SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449950|ref|YP_005237309.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449950|ref|YP_005237309.1|
Domain Number 1 Region: 4-295
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.57e-72
Family Aldo-keto reductases (NADP) 0.0000000000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449950|ref|YP_005237309.1|
Sequence length 298
Comment putative aldo/keto reductase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MVQRVTIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLGVTTVDHADIYGGYQC
EAAFGEALTLAPHLREKLQIVTKCGIATTARAENKLGHYITDRRHIILSAEQSLKNLATD
YLDMLLIHRPDPLMDADDVAEAFQHLHQSGKVRHFGVSNFTPAQFTLLQSRLPFTLATNQ
VEISPVHQPLLLDGTLDQLQQLRIRPMAWSCLGGGRLFNDEAYQPLRQELSVIAQELNAS
SIEQVVYAWILRLPSQPLPIIGSGKIERVRAALEAETLSLTRQQWFRIRKAALGYDVP
Download sequence
Identical sequences A0A0D6G9I7 A0A0F6B131 A0A0F7J641 A0A0H3NCT4 A0A0U1FE81 A0A0W4BPG4 A0A2D3APJ2 A0A2H9YHM3 E8XHD2 Q8ZPN5
gi|378988777|ref|YP_005251941.1| gi|378699324|ref|YP_005181281.1| gi|550900803|ref|YP_008669895.1| NP_460402.1.58477 WP_000250717.1.100010 WP_000250717.1.100234 WP_000250717.1.100376 WP_000250717.1.100424 WP_000250717.1.100436 WP_000250717.1.100484 WP_000250717.1.100488 WP_000250717.1.100597 WP_000250717.1.10076 WP_000250717.1.100781 WP_000250717.1.100793 WP_000250717.1.100869 WP_000250717.1.100871 WP_000250717.1.100882 WP_000250717.1.101007 WP_000250717.1.101020 WP_000250717.1.101074 WP_000250717.1.101078 WP_000250717.1.101180 WP_000250717.1.101259 WP_000250717.1.101284 WP_000250717.1.101291 WP_000250717.1.101353 WP_000250717.1.101386 WP_000250717.1.101404 WP_000250717.1.101420 WP_000250717.1.101589 WP_000250717.1.101707 WP_000250717.1.101724 WP_000250717.1.101734 WP_000250717.1.101878 WP_000250717.1.101953 WP_000250717.1.10220 WP_000250717.1.10266 WP_000250717.1.10429 WP_000250717.1.10439 WP_000250717.1.10678 WP_000250717.1.10753 WP_000250717.1.10992 WP_000250717.1.11024 WP_000250717.1.11031 WP_000250717.1.11098 WP_000250717.1.11168 WP_000250717.1.11190 WP_000250717.1.11295 WP_000250717.1.11455 WP_000250717.1.11458 WP_000250717.1.11518 WP_000250717.1.11532 WP_000250717.1.11543 WP_000250717.1.11763 WP_000250717.1.11772 WP_000250717.1.11897 WP_000250717.1.12114 WP_000250717.1.12351 WP_000250717.1.12370 WP_000250717.1.12546 WP_000250717.1.1264 WP_000250717.1.12728 WP_000250717.1.12879 WP_000250717.1.12936 WP_000250717.1.12995 WP_000250717.1.13027 WP_000250717.1.13106 WP_000250717.1.13130 WP_000250717.1.13414 WP_000250717.1.13488 WP_000250717.1.13509 WP_000250717.1.13669 WP_000250717.1.13741 WP_000250717.1.1387 WP_000250717.1.13908 WP_000250717.1.13932 WP_000250717.1.13968 WP_000250717.1.14001 WP_000250717.1.14151 WP_000250717.1.14239 WP_000250717.1.14320 WP_000250717.1.14379 WP_000250717.1.14406 WP_000250717.1.14410 WP_000250717.1.14466 WP_000250717.1.14524 WP_000250717.1.14554 WP_000250717.1.14725 WP_000250717.1.14852 WP_000250717.1.1489 WP_000250717.1.14932 WP_000250717.1.15046 WP_000250717.1.15055 WP_000250717.1.15124 WP_000250717.1.15223 WP_000250717.1.15226 WP_000250717.1.15316 WP_000250717.1.15369 WP_000250717.1.1540 WP_000250717.1.15508 WP_000250717.1.15784 WP_000250717.1.15830 WP_000250717.1.1601 WP_000250717.1.16062 WP_000250717.1.16063 