.1.53696 WP_001282267.1.53723 WP_001282267.1.5374 WP_001282267.1.53750 WP_001282267.1.53757 WP_001282267.1.53772 WP_001282267.1.53800 WP_001282267.1.53812 WP_001282267.1.53814 WP_001282267.1.53815 WP_001282267.1.53839 WP_001282267.1.53892 WP_001282267.1.53898 WP_001282267.1.53902 WP_001282267.1.53905 WP_001282267.1.5392 WP_001282267.1.53958 WP_001282267.1.53984 WP_001282267.1.54033 WP_001282267.1.54075 WP_001282267.1.54132 WP_001282267.1.54136 WP_001282267.1.5415 WP_001282267.1.54170 WP_001282267.1.54175 WP_001282267.1.54196 WP_001282267.1.54203 WP_001282267.1.54209 WP_001282267.1.54259 WP_001282267.1.54271 WP_001282267.1.54274 WP_001282267.1.5430 WP_001282267.1.54319 WP_001282267.1.54333 WP_001282267.1.54340 WP_001282267.1.54364 WP_001282267.1.54371 WP_001282267.1.54400 WP_001282267.1.54431 WP_001282267.1.54442 WP_001282267.1.54482 WP_001282267.1.54526 WP_001282267.1.54558 WP_001282267.1.54589 WP_001282267.1.54607 WP_001282267.1.5462 WP_001282267.1.54644 WP_001282267.1.54662 WP_001282267.1.54667 WP_001282267.1.54678 WP_001282267.1.54681 WP_001282267.1.54694 WP_001282267.1.54722 WP_001282267.1.54748 WP_001282267.1.54749 WP_001282267.1.54764 WP_001282267.1.54774 WP_001282267.1.5481 WP_001282267.1.54827 WP_001282267.1.5485 WP_001282267.1.54865 WP_001282267.1.54935 WP_001282267.1.54979 WP_001282267.1.54984 WP_001282267.1.55008 WP_001282267.1.55010 WP_001282267.1.55034 WP_001282267.1.55152 WP_001282267.1.55156 WP_001282267.1.55163 WP_001282267.1.55165 WP_001282267.1.55166 WP_001282267.1.55178 WP_001282267.1.55200 WP_001282267.1.55215 WP_001282267.1.5523 WP_001282267.1.55285 WP_001282267.1.55290 WP_001282267.1.55294 WP_001282267.1.55310 WP_001282267.1.55317 WP_001282267.1.55325 WP_001282267.1.55379 WP_001282267.1.5539 WP_001282267.1.55430 WP_001282267.1.55461 WP_001282267.1.55468 WP_001282267.1.55475 WP_001282267.1.55506 WP_001282267.1.5555 WP_001282267.1.55554 WP_001282267.1.5560 WP_001282267.1.55604 WP_001282267.1.55614 WP_001282267.1.55623 WP_001282267.1.55639 WP_001282267.1.55647 WP_001282267.1.55672 WP_001282267.1.55699 WP_001282267.1.55706 WP_001282267.1.55725 WP_001282267.1.55743 WP_001282267.1.55768 WP_001282267.1.55780 WP_001282267.1.55782 WP_001282267.1.55796 WP_001282267.1.55803 WP_001282267.1.55967 WP_001282267.1.55973 WP_001282267.1.56002 WP_001282267.1.56004 WP_001282267.1.56012 WP_001282267.1.56059 WP_001282267.1.56069 WP_001282267.1.56070 WP_001282267.1.56082 WP_001282267.1.56097 WP_001282267.1.56105 WP_001282267.1.56144 WP_001282267.1.56172 WP_001282267.1.5621 WP_001282267.1.56226 WP_001282267.1.56238 WP_001282267.1.56244 WP_001282267.1.56286 WP_001282267.1.56303 WP_001282267.1.56304 WP_001282267.1.56311 WP_001282267.1.56370 WP_001282267.1.56374 WP_001282267.1.56389 WP_001282267.1.56414 WP_001282267.1.56419 WP_001282267.1.56423 WP_001282267.1.56438 WP_001282267.1.56512 WP_001282267.1.56514 WP_001282267.1.56535 WP_001282267.1.56559 WP_001282267.1.56560 WP_001282267.1.56585 WP_001282267.1.56597 WP_001282267.1.56601 WP_001282267.1.56614 WP_001282267.1.56615 WP_001282267.1.56640 WP_001282267.1.56651 WP_001282267.1.56660 WP_001282267.1.56671 WP_001282267.1.56682 WP_001282267.1.56724 WP_001282267.1.56791 WP_001282267.1.56825 WP_001282267.1.56875 WP_001282267.1.56877 WP_001282267.1.56887 WP_001282267.1.56889 WP_001282267.1.56942 WP_001282267.1.56981 WP_001282267.1.57076 WP_001282267.1.57101 WP_001282267.1.57125 WP_001282267.1.57137 WP_001282267.1.57147 WP_001282267.1.57168 WP_001282267.1.57179 WP_001282267.1.57186 WP_001282267.1.57187 WP_001282267.1.57244 WP_001282267.1.57342 WP_001282267.1.57344 WP_001282267.1.57356 WP_001282267.1.57377 WP_001282267.1.57433 WP_001282267.1.57494 WP_001282267.1.57495 WP_001282267.1.57515 WP_001282267.1.57521 WP_001282267.1.57529 WP_001282267.1.57555 WP_001282267.1.57576 WP_001282267.1.57601 WP_001282267.1.57607 WP_001282267.1.5761 WP_001282267.1.57684 WP_001282267.1.57699 WP_001282267.1.57709 WP_001282267.1.5774 WP_001282267.1.57763 WP_001282267.1.57785 WP_001282267.1.57797 WP_001282267.1.57800 WP_001282267.1.5781 WP_001282267.1.57862 WP_001282267.1.57873 WP_001282267.1.57890 WP_001282267.1.57891 WP_001282267.1.57965 WP_001282267.1.57972 WP_001282267.1.57978 WP_001282267.1.58008 WP_001282267.1.5801 WP_001282267.1.58041 WP_001282267.1.58044 WP_001282267.1.58081 WP_001282267.1.5809 WP_001282267.1.58131 WP_001282267.1.58132 WP_001282267.1.58144 WP_001282267.1.58153 WP_001282267.1.58173 WP_001282267.1.58191 WP_001282267.1.58194 WP_001282267.1.58239 WP_001282267.1.58252 WP_001282267.1.58261 WP_001282267.1.58274 WP_001282267.1.58282 WP_001282267.1.58324 WP_001282267.1.58326 WP_001282267.1.58334 WP_001282267.1.58358 WP_001282267.1.5836 WP_001282267.1.58372 WP_001282267.1.58407 WP_001282267.1.58416 WP_001282267.1.58418 WP_001282267.1.58442 WP_001282267.1.5846 WP_001282267.1.58467 WP_001282267.1.58485 WP_001282267.1.58537 WP_001282267.1.58548 WP_001282267.1.58568 WP_001282267.1.5858 WP_001282267.1.58583 WP_001282267.1.58604 WP_001282267.1.58652 WP_001282267.1.58662 WP_001282267.1.58663 WP_001282267.1.58669 WP_001282267.1.58724 WP_001282267.1.58729 WP_001282267.1.58745 WP_001282267.1.5875 WP_001282267.1.5878 WP_001282267.1.58796 WP_001282267.1.58803 WP_001282267.1.58807 WP_001282267.1.58831 WP_001282267.1.58834 WP_001282267.1.58836 WP_001282267.1.58847 WP_001282267.1.5886 WP_001282267.1.58883 WP_001282267.1.58898 WP_001282267.1.58949 WP_001282267.1.58963 WP_001282267.1.58970 WP_001282267.1.58974 WP_001282267.1.59006 WP_001282267.1.59020 WP_001282267.1.59043 WP_001282267.1.59056 WP_001282267.1.59061 WP_001282267.1.59064 WP_001282267.1.59068 WP_001282267.1.59084 WP_001282267.1.59094 WP_001282267.1.59136 WP_001282267.1.59224 WP_001282267.1.59276 WP_001282267.1.59282 WP_001282267.1.5929 WP_001282267.1.59299 WP_001282267.1.59313 WP_001282267.1.59321 WP_001282267.1.59375 WP_001282267.1.59412 WP_001282267.1.59420 WP_001282267.1.59458 WP_001282267.1.59486 WP_001282267.1.5949 WP_001282267.1.59490 WP_001282267.1.59501 WP_001282267.1.59508 WP_001282267.1.59510 WP_001282267.1.59521 WP_001282267.1.59562 WP_001282267.1.59587 WP_001282267.1.59604 WP_001282267.1.59648 