WP_000250717.1.16103 WP_000250717.1.16233 WP_000250717.1.16284 WP_000250717.1.16328 WP_000250717.1.1635 WP_000250717.1.16468 WP_000250717.1.16614 WP_000250717.1.16650 WP_000250717.1.16686 WP_000250717.1.16691 WP_000250717.1.16732 WP_000250717.1.16735 WP_000250717.1.16786 WP_000250717.1.16858 WP_000250717.1.16896 WP_000250717.1.16916 WP_000250717.1.16965 WP_000250717.1.1700 WP_000250717.1.17307 WP_000250717.1.174 WP_000250717.1.17480 WP_000250717.1.17546 WP_000250717.1.17702 WP_000250717.1.17705 WP_000250717.1.17865 WP_000250717.1.18019 WP_000250717.1.18111 WP_000250717.1.18163 WP_000250717.1.18265 WP_000250717.1.18267 WP_000250717.1.18468 WP_000250717.1.18607 WP_000250717.1.18705 WP_000250717.1.18715 WP_000250717.1.18776 WP_000250717.1.18822 WP_000250717.1.18881 WP_000250717.1.18940 WP_000250717.1.18949 WP_000250717.1.19053 WP_000250717.1.19320 WP_000250717.1.19458 WP_000250717.1.19460 WP_000250717.1.19461 WP_000250717.1.19614 WP_000250717.1.19702 WP_000250717.1.19706 WP_000250717.1.19724 WP_000250717.1.19749 WP_000250717.1.19784 WP_000250717.1.19802 WP_000250717.1.19809 WP_000250717.1.19867 WP_000250717.1.1990 WP_000250717.1.1998 WP_000250717.1.20 WP_000250717.1.2010 WP_000250717.1.20212 WP_000250717.1.20266 WP_000250717.1.20271 WP_000250717.1.20362 WP_000250717.1.20418 WP_000250717.1.20443 WP_000250717.1.20525 WP_000250717.1.2054 WP_000250717.1.20553 WP_000250717.1.20626 WP_000250717.1.20646 WP_000250717.1.20886 WP_000250717.1.20908 WP_000250717.1.21049 WP_000250717.1.21146 WP_000250717.1.21245 WP_000250717.1.21246 WP_000250717.1.21269 WP_000250717.1.21400 WP_000250717.1.21497 WP_000250717.1.21499 WP_000250717.1.21603 WP_000250717.1.21751 WP_000250717.1.21757 WP_000250717.1.22024 WP_000250717.1.2205 WP_000250717.1.22062 WP_000250717.1.22067 WP_000250717.1.2221 WP_000250717.1.2235 WP_000250717.1.22379 WP_000250717.1.22427 WP_000250717.1.2246 WP_000250717.1.22485 WP_000250717.1.22620 WP_000250717.1.22845 WP_000250717.1.22870 WP_000250717.1.22979 WP_000250717.1.23102 WP_000250717.1.23114 WP_000250717.1.2314 WP_000250717.1.23192 WP_000250717.1.23259 WP_000250717.1.23460 WP_000250717.1.23472 WP_000250717.1.23482 WP_000250717.1.23634 WP_000250717.1.2364 WP_000250717.1.2376 WP_000250717.1.23932 WP_000250717.1.24017 WP_000250717.1.24206 WP_000250717.1.24308 WP_000250717.1.24392 WP_000250717.1.24578 WP_000250717.1.24737 WP_000250717.1.24779 WP_000250717.1.25008 WP_000250717.1.25015 WP_000250717.1.25405 WP_000250717.1.25454 WP_000250717.1.25493 WP_000250717.1.25668 WP_000250717.1.25690 WP_000250717.1.25740 WP_000250717.1.25793 WP_000250717.1.25814 WP_000250717.1.25988 WP_000250717.1.26282 WP_000250717.1.26311 WP_000250717.1.26319 WP_000250717.1.26429 WP_000250717.1.26440 WP_000250717.1.26493 WP_000250717.1.26551 WP_000250717.1.26567 WP_000250717.1.27010 WP_000250717.1.27173 WP_000250717.1.27206 WP_000250717.1.27342 WP_000250717.1.27423 WP_000250717.1.27513 WP_000250717.1.27561 WP_000250717.1.27616 WP_000250717.1.2763 WP_000250717.1.27665 WP_000250717.1.27707 WP_000250717.1.27761 WP_000250717.1.2777 WP_000250717.1.27857 WP_000250717.1.27977 WP_000250717.1.28094 WP_000250717.1.28170 WP_000250717.1.2825 WP_000250717.1.28302 WP_000250717.1.2835 WP_000250717.1.28370 