WP_001282267.1.59684 WP_001282267.1.5969 WP_001282267.1.59694 WP_001282267.1.59751 WP_001282267.1.59771 WP_001282267.1.5979 WP_001282267.1.59827 WP_001282267.1.59829 WP_001282267.1.59847 WP_001282267.1.59863 WP_001282267.1.5993 WP_001282267.1.59953 WP_001282267.1.59969 WP_001282267.1.59979 WP_001282267.1.59994 WP_001282267.1.60008 WP_001282267.1.60021 WP_001282267.1.60045 WP_001282267.1.60052 WP_001282267.1.60069 WP_001282267.1.60076 WP_001282267.1.60114 WP_001282267.1.60140 WP_001282267.1.60154 WP_001282267.1.60155 WP_001282267.1.60168 WP_001282267.1.60192 WP_001282267.1.60199 WP_001282267.1.60212 WP_001282267.1.60213 WP_001282267.1.60226 WP_001282267.1.60231 WP_001282267.1.60253 WP_001282267.1.60285 WP_001282267.1.60322 WP_001282267.1.60324 WP_001282267.1.60330 WP_001282267.1.60356 WP_001282267.1.60370 WP_001282267.1.60379 WP_001282267.1.6038 WP_001282267.1.60380 WP_001282267.1.6041 WP_001282267.1.60424 WP_001282267.1.60464 WP_001282267.1.60481 WP_001282267.1.605 WP_001282267.1.60503 WP_001282267.1.60507 WP_001282267.1.60545 WP_001282267.1.60561 WP_001282267.1.6058 WP_001282267.1.60584 WP_001282267.1.60597 WP_001282267.1.6060 WP_001282267.1.60622 WP_001282267.1.60661 WP_001282267.1.60676 WP_001282267.1.60708 WP_001282267.1.60725 WP_001282267.1.60760 WP_001282267.1.60772 WP_001282267.1.60783 WP_001282267.1.60792 WP_001282267.1.60794 WP_001282267.1.60807 WP_001282267.1.60809 WP_001282267.1.60855 WP_001282267.1.6086 WP_001282267.1.60863 WP_001282267.1.60874 WP_001282267.1.60882 WP_001282267.1.60889 WP_001282267.1.6090 WP_001282267.1.60941 WP_001282267.1.60950 WP_001282267.1.60976 WP_001282267.1.60988 WP_001282267.1.60990 WP_001282267.1.6104 WP_001282267.1.61044 WP_001282267.1.61045 WP_001282267.1.61076 WP_001282267.1.61078 WP_001282267.1.61087 WP_001282267.1.61114 WP_001282267.1.61123 WP_001282267.1.6114 WP_001282267.1.61146 WP_001282267.1.61147 WP_001282267.1.61168 WP_001282267.1.61184 WP_001282267.1.61200 WP_001282267.1.61201 WP_001282267.1.61210 WP_001282267.1.61218 WP_001282267.1.61232 WP_001282267.1.6129 WP_001282267.1.61296 WP_001282267.1.61309 WP_001282267.1.61345 WP_001282267.1.61357 WP_001282267.1.61417 WP_001282267.1.6143 WP_001282267.1.61434 WP_001282267.1.61511 WP_001282267.1.61539 WP_001282267.1.61542 WP_001282267.1.61553 WP_001282267.1.61574 WP_001282267.1.61582 WP_001282267.1.61609 WP_001282267.1.61649 WP_001282267.1.61652 WP_001282267.1.61662 WP_001282267.1.61694 WP_001282267.1.61697 WP_001282267.1.61712 WP_001282267.1.61714 WP_001282267.1.61730 WP_001282267.1.61732 WP_001282267.1.61737 WP_001282267.1.61743 WP_001282267.1.61783 WP_001282267.1.61809 WP_001282267.1.61857 WP_001282267.1.61877 WP_001282267.1.61918 WP_001282267.1.61920 WP_001282267.1.61922 WP_001282267.1.61924 WP_001282267.1.61952 WP_001282267.1.61968 WP_001282267.1.62007 WP_001282267.1.62020 WP_001282267.1.62025 WP_001282267.1.62063 WP_001282267.1.6209 WP_001282267.1.62120 WP_001282267.1.62122 WP_001282267.1.62124 WP_001282267.1.62142 WP_001282267.1.62144 WP_001282267.1.62195 WP_001282267.1.62199 WP_001282267.1.62204 WP_001282267.1.62219 WP_001282267.1.62223 WP_001282267.1.62241 WP_001282267.1.62257 WP_001282267.1.62302 WP_001282267.1.62304 WP_001282267.1.62314 WP_001282267.1.62323 WP_001282267.1.62333 WP_001282267.1.62338 WP_001282267.1.62344 WP_001282267.1.62364 WP_001282267.1.62374 WP_001282267.1.62380 WP_001282267.1.62403 WP_001282267.1.62411 WP_001282267.1.62436 WP_001282267.1.62475 WP_001282267.1.62504 WP_001282267.1.62522 WP_001282267.1.6253 WP_001282267.1.62536 WP_001282267.1.62564 WP_001282267.1.62640 WP_001282267.1.62677 WP_001282267.1.62686 WP_001282267.1.62693 WP_001282267.1.62725 WP_001282267.1.62751 WP_001282267.1.62798 WP_001282267.1.62825 WP_001282267.1.62853 WP_001282267.1.62903 WP_001282267.1.62910 WP_001282267.1.62913 WP_001282267.1.62932 WP_001282267.1.62955 WP_001282267.1.62960 WP_001282267.1.62976 WP_001282267.1.63016 WP_001282267.1.63025 WP_001282267.1.63069 WP_001282267.1.63087 WP_001282267.1.63118 WP_001282267.1.63135 WP_001282267.1.63150 WP_001282267.1.63169 WP_001282267.1.63181 WP_001282267.1.63203 WP_001282267.1.63243 WP_001282267.1.63256 WP_001282267.1.63290 WP_001282267.1.63297 WP_001282267.1.63382 WP_001282267.1.63422 WP_001282267.1.63432 WP_001282267.1.63448 WP_001282267.1.63455 WP_001282267.1.63461 WP_001282267.1.63479 WP_001282267.1.63514 WP_001282267.1.63532 WP_001282267.1.6357 WP_001282267.1.63577 WP_001282267.1.63583 WP_001282267.1.63592 WP_001282267.1.63633 WP_001282267.1.63663 WP_001282267.1.63664 WP_001282267.1.6367 WP_001282267.1.63690 WP_001282267.1.63718 WP_001282267.1.63736 WP_001282267.1.6375 WP_001282267.1.63757 WP_001282267.1.63797 WP_001282267.1.63816 WP_001282267.1.63834 WP_001282267.1.63860 WP_001282267.1.63864 WP_001282267.1.63866 WP_001282267.1.63876 WP_001282267.1.6389 WP_001282267.1.63901 WP_001282267.1.63955 WP_001282267.1.63958 WP_001282267.1.63963 WP_001282267.1.64018 WP_001282267.1.64032 WP_001282267.1.64046 WP_001282267.1.64087 WP_001282267.1.6415 WP_001282267.1.64208 WP_001282267.1.6423 WP_001282267.1.64244 WP_001282267.1.64293 WP_001282267.1.64294 WP_001282267.1.64332 WP_001282267.1.64374 WP_001282267.1.64376 WP_001282267.1.64387 WP_001282267.1.644 WP_001282267.1.64403 WP_001282267.1.64471 WP_001282267.1.64501 WP_001282267.1.6451 WP_001282267.1.64538 WP_001282267.1.64632 WP_001282267.1.64645 WP_001282267.1.64648 WP_001282267.1.64649 WP_001282267.1.64654 WP_001282267.1.64662 WP_001282267.1.64663 WP_001282267.1.64702 WP_001282267.1.64709 WP_001282267.1.64710 WP_001282267.1.64744 WP_001282267.1.64757 WP_001282267.1.64758 WP_001282267.1.64763 WP_001282267.1.64781 WP_001282267.1.64798 WP_001282267.1.64817 WP_001282267.1.64831 WP_001282267.1.64847 WP_001282267.1.6487 WP_001282267.1.6489 WP_001282267.1.64891 WP_001282267.1.64894 WP_001282267.1.64919 WP_001282267.1.64920 WP_001282267.1.64974 WP_001282267.1.65018 WP_001282267.1.65028 WP_001282267.1.65052 WP_001282267.1.65054 WP_001282267.1.65075 WP_001282267.1.6514 WP_001282267.1.65168 WP_001282267.1.65171 WP_001282267.1.65172 WP_001282267.1.65191 WP_001282267.1.65200 WP_001282267.1.65211 WP_001282267.1.65218 