WP_000250717.1.28538 WP_000250717.1.28575 WP_000250717.1.28625 WP_000250717.1.28655 WP_000250717.1.28694 WP_000250717.1.2879 WP_000250717.1.2890 WP_000250717.1.28938 WP_000250717.1.28946 WP_000250717.1.29006 WP_000250717.1.29010 WP_000250717.1.2910 WP_000250717.1.29588 WP_000250717.1.29601 WP_000250717.1.29606 WP_000250717.1.29615 WP_000250717.1.29619 WP_000250717.1.29704 WP_000250717.1.29775 WP_000250717.1.29923 WP_000250717.1.29969 WP_000250717.1.30006 WP_000250717.1.30027 WP_000250717.1.30180 WP_000250717.1.30246 WP_000250717.1.30469 WP_000250717.1.30505 WP_000250717.1.30507 WP_000250717.1.30535 WP_000250717.1.30547 WP_000250717.1.30794 WP_000250717.1.30833 WP_000250717.1.30835 WP_000250717.1.30972 WP_000250717.1.31 WP_000250717.1.3113 WP_000250717.1.31185 WP_000250717.1.3119 WP_000250717.1.31190 WP_000250717.1.31195 WP_000250717.1.31196 WP_000250717.1.31281 WP_000250717.1.31362 WP_000250717.1.31504 WP_000250717.1.31515 WP_000250717.1.31578 WP_000250717.1.31658 WP_000250717.1.31845 WP_000250717.1.31940 WP_000250717.1.31967 WP_000250717.1.31972 WP_000250717.1.32192 WP_000250717.1.32206 WP_000250717.1.32277 WP_000250717.1.32438 WP_000250717.1.32515 WP_000250717.1.32527 WP_000250717.1.32660 WP_000250717.1.32702 WP_000250717.1.32714 WP_000250717.1.32786 WP_000250717.1.32804 WP_000250717.1.32902 WP_000250717.1.32907 WP_000250717.1.33030 WP_000250717.1.33127 WP_000250717.1.33143 WP_000250717.1.33248 WP_000250717.1.33261 WP_000250717.1.333 WP_000250717.1.33492 WP_000250717.1.33553 WP_000250717.1.33592 WP_000250717.1.33894 WP_000250717.1.34043 WP_000250717.1.34075 WP_000250717.1.34257 WP_000250717.1.34279 WP_000250717.1.34319 WP_000250717.1.34453 WP_000250717.1.34610 WP_000250717.1.34817 WP_000250717.1.34856 WP_000250717.1.34975 WP_000250717.1.35045 WP_000250717.1.35129 WP_000250717.1.35184 WP_000250717.1.35404 WP_000250717.1.35408 WP_000250717.1.35425 WP_000250717.1.35446 WP_000250717.1.35463 WP_000250717.1.35503 WP_000250717.1.35509 WP_000250717.1.35590 WP_000250717.1.3566 WP_000250717.1.35940 WP_000250717.1.36003 WP_000250717.1.3601 WP_000250717.1.36609 WP_000250717.1.36690 WP_000250717.1.3670 WP_000250717.1.36705 WP_000250717.1.36931 WP_000250717.1.36978 WP_000250717.1.37073 WP_000250717.1.37111 WP_000250717.1.37112 WP_000250717.1.37256 WP_000250717.1.37293 WP_000250717.1.37370 WP_000250717.1.37376 WP_000250717.1.3744 WP_000250717.1.37498 WP_000250717.1.37504 WP_000250717.1.37618 WP_000250717.1.37968 WP_000250717.1.37978 WP_000250717.1.38125 WP_000250717.1.38145 WP_000250717.1.383 WP_000250717.1.3848 WP_000250717.1.38613 WP_000250717.1.38673 WP_000250717.1.38693 WP_000250717.1.38773 WP_000250717.1.38881 WP_000250717.1.38882 WP_000250717.1.38895 WP_000250717.1.38913 WP_000250717.1.39003 WP_000250717.1.39136 WP_000250717.1.39197 WP_000250717.1.39229 WP_000250717.1.39405 WP_000250717.1.39420 WP_000250717.1.39449 WP_000250717.1.39512 WP_000250717.1.39629 WP_000250717.1.39723 WP_000250717.1.39763 WP_000250717.1.39862 WP_000250717.1.39921 WP_000250717.1.39923 WP_000250717.1.40017 WP_000250717.1.40072 WP_000250717.1.40073 WP_000250717.1.4011 WP_000250717.1.40208 WP_000250717.1.40240 WP_000250717.1.40257 WP_000250717.1.40292 WP_000250717.1.40305 WP_000250717.1.40311 WP_000250717.1.40380 WP_000250717.1.40395 WP_000250717.1.40465 WP_000250717.1.40710 WP_000250717.1.4075 WP_000250717.1.4087 WP_000250717.1.40877 WP_000250717.1.41017 WP_000250717.1.41086 WP_000250717.1.41091 WP_000250717.1.41226 WP_000250717.1.41279 WP_000250717.1.41345 WP_000250717.1.41516 WP_000250717.1.41554 WP_000250717.1.41572 WP_000250717.1.41591 WP_000250717.1.41662 WP_000250717.1.41708 WP_000250717.1.41761 WP_000250717.1.41882 WP_000250717.1.41979 WP_000250717.1.41985 WP_000250717.1.42104 WP_000250717.1.42320 WP_000250717.1.42342 WP_000250717.1.42422 WP_000250717.1.4276 WP_000250717.1.42767 WP_000250717.1.42864 WP_000250717.1.4288 WP_000250717.1.43018 WP_000250717.1.43041 WP_000250717.1.43244 WP_000250717.1.43312 WP_000250717.1.43334 WP_000250717.1.43437 WP_000250717.1.43522 WP_000250717.1.43535 WP_000250717.1.43613 WP_000250717.1.43668 WP_000250717.1.43886 WP_000250717.1.44043 WP_000250717.1.44099 WP_000250717.1.44121 WP_000250717.1.44291 WP_000250717.1.44310 WP_000250717.1.44479 WP_000250717.1.44640 WP_000250717.1.4467 WP_000250717.1.44747 WP_000250717.1.4485 WP_000250717.1.44877 WP_000250717.1.44927 WP_000250717.1.45067 WP_000250717.1.45074 WP_000250717.1.45079 WP_000250717.1.45098 WP_000250717.1.45177 WP_000250717.1.45184 WP_000250717.1.45259 WP_000250717.1.45344 WP_000250717.1.45349 WP_000250717.1.45365 WP_000250717.1.45550 WP_000250717.1.45585 WP_000250717.1.45660 WP_000250717.1.45690 WP_000250717.1.458 WP_000250717.1.46011 WP_000250717.1.46069 WP_000250717.1.46112 WP_000250717.1.46173 WP_000250717.1.46174 WP_000250717.1.46187 WP_000250717.1.46303 WP_000250717.1.46595 WP_000250717.1.46675 WP_000250717.1.47057 WP_000250717.1.47214 WP_000250717.1.47429 WP_000250717.1.47448 WP_000250717.1.4747 WP_000250717.1.47472 WP_000250717.1.47478 WP_000250717.1.47621 WP_000250717.1.47799 WP_000250717.1.47817 WP_000250717.1.48242 WP_000250717.1.48253 WP_000250717.1.483 WP_000250717.1.48367 WP_000250717.1.48377 WP_000250717.1.4853 WP_000250717.1.48788 WP_000250717.1.4885 WP_000250717.1.48894 WP_000250717.1.48919 WP_000250717.1.49084 WP_000250717.1.49155 WP_000250717.1.49204 WP_000250717.1.49239 WP_000250717.1.49256 WP_000250717.1.49276 WP_000250717.1.49290 WP_000250717.1.49340 WP_000250717.1.49366 WP_000250717.1.49490 WP_000250717.1.49515 WP_000250717.1.49572 WP_000250717.1.4979 WP_000250717.1.49803 WP_000250717.1.49805 WP_000250717.1.49929 WP_000250717.1.50080 WP_000250717.1.50161 WP_000250717.1.50211 WP_000250717.1.50376 WP_000250717.1.50389 WP_000250717.1.50676 WP_000250717.1.50774 WP_000250717.1.50804 WP_000250717.1.50808 WP_000250717.1.5088 WP_000250717.1.50908 WP_000250717.1.50941 WP_000250717.1.51014 WP_000250717.1.51022 WP_000250717.1.51179 WP_000250717.1.51182 WP_000250717.1.51186 WP_000250717.1.51487 WP_000250717.1.51488 WP_000250717.1.51634 WP_000250717.1.51649 WP_000250717.1.51686 WP_000250717.1.51756 WP_000250717.1.51911 WP_000250717.1.51932 WP_000250717.1.51989 WP_000250717.1.52121 WP_000250717.1.52346 WP_000250717.1.52353 WP_000250717.1.52361 WP_000250717.1.52653 WP_000250717.1.52656 WP_000250717.1.52743 WP_000250717.1.52851 WP_000250717.1.52857 WP_000250717.1.52898 WP_000250717.1.52915 WP_000250717.1.53190 WP_000250717.1.53406 WP_000250717.1.53466 WP_000250717.1.53529 