WP_001282267.1.65226 WP_001282267.1.65238 WP_001282267.1.65248 WP_001282267.1.65249 WP_001282267.1.65266 WP_001282267.1.65269 WP_001282267.1.65348 WP_001282267.1.6535 WP_001282267.1.65363 WP_001282267.1.65394 WP_001282267.1.65395 WP_001282267.1.65437 WP_001282267.1.65459 WP_001282267.1.65463 WP_001282267.1.65474 WP_001282267.1.65475 WP_001282267.1.65487 WP_001282267.1.6549 WP_001282267.1.65499 WP_001282267.1.6554 WP_001282267.1.6561 WP_001282267.1.65633 WP_001282267.1.6565 WP_001282267.1.65650 WP_001282267.1.65696 WP_001282267.1.65697 WP_001282267.1.65699 WP_001282267.1.65737 WP_001282267.1.6575 WP_001282267.1.65755 WP_001282267.1.65782 WP_001282267.1.65790 WP_001282267.1.65812 WP_001282267.1.65818 WP_001282267.1.65846 WP_001282267.1.65849 WP_001282267.1.65863 WP_001282267.1.6594 WP_001282267.1.65940 WP_001282267.1.65945 WP_001282267.1.65956 WP_001282267.1.65968 WP_001282267.1.65985 WP_001282267.1.66021 WP_001282267.1.66031 WP_001282267.1.66049 WP_001282267.1.66052 WP_001282267.1.66064 WP_001282267.1.66109 WP_001282267.1.66129 WP_001282267.1.66145 WP_001282267.1.66183 WP_001282267.1.6620 WP_001282267.1.66216 WP_001282267.1.66234 WP_001282267.1.66272 WP_001282267.1.66273 WP_001282267.1.6630 WP_001282267.1.66314 WP_001282267.1.66324 WP_001282267.1.66330 WP_001282267.1.6634 WP_001282267.1.66358 WP_001282267.1.66361 WP_001282267.1.66362 WP_001282267.1.66365 WP_001282267.1.66368 WP_001282267.1.6638 WP_001282267.1.6640 WP_001282267.1.66480 WP_001282267.1.66492 WP_001282267.1.66506 WP_001282267.1.66600 WP_001282267.1.66665 WP_001282267.1.66678 WP_001282267.1.66681 WP_001282267.1.66684 WP_001282267.1.66698 WP_001282267.1.66755 WP_001282267.1.66759 WP_001282267.1.6680 WP_001282267.1.66801 WP_001282267.1.66824 WP_001282267.1.66825 WP_001282267.1.66834 WP_001282267.1.66860 WP_001282267.1.66876 WP_001282267.1.66901 WP_001282267.1.66953 WP_001282267.1.66955 WP_001282267.1.66962 WP_001282267.1.66981 WP_001282267.1.67024 WP_001282267.1.67037 WP_001282267.1.67042 WP_001282267.1.67045 WP_001282267.1.67100 WP_001282267.1.67101 WP_001282267.1.67143 WP_001282267.1.67181 WP_001282267.1.67201 WP_001282267.1.67211 WP_001282267.1.67228 WP_001282267.1.67235 WP_001282267.1.67237 WP_001282267.1.67268 WP_001282267.1.67336 WP_001282267.1.67339 WP_001282267.1.67347 WP_001282267.1.67387 WP_001282267.1.6739 WP_001282267.1.67394 WP_001282267.1.67397 WP_001282267.1.67403 WP_001282267.1.67430 WP_001282267.1.67442 WP_001282267.1.67465 WP_001282267.1.67539 WP_001282267.1.67552 WP_001282267.1.67556 WP_001282267.1.67576 WP_001282267.1.67604 WP_001282267.1.67617 WP_001282267.1.67619 WP_001282267.1.67625 WP_001282267.1.67627 WP_001282267.1.67633 WP_001282267.1.67641 WP_001282267.1.67657 WP_001282267.1.67673 WP_001282267.1.67682 WP_001282267.1.67700 WP_001282267.1.67718 WP_001282267.1.67729 WP_001282267.1.67772 WP_001282267.1.67774 WP_001282267.1.67814 WP_001282267.1.67820 WP_001282267.1.67825 WP_001282267.1.67829 WP_001282267.1.67887 WP_001282267.1.67905 WP_001282267.1.67910 WP_001282267.1.67942 WP_001282267.1.67954 WP_001282267.1.67969 WP_001282267.1.67977 WP_001282267.1.68 WP_001282267.1.68036 WP_001282267.1.68043 WP_001282267.1.68073 WP_001282267.1.68075 WP_001282267.1.68105 WP_001282267.1.68113 WP_001282267.1.68115 WP_001282267.1.68131 WP_001282267.1.68147 WP_001282267.1.68182 WP_001282267.1.6819 WP_001282267.1.68201 WP_001282267.1.68206 WP_001282267.1.68210 WP_001282267.1.6827 WP_001282267.1.68275 WP_001282267.1.68285 WP_001282267.1.68359 WP_001282267.1.68401 WP_001282267.1.68420 WP_001282267.1.68477 WP_001282267.1.68478 WP_001282267.1.6849 WP_001282267.1.685 WP_001282267.1.68514 WP_001282267.1.68547 WP_001282267.1.68564 WP_001282267.1.68589 WP_001282267.1.68591 WP_001282267.1.68655 WP_001282267.1.68656 WP_001282267.1.68688 WP_001282267.1.68742 WP_001282267.1.68770 WP_001282267.1.68778 WP_001282267.1.68787 WP_001282267.1.68809 WP_001282267.1.68816 WP_001282267.1.68894 WP_001282267.1.68914 WP_001282267.1.68928 WP_001282267.1.68975 WP_001282267.1.69001 WP_001282267.1.69006 WP_001282267.1.6904 WP_001282267.1.69053 WP_001282267.1.6913 WP_001282267.1.69146 WP_001282267.1.69151 WP_001282267.1.69170 WP_001282267.1.69210 WP_001282267.1.69255 WP_001282267.1.69270 WP_001282267.1.69282 WP_001282267.1.69296 WP_001282267.1.69320 WP_001282267.1.69359 WP_001282267.1.69376 WP_001282267.1.69385 WP_001282267.1.69396 WP_001282267.1.69397 WP_001282267.1.69433 WP_001282267.1.69466 WP_001282267.1.69515 WP_001282267.1.6954 WP_001282267.1.69554 WP_001282267.1.69564 WP_001282267.1.69588 WP_001282267.1.69597 WP_001282267.1.69611 WP_001282267.1.69642 WP_001282267.1.69644 WP_001282267.1.69656 WP_001282267.1.69657 WP_001282267.1.69690 WP_001282267.1.69704 WP_001282267.1.69710 WP_001282267.1.69754 WP_001282267.1.69758 WP_001282267.1.69760 WP_001282267.1.69807 WP_001282267.1.69817 WP_001282267.1.69839 WP_001282267.1.69923 WP_001282267.1.69948 WP_001282267.1.69953 WP_001282267.1.70003 WP_001282267.1.70010 WP_001282267.1.70047 WP_001282267.1.70049 WP_001282267.1.70058 WP_001282267.1.70061 WP_001282267.1.7016 WP_001282267.1.70169 WP_001282267.1.70183 WP_001282267.1.70205 WP_001282267.1.7021 WP_001282267.1.70240 WP_001282267.1.70241 WP_001282267.1.70249 WP_001282267.1.70261 WP_001282267.1.70269 WP_001282267.1.70281 WP_001282267.1.70289 WP_001282267.1.70314 WP_001282267.1.70327 WP_001282267.1.7033 WP_001282267.1.70355 WP_001282267.1.70427 WP_001282267.1.70433 WP_001282267.1.7044 WP_001282267.1.70447 WP_001282267.1.70485 WP_001282267.1.70488 WP_001282267.1.70491 WP_001282267.1.70545 WP_001282267.1.70580 WP_001282267.1.7060 WP_001282267.1.70623 WP_001282267.1.70643 WP_001282267.1.70662 WP_001282267.1.70671 WP_001282267.1.70679 WP_001282267.1.70683 WP_001282267.1.70685 WP_001282267.1.70708 WP_001282267.1.70717 WP_001282267.1.70731 WP_001282267.1.70732 WP_001282267.1.70733 WP_001282267.1.70761 WP_001282267.1.70772 WP_001282267.1.70845 WP_001282267.1.70846 WP_001282267.1.70869 WP_001282267.1.70883 WP_001282267.1.70899 WP_001282267.1.70922 WP_001282267.1.7093 WP_001282267.1.70948 WP_001282267.1.70959 WP_001282267.1.70969 WP_001282267.1.70981 WP_001282267.1.70986 