WP_000250717.1.53543 WP_000250717.1.53757 WP_000250717.1.53812 WP_000250717.1.54033 WP_000250717.1.54075 WP_000250717.1.54196 WP_000250717.1.54209 WP_000250717.1.54271 WP_000250717.1.54274 WP_000250717.1.54319 WP_000250717.1.54364 WP_000250717.1.54400 WP_000250717.1.54644 WP_000250717.1.54662 WP_000250717.1.54722 WP_000250717.1.54749 WP_000250717.1.54764 WP_000250717.1.55008 WP_000250717.1.55152 WP_000250717.1.55156 WP_000250717.1.55285 WP_000250717.1.55475 WP_000250717.1.55647 WP_000250717.1.55743 WP_000250717.1.55768 WP_000250717.1.55782 WP_000250717.1.55796 WP_000250717.1.56002 WP_000250717.1.56012 WP_000250717.1.56105 WP_000250717.1.56238 WP_000250717.1.56286 WP_000250717.1.56304 WP_000250717.1.56368 WP_000250717.1.56414 WP_000250717.1.56438 WP_000250717.1.56560 WP_000250717.1.56597 WP_000250717.1.56601 WP_000250717.1.56614 WP_000250717.1.56671 WP_000250717.1.56682 WP_000250717.1.56875 WP_000250717.1.56877 WP_000250717.1.57168 WP_000250717.1.57187 WP_000250717.1.57377 WP_000250717.1.57433 WP_000250717.1.57515 WP_000250717.1.57529 WP_000250717.1.57576 WP_000250717.1.57601 WP_000250717.1.57607 WP_000250717.1.57763 WP_000250717.1.57862 WP_000250717.1.57890 WP_000250717.1.57891 WP_000250717.1.57978 WP_000250717.1.5801 WP_000250717.1.58041 WP_000250717.1.58144 WP_000250717.1.58157 WP_000250717.1.58418 WP_000250717.1.58548 WP_000250717.1.5858 WP_000250717.1.58662 WP_000250717.1.58669 WP_000250717.1.58698 WP_000250717.1.58745 WP_000250717.1.58803 WP_000250717.1.5886 WP_000250717.1.59094 WP_000250717.1.59097 WP_000250717.1.59224 WP_000250717.1.59375 WP_000250717.1.59458 WP_000250717.1.59490 WP_000250717.1.59508 WP_000250717.1.59512 WP_000250717.1.59684 WP_000250717.1.59694 WP_000250717.1.59771 WP_000250717.1.5979 WP_000250717.1.59953 WP_000250717.1.60008 WP_000250717.1.60021 WP_000250717.1.60069 WP_000250717.1.60140 WP_000250717.1.60155 WP_000250717.1.60285 WP_000250717.1.60379 WP_000250717.1.60464 WP_000250717.1.60608 WP_000250717.1.60874 WP_000250717.1.60941 WP_000250717.1.61078 WP_000250717.1.6108 WP_000250717.1.6114 WP_000250717.1.61232 WP_000250717.1.6129 WP_000250717.1.61296 WP_000250717.1.61345 WP_000250717.1.61417 WP_000250717.1.61509 WP_000250717.1.61574 WP_000250717.1.61712 WP_000250717.1.61730 WP_000250717.1.61857 WP_000250717.1.61918 WP_000250717.1.61952 WP_000250717.1.62007 WP_000250717.1.62025 WP_000250717.1.62204 WP_000250717.1.62222 WP_000250717.1.62304 WP_000250717.1.62364 WP_000250717.1.62374 WP_000250717.1.62403 WP_000250717.1.62486 WP_000250717.1.6253 WP_000250717.1.62853 WP_000250717.1.62903 WP_000250717.1.62910 WP_000250717.1.62955 WP_000250717.1.63181 WP_000250717.1.63203 WP_000250717.1.63256 WP_000250717.1.63290 WP_000250717.1.63382 WP_000250717.1.63432 WP_000250717.1.63461 WP_000250717.1.63479 WP_000250717.1.63577 WP_000250717.1.63664 WP_000250717.1.63718 WP_000250717.1.6375 WP_000250717.1.63757 WP_000250717.1.63834 WP_000250717.1.64046 WP_000250717.1.6423 WP_000250717.1.64244 WP_000250717.1.64403 WP_000250717.1.64649 WP_000250717.1.64702 WP_000250717.1.64757 WP_000250717.1.64781 WP_000250717.1.64831 WP_000250717.1.6489 WP_000250717.1.65018 WP_000250717.1.65028 WP_000250717.1.65171 WP_000250717.1.65248 WP_000250717.1.6535 WP_000250717.1.65474 WP_000250717.1.65633 WP_000250717.1.6565 WP_000250717.1.65696 WP_000250717.1.6575 WP_000250717.1.65782 WP_000250717.1.6630 WP_000250717.1.66314 WP_000250717.1.66358 WP_000250717.1.66362 WP_000250717.1.6638 WP_000250717.1.6640 WP_000250717.1.66698 WP_000250717.1.6680 WP_000250717.1.66834 WP_000250717.1.66901 WP_000250717.1.66962 WP_000250717.1.67037 WP_000250717.1.67045 WP_000250717.1.67181 WP_000250717.1.67268 WP_000250717.1.67347 WP_000250717.1.67465 WP_000250717.1.67552 WP_000250717.1.67682 WP_000250717.1.67887 WP_000250717.1.68073 WP_000250717.1.68201 WP_000250717.1.68206 WP_000250717.1.6827 WP_000250717.1.68275 WP_000250717.1.6849 WP_000250717.1.68547 WP_000250717.1.68589 WP_000250717.1.68655 WP_000250717.1.68656 WP_000250717.1.68690 WP_000250717.1.68778 WP_000250717.1.68787 WP_000250717.1.68894 WP_000250717.1.68928 WP_000250717.1.68958 WP_000250717.1.68975 WP_000250717.1.69006 WP_000250717.1.6913 WP_000250717.1.69146 WP_000250717.1.69255 WP_000250717.1.69346 WP_000250717.1.69397 WP_000250717.1.69564 WP_000250717.1.69644 WP_000250717.1.69704 WP_000250717.1.7010 WP_000250717.1.7021 WP_000250717.1.70241 WP_000250717.1.70269 WP_000250717.1.70289 WP_000250717.1.70447 WP_000250717.1.70485 WP_000250717.1.70643 WP_000250717.1.70683 WP_000250717.1.70883 WP_000250717.1.70922 WP_000250717.1.70948 WP_000250717.1.71116 WP_000250717.1.71146 WP_000250717.1.71165 WP_000250717.1.71188 WP_000250717.1.71202 WP_000250717.1.71243 WP_000250717.1.71306 WP_000250717.1.71337 WP_000250717.1.71378 WP_000250717.1.71401 WP_000250717.1.71702 WP_000250717.1.71750 WP_000250717.1.71845 WP_000250717.1.71881 WP_000250717.1.71908 WP_000250717.1.71952 WP_000250717.1.71973 WP_000250717.1.72105 WP_000250717.1.72107 WP_000250717.1.72203 WP_000250717.1.72351 WP_000250717.1.72376 WP_000250717.1.72594 WP_000250717.1.72871 WP_000250717.1.72872 WP_000250717.1.72975 WP_000250717.1.7315 WP_000250717.1.73200 WP_000250717.1.7334 WP_000250717.1.73377 WP_000250717.1.73481 WP_000250717.1.7356 WP_000250717.1.73561 WP_000250717.1.73581 WP_000250717.1.73617 WP_000250717.1.73753 WP_000250717.1.73758 WP_000250717.1.73794 WP_000250717.1.7387 WP_000250717.1.73924 WP_000250717.1.74029 WP_000250717.1.74181 WP_000250717.1.74191 WP_000250717.1.7433 WP_000250717.1.74379 WP_000250717.1.74410 WP_000250717.1.74529 WP_000250717.1.74545 WP_000250717.1.74639 WP_000250717.1.74745 WP_000250717.1.75129 WP_000250717.1.75180 WP_000250717.1.75187 WP_000250717.1.75288 WP_000250717.1.75334 WP_000250717.1.75362 WP_000250717.1.75385 WP_000250717.1.75392 WP_000250717.1.75760 WP_000250717.1.75764 WP_000250717.1.75837 WP_000250717.1.75874 WP_000250717.1.75945 WP_000250717.1.76020 WP_000250717.1.76252 WP_000250717.1.76445 WP_000250717.1.7660 WP_000250717.1.76673 WP_000250717.1.76706 WP_000250717.1.76721 WP_000250717.1.76756 WP_000250717.1.76760 WP_000250717.1.76875 WP_000250717.1.76880 WP_000250717.1.76899 WP_000250717.1.77038 WP_000250717.1.77047 WP_000250717.1.77080 WP_000250717.1.7712 WP_000250717.1.77180 WP_000250717.1.77244 WP_000250717.1.77292 WP_000250717.1.77349 WP_000250717.1.77436 WP_000250717.1.77514 WP_000250717.1.77529 WP_000250717.1.77549 WP_000250717.1.77692 WP_000250717.1.77754 WP_000250717.1.7782 WP_000250717.1.77851 WP_000250717.1.77898 