WP_001282267.1.70995 WP_001282267.1.71007 WP_001282267.1.71010 WP_001282267.1.71023 WP_001282267.1.71039 WP_001282267.1.71057 WP_001282267.1.71069 WP_001282267.1.71081 WP_001282267.1.71088 WP_001282267.1.71116 WP_001282267.1.71117 WP_001282267.1.71120 WP_001282267.1.71146 WP_001282267.1.71165 WP_001282267.1.71171 WP_001282267.1.71186 WP_001282267.1.71188 WP_001282267.1.71202 WP_001282267.1.71243 WP_001282267.1.71299 WP_001282267.1.71306 WP_001282267.1.71337 WP_001282267.1.7134 WP_001282267.1.71363 WP_001282267.1.71368 WP_001282267.1.71378 WP_001282267.1.714 WP_001282267.1.71401 WP_001282267.1.7142 WP_001282267.1.71450 WP_001282267.1.71452 WP_001282267.1.71455 WP_001282267.1.71456 WP_001282267.1.71481 WP_001282267.1.71487 WP_001282267.1.71500 WP_001282267.1.71523 WP_001282267.1.71542 WP_001282267.1.71566 WP_001282267.1.71583 WP_001282267.1.71636 WP_001282267.1.71640 WP_001282267.1.71651 WP_001282267.1.71653 WP_001282267.1.71702 WP_001282267.1.71716 WP_001282267.1.71746 WP_001282267.1.71750 WP_001282267.1.71798 WP_001282267.1.71845 WP_001282267.1.71848 WP_001282267.1.71872 WP_001282267.1.71881 WP_001282267.1.71908 WP_001282267.1.71923 WP_001282267.1.71929 WP_001282267.1.71941 WP_001282267.1.71950 WP_001282267.1.71952 WP_001282267.1.71954 WP_001282267.1.71973 WP_001282267.1.71985 WP_001282267.1.72003 WP_001282267.1.72068 WP_001282267.1.72073 WP_001282267.1.72105 WP_001282267.1.72121 WP_001282267.1.72203 WP_001282267.1.72243 WP_001282267.1.72254 WP_001282267.1.72269 WP_001282267.1.72281 WP_001282267.1.72283 WP_001282267.1.72350 WP_001282267.1.72376 WP_001282267.1.72383 WP_001282267.1.72403 WP_001282267.1.7243 WP_001282267.1.72438 WP_001282267.1.72461 WP_001282267.1.72527 WP_001282267.1.7255 WP_001282267.1.72594 WP_001282267.1.72631 WP_001282267.1.72638 WP_001282267.1.72667 WP_001282267.1.72674 WP_001282267.1.72724 WP_001282267.1.72728 WP_001282267.1.72789 WP_001282267.1.72793 WP_001282267.1.72797 WP_001282267.1.72828 WP_001282267.1.72871 WP_001282267.1.72887 WP_001282267.1.72892 WP_001282267.1.72944 WP_001282267.1.72946 WP_001282267.1.72969 WP_001282267.1.72975 WP_001282267.1.72987 WP_001282267.1.73052 WP_001282267.1.73102 WP_001282267.1.7311 WP_001282267.1.73114 WP_001282267.1.73125 WP_001282267.1.7315 WP_001282267.1.7316 WP_001282267.1.73177 WP_001282267.1.73180 WP_001282267.1.73200 WP_001282267.1.73258 WP_001282267.1.73270 WP_001282267.1.73285 WP_001282267.1.7332 WP_001282267.1.73328 WP_001282267.1.7333 WP_001282267.1.7334 WP_001282267.1.73352 WP_001282267.1.73377 WP_001282267.1.73389 WP_001282267.1.73425 WP_001282267.1.73461 WP_001282267.1.73481 WP_001282267.1.73488 WP_001282267.1.73504 WP_001282267.1.73512 WP_001282267.1.7353 WP_001282267.1.73544 WP_001282267.1.7356 WP_001282267.1.73561 WP_001282267.1.73581 WP_001282267.1.73598 WP_001282267.1.7361 WP_001282267.1.73617 WP_001282267.1.73648 WP_001282267.1.73669 WP_001282267.1.7374 WP_001282267.1.73753 WP_001282267.1.73758 WP_001282267.1.73768 WP_001282267.1.73794 WP_001282267.1.73847 WP_001282267.1.73849 WP_001282267.1.7386 WP_001282267.1.7387 WP_001282267.1.73924 WP_001282267.1.73945 WP_001282267.1.73948 WP_001282267.1.73956 WP_001282267.1.73958 WP_001282267.1.73965 WP_001282267.1.73999 WP_001282267.1.74024 WP_001282267.1.74028 WP_001282267.1.74029 WP_001282267.1.74030 WP_001282267.1.74038 WP_001282267.1.74040 WP_001282267.1.74043 WP_001282267.1.74058 WP_001282267.1.74070 WP_001282267.1.74077 WP_001282267.1.74089 WP_001282267.1.74135 WP_001282267.1.74181 WP_001282267.1.74191 WP_001282267.1.74214 WP_001282267.1.74241 WP_001282267.1.74285 WP_001282267.1.7430 WP_001282267.1.74317 WP_001282267.1.7433 WP_001282267.1.74379 WP_001282267.1.74410 WP_001282267.1.74415 WP_001282267.1.74418 WP_001282267.1.74422 WP_001282267.1.7444 WP_001282267.1.74454 WP_001282267.1.74466 WP_001282267.1.74469 WP_001282267.1.745 WP_001282267.1.74500 WP_001282267.1.74529 WP_001282267.1.74545 WP_001282267.1.74616 WP_001282267.1.74621 WP_001282267.1.74647 WP_001282267.1.74677 WP_001282267.1.74699 WP_001282267.1.74741 WP_001282267.1.74745 WP_001282267.1.74757 WP_001282267.1.74806 WP_001282267.1.74807 WP_001282267.1.74826 WP_001282267.1.74831 WP_001282267.1.74884 WP_001282267.1.74894 WP_001282267.1.7491 WP_001282267.1.74929 WP_001282267.1.74939 WP_001282267.1.74946 WP_001282267.1.74973 WP_001282267.1.7507 WP_001282267.1.75089 WP_001282267.1.75116 WP_001282267.1.75129 WP_001282267.1.75168 WP_001282267.1.75187 WP_001282267.1.75237 WP_001282267.1.75273 WP_001282267.1.75288 WP_001282267.1.75296 WP_001282267.1.75301 WP_001282267.1.75334 WP_001282267.1.75362 WP_001282267.1.75371 WP_001282267.1.75385 WP_001282267.1.75392 WP_001282267.1.75413 WP_001282267.1.7543 WP_001282267.1.75433 WP_001282267.1.75494 WP_001282267.1.75532 WP_001282267.1.75565 WP_001282267.1.75585 WP_001282267.1.75593 WP_001282267.1.75610 WP_001282267.1.75626 WP_001282267.1.75633 WP_001282267.1.75664 WP_001282267.1.75703 WP_001282267.1.75718 WP_001282267.1.75740 WP_001282267.1.75745 WP_001282267.1.75760 WP_001282267.1.75764 WP_001282267.1.75828 WP_001282267.1.75837 WP_001282267.1.75844 WP_001282267.1.75873 WP_001282267.1.75874 WP_001282267.1.75884 WP_001282267.1.75886 WP_001282267.1.75898 WP_001282267.1.75932 WP_001282267.1.75945 WP_001282267.1.75957 WP_001282267.1.76 WP_001282267.1.76020 WP_001282267.1.76024 WP_001282267.1.76081 WP_001282267.1.76102 WP_001282267.1.76115 WP_001282267.1.76116 WP_001282267.1.76122 WP_001282267.1.76156 WP_001282267.1.76164 WP_001282267.1.76170 WP_001282267.1.76186 WP_001282267.1.76252 WP_001282267.1.76256 WP_001282267.1.7629 WP_001282267.1.76327 WP_001282267.1.7633 WP_001282267.1.76339 WP_001282267.1.7634 WP_001282267.1.76366 WP_001282267.1.76417 WP_001282267.1.76434 WP_001282267.1.76445 WP_001282267.1.7646 WP_001282267.1.76471 WP_001282267.1.76510 WP_001282267.1.76532 WP_001282267.1.76558 WP_001282267.1.76572 WP_001282267.1.7660 WP_001282267.1.76641 WP_001282267.1.76651 WP_001282267.1.76653 WP_001282267.1.76673 WP_001282267.1.76706 WP_001282267.1.76721 WP_001282267.1.76724 WP_001282267.1.76756 WP_001282267.1.76760 WP_001282267.1.76788 WP_001282267.1.76799 WP_001282267.1.7684 