WP_000250717.1.77918 WP_000250717.1.77960 WP_000250717.1.78033 WP_000250717.1.78076 WP_000250717.1.78096 WP_000250717.1.78100 WP_000250717.1.78110 WP_000250717.1.78120 WP_000250717.1.78383 WP_000250717.1.78407 WP_000250717.1.7861 WP_000250717.1.78618 WP_000250717.1.78673 WP_000250717.1.78735 WP_000250717.1.78802 WP_000250717.1.78830 WP_000250717.1.78835 WP_000250717.1.78871 WP_000250717.1.78874 WP_000250717.1.78918 WP_000250717.1.78930 WP_000250717.1.79151 WP_000250717.1.79167 WP_000250717.1.79335 WP_000250717.1.79462 WP_000250717.1.79472 WP_000250717.1.79490 WP_000250717.1.79495 WP_000250717.1.79529 WP_000250717.1.79570 WP_000250717.1.7964 WP_000250717.1.79659 WP_000250717.1.79668 WP_000250717.1.79708 WP_000250717.1.79845 WP_000250717.1.79914 WP_000250717.1.80077 WP_000250717.1.80137 WP_000250717.1.80182 WP_000250717.1.80296 WP_000250717.1.80366 WP_000250717.1.80479 WP_000250717.1.80780 WP_000250717.1.80831 WP_000250717.1.80850 WP_000250717.1.80881 WP_000250717.1.80939 WP_000250717.1.8096 WP_000250717.1.81037 WP_000250717.1.81069 WP_000250717.1.81149 WP_000250717.1.81175 WP_000250717.1.8119 WP_000250717.1.81193 WP_000250717.1.81354 WP_000250717.1.81425 WP_000250717.1.81750 WP_000250717.1.81785 WP_000250717.1.81902 WP_000250717.1.81974 WP_000250717.1.82337 WP_000250717.1.82479 WP_000250717.1.82503 WP_000250717.1.82515 WP_000250717.1.82676 WP_000250717.1.82761 WP_000250717.1.8282 WP_000250717.1.82944 WP_000250717.1.82956 WP_000250717.1.83092 WP_000250717.1.83163 WP_000250717.1.83305 WP_000250717.1.83413 WP_000250717.1.83491 WP_000250717.1.83516 WP_000250717.1.83523 WP_000250717.1.8354 WP_000250717.1.83721 WP_000250717.1.83760 WP_000250717.1.83995 WP_000250717.1.84103 WP_000250717.1.84283 WP_000250717.1.84392 WP_000250717.1.8441 WP_000250717.1.84532 WP_000250717.1.84659 WP_000250717.1.84899 WP_000250717.1.8497 WP_000250717.1.85040 WP_000250717.1.85134 WP_000250717.1.85178 WP_000250717.1.85180 WP_000250717.1.85190 WP_000250717.1.8545 WP_000250717.1.85481 WP_000250717.1.85483 WP_000250717.1.85541 WP_000250717.1.8556 WP_000250717.1.85615 WP_000250717.1.85617 WP_000250717.1.85663 WP_000250717.1.85672 WP_000250717.1.85742 WP_000250717.1.85777 WP_000250717.1.85886 WP_000250717.1.85900 WP_000250717.1.85904 WP_000250717.1.85976 WP_000250717.1.86306 WP_000250717.1.86356 WP_000250717.1.86389 WP_000250717.1.86450 WP_000250717.1.86469 WP_000250717.1.86580 WP_000250717.1.86588 WP_000250717.1.86661 WP_000250717.1.8672 WP_000250717.1.8678 WP_000250717.1.86807 WP_000250717.1.86810 WP_000250717.1.8684 WP_000250717.1.86860 WP_000250717.1.86895 WP_000250717.1.86906 WP_000250717.1.87095 WP_000250717.1.87323 WP_000250717.1.8736 WP_000250717.1.87460 WP_000250717.1.87552 WP_000250717.1.87779 WP_000250717.1.87945 WP_000250717.1.88019 WP_000250717.1.88073 WP_000250717.1.8809 WP_000250717.1.88291 WP_000250717.1.88293 WP_000250717.1.8837 WP_000250717.1.88393 WP_000250717.1.88698 WP_000250717.1.88703 WP_000250717.1.88762 WP_000250717.1.88792 WP_000250717.1.88902 WP_000250717.1.8891 WP_000250717.1.88981 WP_000250717.1.89008 WP_000250717.1.89116 WP_000250717.1.89138 WP_000250717.1.89304 WP_000250717.1.89512 WP_000250717.1.89527 WP_000250717.1.89570 WP_000250717.1.89604 WP_000250717.1.89622 