WP_001282267.1.76854 WP_001282267.1.76875 WP_001282267.1.76880 WP_001282267.1.76899 WP_001282267.1.76916 WP_001282267.1.76932 WP_001282267.1.76973 WP_001282267.1.76988 WP_001282267.1.77016 WP_001282267.1.77038 WP_001282267.1.77047 WP_001282267.1.77080 WP_001282267.1.77087 WP_001282267.1.77090 WP_001282267.1.77111 WP_001282267.1.7712 WP_001282267.1.77177 WP_001282267.1.77180 WP_001282267.1.77193 WP_001282267.1.77241 WP_001282267.1.77244 WP_001282267.1.77267 WP_001282267.1.77292 WP_001282267.1.77299 WP_001282267.1.77313 WP_001282267.1.77349 WP_001282267.1.77384 WP_001282267.1.77414 WP_001282267.1.77431 WP_001282267.1.77440 WP_001282267.1.77501 WP_001282267.1.77512 WP_001282267.1.77513 WP_001282267.1.77514 WP_001282267.1.77529 WP_001282267.1.77549 WP_001282267.1.77563 WP_001282267.1.77596 WP_001282267.1.77629 WP_001282267.1.77646 WP_001282267.1.77653 WP_001282267.1.77692 WP_001282267.1.77702 WP_001282267.1.77710 WP_001282267.1.77713 WP_001282267.1.7772 WP_001282267.1.7782 WP_001282267.1.77825 WP_001282267.1.77837 WP_001282267.1.7784 WP_001282267.1.77851 WP_001282267.1.77898 WP_001282267.1.77900 WP_001282267.1.77918 WP_001282267.1.77923 WP_001282267.1.77960 WP_001282267.1.77975 WP_001282267.1.78033 WP_001282267.1.78035 WP_001282267.1.78048 WP_001282267.1.78053 WP_001282267.1.78076 WP_001282267.1.78096 WP_001282267.1.78100 WP_001282267.1.78107 WP_001282267.1.78110 WP_001282267.1.78120 WP_001282267.1.7814 WP_001282267.1.78166 WP_001282267.1.78170 WP_001282267.1.78192 WP_001282267.1.78195 WP_001282267.1.78259 WP_001282267.1.78291 WP_001282267.1.78309 WP_001282267.1.78320 WP_001282267.1.78352 WP_001282267.1.78372 WP_001282267.1.78382 WP_001282267.1.78383 WP_001282267.1.78388 WP_001282267.1.78407 WP_001282267.1.78410 WP_001282267.1.78495 WP_001282267.1.78496 WP_001282267.1.7861 WP_001282267.1.78618 WP_001282267.1.7862 WP_001282267.1.78626 WP_001282267.1.78661 WP_001282267.1.78673 WP_001282267.1.78674 WP_001282267.1.78676 WP_001282267.1.78715 WP_001282267.1.78735 WP_001282267.1.78761 WP_001282267.1.78771 WP_001282267.1.78789 WP_001282267.1.78802 WP_001282267.1.78830 WP_001282267.1.78835 WP_001282267.1.78838 WP_001282267.1.78862 WP_001282267.1.78871 WP_001282267.1.78874 WP_001282267.1.78881 WP_001282267.1.789 WP_001282267.1.7891 WP_001282267.1.78918 WP_001282267.1.78930 WP_001282267.1.78959 WP_001282267.1.78993 WP_001282267.1.79011 WP_001282267.1.79012 WP_001282267.1.79069 WP_001282267.1.79074 WP_001282267.1.79081 WP_001282267.1.79098 WP_001282267.1.79140 WP_001282267.1.79151 WP_001282267.1.79155 WP_001282267.1.79164 WP_001282267.1.79167 WP_001282267.1.79203 WP_001282267.1.79204 WP_001282267.1.79280 WP_001282267.1.79335 WP_001282267.1.79397 WP_001282267.1.79427 WP_001282267.1.79456 WP_001282267.1.79462 WP_001282267.1.79466 WP_001282267.1.79472 WP_001282267.1.79490 WP_001282267.1.79495 WP_001282267.1.79529 WP_001282267.1.79531 WP_001282267.1.79532 WP_001282267.1.79547 WP_001282267.1.79570 WP_001282267.1.79635 WP_001282267.1.7964 WP_001282267.1.79642 WP_001282267.1.79645 WP_001282267.1.79654 WP_001282267.1.79659 WP_001282267.1.79668 WP_001282267.1.7970 WP_001282267.1.79708 WP_001282267.1.79722 WP_001282267.1.79734 WP_001282267.1.79772 WP_001282267.1.7979 WP_001282267.1.79832 WP_001282267.1.79845 WP_001282267.1.79867 WP_001282267.1.79880 WP_001282267.1.79916 WP_001282267.1.79934 WP_001282267.1.79942 WP_001282267.1.79945 WP_001282267.1.79974 WP_001282267.1.79977 WP_001282267.1.80045 WP_001282267.1.80065 WP_001282267.1.80077 WP_001282267.1.80103 WP_001282267.1.80137 WP_001282267.1.80182 WP_001282267.1.80236 WP_001282267.1.8024 WP_001282267.1.80273 WP_001282267.1.80282 WP_001282267.1.80293 WP_001282267.1.80296 WP_001282267.1.80307 WP_001282267.1.80354 WP_001282267.1.80366 WP_001282267.1.80368 WP_001282267.1.80386 WP_001282267.1.80400 WP_001282267.1.80462 WP_001282267.1.80473 WP_001282267.1.8049 WP_001282267.1.80492 WP_001282267.1.80496 WP_001282267.1.80569 WP_001282267.1.80629 WP_001282267.1.80638 WP_001282267.1.80664 WP_001282267.1.80696 WP_001282267.1.80725 WP_001282267.1.80741 WP_001282267.1.80780 WP_001282267.1.80803 WP_001282267.1.80819 WP_001282267.1.80827 WP_001282267.1.80831 WP_001282267.1.80850 WP_001282267.1.80857 WP_001282267.1.80868 WP_001282267.1.80881 WP_001282267.1.80927 WP_001282267.1.80939 WP_001282267.1.80959 WP_001282267.1.8096 WP_001282267.1.80973 WP_001282267.1.80984 WP_001282267.1.81037 WP_001282267.1.81041 WP_001282267.1.81067 WP_001282267.1.81069 WP_001282267.1.81084 WP_001282267.1.81107 WP_001282267.1.81118 WP_001282267.1.81131 WP_001282267.1.81149 WP_001282267.1.81175 WP_001282267.1.81187 WP_001282267.1.8119 WP_001282267.1.81193 WP_001282267.1.81231 WP_001282267.1.81262 WP_001282267.1.81268 WP_001282267.1.81269 WP_001282267.1.81271 WP_001282267.1.81275 WP_001282267.1.81302 WP_001282267.1.81305 WP_001282267.1.8131 WP_001282267.1.81320 WP_001282267.1.81328 WP_001282267.1.81333 WP_001282267.1.81342 WP_001282267.1.81354 WP_001282267.1.81364 WP_001282267.1.81409 WP_001282267.1.81425 WP_001282267.1.81494 WP_001282267.1.81528 WP_001282267.1.81548 WP_001282267.1.81557 WP_001282267.1.81568 WP_001282267.1.81676 WP_001282267.1.8168 WP_001282267.1.81681 WP_001282267.1.8170 WP_001282267.1.81735 WP_001282267.1.81736 WP_001282267.1.81743 WP_001282267.1.81746 WP_001282267.1.81750 WP_001282267.1.81760 WP_001282267.1.81763 WP_001282267.1.81785 WP_001282267.1.81798 WP_001282267.1.81855 WP_001282267.1.81902 WP_001282267.1.81921 WP_001282267.1.81931 WP_001282267.1.81936 WP_001282267.1.81949 WP_001282267.1.8196 WP_001282267.1.81974 WP_001282267.1.81977 WP_001282267.1.82037 WP_001282267.1.82070 WP_001282267.1.82076 WP_001282267.1.82099 WP_001282267.1.82131 WP_001282267.1.82144 WP_001282267.1.82156 WP_001282267.1.8218 WP_001282267.1.82180 WP_001282267.1.82192 WP_001282267.1.82201 WP_001282267.1.82214 WP_001282267.1.82225 WP_001282267.1.82232 WP_001282267.1.82258 WP_001282267.1.82337 WP_001282267.1.8236 WP_001282267.1.82369 WP_001282267.1.82395 WP_001282267.1.8240 WP_001282267.1.82408 WP_001282267.1.82416 WP_001282267.1.8242 WP_001282267.1.82456 WP_001282267.1.82464 WP_001282267.1.82465 WP_001282267.1.82473 