WP_000250717.1.89632 WP_000250717.1.89659 WP_000250717.1.89902 WP_000250717.1.8996 WP_000250717.1.90097 WP_000250717.1.90252 WP_000250717.1.90417 WP_000250717.1.90453 WP_000250717.1.90458 WP_000250717.1.90557 WP_000250717.1.90585 WP_000250717.1.90641 WP_000250717.1.90734 WP_000250717.1.91003 WP_000250717.1.91069 WP_000250717.1.91278 WP_000250717.1.91512 WP_000250717.1.91564 WP_000250717.1.91628 WP_000250717.1.91655 WP_000250717.1.91724 WP_000250717.1.91732 WP_000250717.1.91788 WP_000250717.1.92013 WP_000250717.1.92093 WP_000250717.1.92108 WP_000250717.1.92183 WP_000250717.1.92208 WP_000250717.1.92268 WP_000250717.1.92310 WP_000250717.1.92443 WP_000250717.1.92482 WP_000250717.1.92531 WP_000250717.1.92669 WP_000250717.1.92671 WP_000250717.1.92738 WP_000250717.1.93086 WP_000250717.1.93101 WP_000250717.1.93136 WP_000250717.1.93155 WP_000250717.1.93365 WP_000250717.1.93543 WP_000250717.1.93650 WP_000250717.1.93656 WP_000250717.1.93662 WP_000250717.1.93691 WP_000250717.1.937 WP_000250717.1.93705 WP_000250717.1.93804 WP_000250717.1.9389 WP_000250717.1.93994 WP_000250717.1.94039 WP_000250717.1.94072 WP_000250717.1.94162 WP_000250717.1.94168 WP_000250717.1.94198 WP_000250717.1.9432 WP_000250717.1.94354 WP_000250717.1.94380 WP_000250717.1.94458 WP_000250717.1.94565 WP_000250717.1.94584 WP_000250717.1.94674 WP_000250717.1.94796 WP_000250717.1.94959 WP_000250717.1.94982 WP_000250717.1.95051 WP_000250717.1.95085 WP_000250717.1.95121 WP_000250717.1.95282 WP_000250717.1.95546 WP_000250717.1.95630 WP_000250717.1.95840 WP_000250717.1.95911 WP_000250717.1.9609 WP_000250717.1.96139 WP_000250717.1.96317 WP_000250717.1.96343 WP_000250717.1.9644 WP_000250717.1.96469 WP_000250717.1.96500 WP_000250717.1.96555 WP_000250717.1.96563 WP_000250717.1.96732 WP_000250717.1.96771 WP_000250717.1.97015 WP_000250717.1.97145 WP_000250717.1.97190 WP_000250717.1.97318 WP_000250717.1.97369 WP_000250717.1.97480 WP_000250717.1.97597 WP_000250717.1.97613 WP_000250717.1.97620 WP_000250717.1.97727 WP_000250717.1.97732 WP_000250717.1.97736 WP_000250717.1.9775 WP_000250717.1.97846 WP_000250717.1.98006 WP_000250717.1.98019 WP_000250717.1.98022 WP_000250717.1.98110 WP_000250717.1.98146 WP_000250717.1.98219 WP_000250717.1.9841 WP_000250717.1.98495 WP_000250717.1.98531 WP_000250717.1.98577 WP_000250717.1.98676 WP_000250717.1.98677 WP_000250717.1.98760 WP_000250717.1.98843 WP_000250717.1.9898 WP_000250717.1.99098 WP_000250717.1.99184 WP_000250717.1.99267 WP_000250717.1.99276 WP_000250717.1.99646 WP_000250717.1.99657 WP_000250717.1.99660 WP_000250717.1.99712 WP_000250717.1.99813 WP_000250717.1.99858 WP_000250717.1.99889 WP_000250717.1.99958 gi|549479258|ref|YP_008613220.1| 99287.STM1439 gi|379700610|ref|YP_005242338.1| gi|549724073|ref|YP_008644263.1| gi|16764787|ref|NP_460402.1| gi|482903247|ref|YP_007901807.1| gi|378444864|ref|YP_005232496.1| ABAM02000001|CDS_1974968-1975864 ABAO01000036|CDS_13225-14121 AE006468|CDS_1515074-1515970 CP001363|CDS_1525050-1525946 FN424405|CDS_1511586-1512482 gi|378449950|ref|YP_005237309.1| APC24440 IDP00964 gi|378983994|ref|YP_005247149.1| gi|383496144|ref|YP_005396833.1| gi|526220107|ref|YP_008265636.1| gi|525838349|ref|YP_008255366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]