WP_001282267.1.82479 WP_001282267.1.82503 WP_001282267.1.82515 WP_001282267.1.82529 WP_001282267.1.82530 WP_001282267.1.82553 WP_001282267.1.82562 WP_001282267.1.82570 WP_001282267.1.82584 WP_001282267.1.82636 WP_001282267.1.82646 WP_001282267.1.82648 WP_001282267.1.82670 WP_001282267.1.82676 WP_001282267.1.82692 WP_001282267.1.82731 WP_001282267.1.82761 WP_001282267.1.82812 WP_001282267.1.8282 WP_001282267.1.82850 WP_001282267.1.82872 WP_001282267.1.82908 WP_001282267.1.8294 WP_001282267.1.82944 WP_001282267.1.82956 WP_001282267.1.82959 WP_001282267.1.83007 WP_001282267.1.8304 WP_001282267.1.83092 WP_001282267.1.83128 WP_001282267.1.83139 WP_001282267.1.83163 WP_001282267.1.83180 WP_001282267.1.83221 WP_001282267.1.83229 WP_001282267.1.83235 WP_001282267.1.83252 WP_001282267.1.83258 WP_001282267.1.83280 WP_001282267.1.83290 WP_001282267.1.83305 WP_001282267.1.83333 WP_001282267.1.83360 WP_001282267.1.83382 WP_001282267.1.83413 WP_001282267.1.83491 WP_001282267.1.83523 WP_001282267.1.8354 WP_001282267.1.83598 WP_001282267.1.83651 WP_001282267.1.83657 WP_001282267.1.83677 WP_001282267.1.83710 WP_001282267.1.83721 WP_001282267.1.83739 WP_001282267.1.8375 WP_001282267.1.83760 WP_001282267.1.83806 WP_001282267.1.83923 WP_001282267.1.83994 WP_001282267.1.83995 WP_001282267.1.84 WP_001282267.1.84031 WP_001282267.1.8406 WP_001282267.1.84076 WP_001282267.1.84077 WP_001282267.1.84103 WP_001282267.1.84110 WP_001282267.1.84127 WP_001282267.1.84150 WP_001282267.1.84179 WP_001282267.1.84209 WP_001282267.1.84230 WP_001282267.1.84252 WP_001282267.1.84283 WP_001282267.1.84291 WP_001282267.1.8431 WP_001282267.1.84325 WP_001282267.1.84345 WP_001282267.1.84369 WP_001282267.1.84392 WP_001282267.1.84397 WP_001282267.1.84401 WP_001282267.1.8441 WP_001282267.1.84435 WP_001282267.1.84523 WP_001282267.1.84532 WP_001282267.1.84554 WP_001282267.1.84567 WP_001282267.1.84631 WP_001282267.1.84659 WP_001282267.1.84711 WP_001282267.1.84727 WP_001282267.1.84744 WP_001282267.1.84745 WP_001282267.1.84773 WP_001282267.1.84814 WP_001282267.1.84872 WP_001282267.1.84879 WP_001282267.1.84899 WP_001282267.1.84945 WP_001282267.1.84967 WP_001282267.1.8497 WP_001282267.1.85004 WP_001282267.1.8502 WP_001282267.1.85039 WP_001282267.1.85040 WP_001282267.1.85094 WP_001282267.1.85134 WP_001282267.1.85153 WP_001282267.1.85178 WP_001282267.1.85180 WP_001282267.1.85190 WP_001282267.1.85192 WP_001282267.1.85217 WP_001282267.1.85273 WP_001282267.1.8533 WP_001282267.1.85338 WP_001282267.1.85339 WP_001282267.1.85408 WP_001282267.1.85433 WP_001282267.1.8545 WP_001282267.1.85481 WP_001282267.1.85483 WP_001282267.1.85511 WP_001282267.1.85512 WP_001282267.1.85541 WP_001282267.1.8556 WP_001282267.1.85568 WP_001282267.1.8557 WP_001282267.1.85606 WP_001282267.1.85615 WP_001282267.1.85617 WP_001282267.1.85635 WP_001282267.1.85646 WP_001282267.1.85654 WP_001282267.1.85663 WP_001282267.1.85665 WP_001282267.1.85669 WP_001282267.1.85671 WP_001282267.1.85672 WP_001282267.1.85688 WP_001282267.1.85703 WP_001282267.1.85723 WP_001282267.1.85728 WP_001282267.1.85746 WP_001282267.1.85777 WP_001282267.1.85811 WP_001282267.1.85886 WP_001282267.1.859 WP_001282267.1.85900 WP_001282267.1.85904 WP_001282267.1.8591 WP_001282267.1.85917 WP_001282267.1.8594 WP_001282267.1.85976 WP_001282267.1.85977 WP_001282267.1.860 WP_001282267.1.86010 WP_001282267.1.86043 WP_001282267.1.8605 WP_001282267.1.86084 WP_001282267.1.8610 WP_001282267.1.86120 WP_001282267.1.86126 WP_001282267.1.8614 WP_001282267.1.86156 WP_001282267.1.86173 WP_001282267.1.86284 WP_001282267.1.86285 WP_001282267.1.86306 WP_001282267.1.86323 WP_001282267.1.86342 WP_001282267.1.86356 WP_001282267.1.8640 WP_001282267.1.8642 WP_001282267.1.86426 WP_001282267.1.86450 WP_001282267.1.86466 WP_001282267.1.86469 WP_001282267.1.86489 WP_001282267.1.86530 WP_001282267.1.86580 WP_001282267.1.86588 WP_001282267.1.86656 WP_001282267.1.86661 WP_001282267.1.86663 WP_001282267.1.86699 WP_001282267.1.8671 WP_001282267.1.86744 WP_001282267.1.86770 WP_001282267.1.8678 WP_001282267.1.86794 WP_001282267.1.86800 WP_001282267.1.86810 WP_001282267.1.86811 WP_001282267.1.86815 WP_001282267.1.8684 WP_001282267.1.86895 WP_001282267.1.86902 WP_001282267.1.86906 WP_001282267.1.8691 WP_001282267.1.86945 WP_001282267.1.86989 WP_001282267.1.87023 WP_001282267.1.87034 WP_001282267.1.87041 WP_001282267.1.87051 WP_001282267.1.87095 WP_001282267.1.87136 WP_001282267.1.87148 WP_001282267.1.87155 WP_001282267.1.8722 WP_001282267.1.87220 WP_001282267.1.87258 WP_001282267.1.87276 WP_001282267.1.87282 WP_001282267.1.87293 WP_001282267.1.87323 WP_001282267.1.87346 WP_001282267.1.8736 WP_001282267.1.87370 WP_001282267.1.87376 WP_001282267.1.87420 WP_001282267.1.87460 WP_001282267.1.87493 WP_001282267.1.87528 WP_001282267.1.87552 WP_001282267.1.87560 WP_001282267.1.87584 WP_001282267.1.8760 WP_001282267.1.87600 WP_001282267.1.87609 WP_001282267.1.87612 WP_001282267.1.87615 WP_001282267.1.87618 WP_001282267.1.87626 WP_001282267.1.87653 WP_001282267.1.87659 WP_001282267.1.8767 WP_001282267.1.87687 WP_001282267.1.87695 WP_001282267.1.87698 WP_001282267.1.87706 WP_001282267.1.87739 WP_001282267.1.87741 WP_001282267.1.87742 WP_001282267.1.87779 WP_001282267.1.87813 WP_001282267.1.87852 WP_001282267.1.87891 WP_001282267.1.87899 WP_001282267.1.8792 WP_001282267.1.87945 WP_001282267.1.87949 WP_001282267.1.88019 WP_001282267.1.88025 WP_001282267.1.88026 WP_001282267.1.8805 WP_001282267.1.8806 WP_001282267.1.88073 WP_001282267.1.8809 WP_001282267.1.88092 WP_001282267.1.881 WP_001282267.1.88145 WP_001282267.1.88199 WP_001282267.1.88214 WP_001282267.1.88244 WP_001282267.1.88291 WP_001282267.1.88293 WP_001282267.1.88299 WP_001282267.1.88313 WP_001282267.1.88359 WP_001282267.1.8837 WP_001282267.1.88393 WP_001282267.1.88407 WP_001282267.1.88414 WP_001282267.1.88444 WP_001282267.1.88446 WP_001282267.1.88458 WP_001282267.1.88501 WP_001282267.1.88538 WP_001282267.1.88547 WP_001282267.1.886 WP_001282267.1.88620 WP_001282267.1.88624 WP_001282267.1.88647 WP_001282267.1.88648 WP_001282267.1.88651 WP_001282267.1.88683 WP_001282267.1.88692 WP_001282267.1.88703 WP_001282267.1.88707 WP_001282267.1.88727 WP_001282267.1.88762 WP_001282267.1.88772 WP_001282267.1.88792 WP_001282267.1.88817 WP_001282267.1.88845 WP_001282267.1.88850 WP_001282267.1.8889 WP_001282267.1.88892 WP_001282267.1.88894 WP_001282267.1.88902 WP_001282267.1.8891 WP_001282267.1.88957 WP_001282267.1.88967 WP_001282267.1.88970 WP_001282267.1.88980 WP_001282267.1.88981 WP_001282267.1.89008 WP_001282267.1.89114 WP_001282267.1.89116 WP_001282267.1.89119 WP_001282267.1.89138 WP_001282267.1.89174 WP_001282267.1.89182 WP_001282267.1.89298 WP_001282267.1.89304 WP_001282267.1.89308 WP_001282267.1.89314 WP_001282267.1.89328 WP_001282267.1.89332 WP_001282267.1.89343 WP_001282267.1.89354 WP_001282267.1.89355 WP_001282267.1.89395 WP_001282267.1.8940 WP_001282267.1.89449 WP_001282267.1.8947 WP_001282267.1.89503 WP_001282267.1.89512 WP_001282267.1.89527 WP_001282267.1.89570 WP_001282267.1.89580 WP_001282267.1.89591 WP_001282267.1.89604 WP_001282267.1.89612 WP_001282267.1.89622 WP_001282267.1.89647 WP_001282267.1.89657 WP_001282267.1.89659 WP_001282267.1.89668 WP_001282267.1.89706 WP_001282267.1.89713 WP_001282267.1.89733 WP_001282267.1.89764 WP_001282267.1.89765 WP_001282267.1.89777 WP_001282267.1.89796 WP_001282267.1.89804 WP_001282267.1.89815 WP_001282267.1.89817 WP_001282267.1.89845 WP_001282267.1.89888 WP_001282267.1.89902 WP_001282267.1.89911 WP_001282267.1.89914 WP_001282267.1.8995 WP_001282267.1.89952 WP_001282267.1.8996 WP_001282267.1.89975 WP_001282267.1.90007 WP_001282267.1.9002 WP_001282267.1.90097 WP_001282267.1.9011 WP_001282267.1.90193 WP_001282267.1.90196 WP_001282267.1.90211 WP_001282267.1.90240 WP_001282267.1.90252 WP_001282267.1.90274 WP_001282267.1.90280 WP_001282267.1.90330 WP_001282267.1.90338 WP_001282267.1.90348 WP_001282267.1.90365 WP_001282267.1.90417 WP_001282267.1.90428 WP_001282267.1.90440 WP_001282267.1.90453 WP_001282267.1.90458 WP_001282267.1.90472 WP_001282267.1.90489 WP_001282267.1.90513 WP_001282267.1.90557 WP_001282267.1.90582 WP_001282267.1.90585 WP_001282267.1.9064 WP_001282267.1.90641 WP_001282267.1.90713 WP_001282267.1.90734 WP_001282267.1.90792 WP_001282267.1.90794 WP_001282267.1.90796 WP_001282267.1.90811 WP_001282267.1.90876 WP_001282267.1.9091 WP_001282267.1.90991 WP_001282267.1.91003 WP_001282267.1.91042 WP_001282267.1.91056 WP_001282267.1.91067 WP_001282267.1.91069 WP_001282267.1.91107 WP_001282267.1.91164 WP_001282267.1.91179 WP_001282267.1.91205 WP_001282267.1.91239 WP_001282267.1.91278 WP_001282267.1.91282 WP_001282267.1.91291 WP_001282267.1.91312 WP_001282267.1.91313 WP_001282267.1.91331 WP_001282267.1.91334 WP_001282267.1.9135 WP_001282267.1.91453 WP_001282267.1.91493 WP_001282267.1.91506 WP_001282267.1.91512 WP_001282267.1.91524 WP_001282267.1.91557 WP_001282267.1.91564 WP_001282267.1.91579 WP_001282267.1.91580 WP_001282267.1.91597 WP_001282267.1.91621 WP_001282267.1.91628 WP_001282267.1.91655 WP_001282267.1.9166 WP_001282267.1.91715 WP_001282267.1.91724 WP_001282267.1.91732 WP_001282267.1.91788 WP_001282267.1.91806 WP_001282267.1.91864 WP_001282267.1.9187 WP_001282267.1.91870 WP_001282267.1.91880 WP_001282267.1.91914 WP_001282267.1.91984 WP_001282267.1.92013 WP_001282267.1.92018 WP_001282267.1.92044 WP_001282267.1.92067 WP_001282267.1.92087 WP_001282267.1.92093 WP_001282267.1.92098 WP_001282267.1.92099 WP_001282267.1.92108 WP_001282267.1.92156 WP_001282267.1.92165 WP_001282267.1.92172 WP_001282267.1.92183 WP_001282267.1.92208 WP_001282267.1.92240 WP_001282267.1.92243 WP_001282267.1.92268 WP_001282267.1.92270 WP_001282267.1.92310 WP_001282267.1.92318 WP_001282267.1.92327 WP_001282267.1.92394 WP_001282267.1.92399 WP_001282267.1.92443 WP_001282267.1.92470 WP_001282267.1.92477 WP_001282267.1.92482 WP_001282267.1.92529 WP_001282267.1.9253 WP_001282267.1.92531 WP_001282267.1.92545 WP_001282267.1.92570 WP_001282267.1.92588 WP_001282267.1.926 WP_001282267.1.92633 WP_001282267.1.92646 WP_001282267.1.92649 WP_001282267.1.92659 WP_001282267.1.92669 WP_001282267.1.92671 WP_001282267.1.92676 WP_001282267.1.92705 WP_001282267.1.9271 WP_001282267.1.92734 WP_001282267.1.92738 WP_001282267.1.92758 WP_001282267.1.92786 WP_001282267.1.92810 WP_001282267.1.92823 WP_001282267.1.92827 WP_001282267.1.92836 WP_001282267.1.92842 WP_001282267.1.92893 WP_001282267.1.92895 WP_001282267.1.92926 WP_001282267.1.92936 WP_001282267.1.92987 WP_001282267.1.93007 WP_001282267.1.93022 WP_001282267.1.93059 WP_001282267.1.93086 WP_001282267.1.93101 WP_001282267.1.93103 WP_001282267.1.93105 WP_001282267.1.93111 WP_001282267.1.93118 WP_001282267.1.93121 WP_001282267.1.93136 WP_001282267.1.93155 WP_001282267.1.93168 WP_001282267.1.93184 WP_001282267.1.93213 WP_001282267.1.93221 WP_001282267.1.93223 WP_001282267.1.93239 WP_001282267.1.93302 WP_001282267.1.93322 WP_001282267.1.93339 WP_001282267.1.9336 WP_001282267.1.93365 WP_001282267.1.93387 WP_001282267.1.93469 WP_001282267.1.93511 WP_001282267.1.93512 WP_001282267.1.93543 WP_001282267.1.93604 WP_001282267.1.93635 WP_001282267.1.93650 WP_001282267.1.93656 WP_001282267.1.93657 WP_001282267.1.93662 WP_001282267.1.937 WP_001282267.1.93705 WP_001282267.1.9374 WP_001282267.1.93741 WP_001282267.1.9375 WP_001282267.1.93754 WP_001282267.1.93767 WP_001282267.1.93780 WP_001282267.1.93803 WP_001282267.1.93804 WP_001282267.1.93828 WP_001282267.1.93837 WP_001282267.1.93842 WP_001282267.1.93843 WP_001282267.1.93875 WP_001282267.1.9389 WP_001282267.1.93909 WP_001282267.1.93919 WP_001282267.1.93937 WP_001282267.1.93938 WP_001282267.1.93984 WP_001282267.1.93986 WP_001282267.1.9399 WP_001282267.1.93994 WP_001282267.1.94017 WP_001282267.1.94070 WP_001282267.1.94071 WP_001282267.1.94072 WP_001282267.1.94079 WP_001282267.1.94097 WP_001282267.1.94107 WP_001282267.1.94132 WP_001282267.1.94142 WP_001282267.1.94162 WP_001282267.1.94168 WP_001282267.1.94181 WP_001282267.1.94198 WP_001282267.1.94215 WP_001282267.1.94303 WP_001282267.1.9432 WP_001282267.1.94354 WP_001282267.1.94365 WP_001282267.1.94379 WP_001282267.1.94380 WP_001282267.1.94383 WP_001282267.1.94390 WP_001282267.1.94415 WP_001282267.1.94458 WP_001282267.1.94492 WP_001282267.1.94510 WP_001282267.1.94527 WP_001282267.1.94557 WP_001282267.1.94562 WP_001282267.1.94565 WP_001282267.1.94573 WP_001282267.1.94579 WP_001282267.1.94584 WP_001282267.1.94586 WP_001282267.1.94588 WP_001282267.1.94593 WP_001282267.1.94650 WP_001282267.1.94655 WP_001282267.1.94659 WP_001282267.1.94662 WP_001282267.1.94669 WP_001282267.1.94674 WP_001282267.1.94700 WP_001282267.1.94717 WP_001282267.1.94745 WP_001282267.1.94782 WP_001282267.1.94785 WP_001282267.1.94796 WP_001282267.1.94815 WP_001282267.1.94820 WP_001282267.1.94850 WP_001282267.1.94851 WP_001282267.1.94864 WP_001282267.1.94952 WP_001282267.1.94959 WP_001282267.1.94967 WP_001282267.1.94987 WP_001282267.1.95006 WP_001282267.1.9503 WP_001282267.1.95051 WP_001282267.1.95055 WP_001282267.1.95076 WP_001282267.1.95085 WP_001282267.1.95094 WP_001282267.1.95099 WP_001282267.1.95121 WP_001282267.1.95133 WP_001282267.1.95165 WP_001282267.1.95239 WP_001282267.1.95246 WP_001282267.1.95248 WP_001282267.1.95249 WP_001282267.1.9525 WP_001282267.1.95255 WP_001282267.1.95265 WP_001282267.1.95277 WP_001282267.1.95282 WP_001282267.1.95298 WP_001282267.1.95320 WP_001282267.1.95338 WP_001282267.1.95388 WP_001282267.1.95412 WP_001282267.1.95530 WP_001282267.1.95546 WP_001282267.1.95547 WP_001282267.1.95579 WP_001282267.1.95590 WP_001282267.1.95623 WP_001282267.1.95625 WP_001282267.1.95630 WP_001282267.1.95641 WP_001282267.1.95670 WP_001282267.1.95675 WP_001282267.1.95691 WP_001282267.1.95716 WP_001282267.1.95729 WP_001282267.1.9574 WP_001282267.1.95776 WP_001282267.1.95803 WP_001282267.1.95805 WP_001282267.1.95840 WP_001282267.1.95884 WP_001282267.1.95890 WP_001282267.1.95906 WP_001282267.1.95911 WP_001282267.1.95939 WP_001282267.1.95940 WP_001282267.1.96004 WP_001282267.1.96025 WP_001282267.1.96042 WP_001282267.1.96044 WP_001282267.1.96045 WP_001282267.1.96054 WP_001282267.1.9609 WP_001282267.1.96094 WP_001282267.1.96127 WP_001282267.1.96139 WP_001282267.1.96141 WP_001282267.1.96144 WP_001282267.1.96162 WP_001282267.1.96188 WP_001282267.1.96206 WP_001282267.1.96211 WP_001282267.1.96212 WP_001282267.1.96317 WP_001282267.1.96319 WP_001282267.1.9633 WP_001282267.1.96343 WP_001282267.1.96359 WP_001282267.1.96404 WP_001282267.1.9644 WP_001282267.1.96469 WP_001282267.1.96497 WP_001282267.1.96500 WP_001282267.1.96533 WP_001282267.1.96539 WP_001282267.1.96552 WP_001282267.1.96555 WP_001282267.1.96563 WP_001282267.1.96600 WP_001282267.1.96610 WP_001282267.1.96625 WP_001282267.1.96635 WP_001282267.1.9664 WP_001282267.1.96640 WP_001282267.1.96642 WP_001282267.1.96675 WP_001282267.1.9670 WP_001282267.1.96731 WP_001282267.1.96732 WP_001282267.1.9674 WP_001282267.1.96750 WP_001282267.1.96758 WP_001282267.1.96771 WP_001282267.1.96792 WP_001282267.1.96801 WP_001282267.1.96803 WP_001282267.1.96902 WP_001282267.1.96925 WP_001282267.1.96938 WP_001282267.1.96946 WP_001282267.1.96957 WP_001282267.1.96978 WP_001282267.1.97015 WP_001282267.1.97026 WP_001282267.1.97028 WP_001282267.1.97047 WP_001282267.1.97079 WP_001282267.1.97143 WP_001282267.1.97145 WP_001282267.1.97154 WP_001282267.1.97184 WP_001282267.1.97190 WP_001282267.1.97224 WP_001282267.1.97260 WP_001282267.1.97287 WP_001282267.1.97291 WP_001282267.1.97297 WP_001282267.1.97318 WP_001282267.1.97337 WP_001282267.1.97368 WP_001282267.1.97369 WP_001282267.1.97422 WP_001282267.1.97441 WP_001282267.1.97477 WP_001282267.1.97487 WP_001282267.1.97497 WP_001282267.1.97505 WP_001282267.1.97534 WP_001282267.1.97597 WP_001282267.1.97599 WP_001282267.1.97606 WP_001282267.1.97613 WP_001282267.1.97615 WP_001282267.1.97620 WP_001282267.1.97626 WP_001282267.1.97628 WP_001282267.1.97631 WP_001282267.1.97646 WP_001282267.1.97690 WP_001282267.1.97693 WP_001282267.1.97727 WP_001282267.1.97732 WP_001282267.1.97736 WP_001282267.1.9775 WP_001282267.1.97768 WP_001282267.1.97772 WP_001282267.1.97819 WP_001282267.1.97840 WP_001282267.1.97846 WP_001282267.1.97938 WP_001282267.1.97983 WP_001282267.1.97986 WP_001282267.1.9799 WP_001282267.1.98006 WP_001282267.1.98019 WP_001282267.1.98022 WP_001282267.1.98036 WP_001282267.1.98080 WP_001282267.1.98086 WP_001282267.1.9811 WP_001282267.1.98110 WP_001282267.1.98146 WP_001282267.1.98158 WP_001282267.1.98170 WP_001282267.1.98201 WP_001282267.1.98219 WP_001282267.1.98236 WP_001282267.1.98250 WP_001282267.1.9826 WP_001282267.1.98263 WP_001282267.1.98314 WP_001282267.1.98403 WP_001282267.1.9841 WP_001282267.1.98418 WP_001282267.1.98438 WP_001282267.1.98446 WP_001282267.1.98448 WP_001282267.1.98457 WP_001282267.1.98483 WP_001282267.1.98495 WP_001282267.1.9850 WP_001282267.1.98502 WP_001282267.1.98531 WP_001282267.1.98577 WP_001282267.1.98607 WP_001282267.1.9863 WP_001282267.1.98676 WP_001282267.1.98677 WP_001282267.1.98731 WP_001282267.1.98760 WP_001282267.1.98762 WP_001282267.1.9877 WP_001282267.1.98779 WP_001282267.1.98801 WP_001282267.1.98818 WP_001282267.1.9887 WP_001282267.1.9898 WP_001282267.1.99071 WP_001282267.1.99072 WP_001282267.1.99073 WP_001282267.1.99098 WP_001282267.1.99163 WP_001282267.1.99184 WP_001282267.1.9919 WP_001282267.1.99198 WP_001282267.1.99219 WP_001282267.1.99255 WP_001282267.1.99267 WP_001282267.1.99276 WP_001282267.1.99278 WP_001282267.1.99327 WP_001282267.1.99335 WP_001282267.1.99350 WP_001282267.1.99360 WP_001282267.1.99363 WP_001282267.1.99369 WP_001282267.1.99388 WP_001282267.1.99397 WP_001282267.1.99463 WP_001282267.1.99469 WP_001282267.1.99483 WP_001282267.1.99531 WP_001282267.1.9954 WP_001282267.1.99546 WP_001282267.1.99579 WP_001282267.1.99595 WP_001282267.1.99626 WP_001282267.1.99646 WP_001282267.1.99657 WP_001282267.1.99660 WP_001282267.1.99671 WP_001282267.1.99676 WP_001282267.1.99712 WP_001282267.1.99764 WP_001282267.1.99813 WP_001282267.1.99829 WP_001282267.1.99837 WP_001282267.1.99841 WP_001282267.1.99858 WP_001282267.1.99889 WP_001282267.1.9992 WP_001282267.1.99958 WP_001282267.1.99996 APC24438 gi|378988772|ref|YP_005251936.1| gi|378699319|ref|YP_005181276.1| gi|378444859|ref|YP_005232491.1| gi|386591282|ref|YP_006087682.1| gi|16764782|ref|NP_460397.1| gi|194451220|ref|YP_002045472.1| gi|488653822|ref|YP_007925625.1| gi|383496139|ref|YP_005396828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]