SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378449980|ref|YP_005237339.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378449980|ref|YP_005237339.1|
Domain Number 1 Region: 1-374
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.16e-101
Family Type I phosphomannose isomerase 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378449980|ref|YP_005237339.1|
Sequence length 391
Comment mannose-6-phosphate isomerase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MQKLINSVQNYAWGSKTALTELYGIANPQQQPMAELWMGAHPKSSSRITTANGETVSLRD
AIEKNKTAMLGEAVANRFGELPFLFKVLCAAQPLSIQVHPNKRNSEIGFAKENAAGIPMD
AAERNYKDPNHKPELVFALTPFLAMNAFREFSDIVSLLQPVAGAHSAIAHFLQVPNAERL
SQLFASLLNMQGEEKSRALAVLKAALNSQQGEPWQTIRVISEYYPDDSGLFSPLLLNVVK
LNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEPKPAGE
LLTAPVKSGAELDFPIPVDDFAFSLHDLALQETSIGQHSAAILFCVEGEAVLRKDEQRLV
LKPGESAFIGADESPVNASGTGRLARVYNKL
Download sequence
Identical sequences A0A0D6G6T7 A0A0F6B161 A0A0F7J8I5 A0A0H3NB52 A0A0M0Q6G9 A0A0T9VGE5 A0A1S1AR26 A0A2D3APL4 A0A2H9YHP8 P25081
gi|549724099|ref|YP_008644289.1| gi|378449980|ref|YP_005237339.1| gi|482903274|ref|YP_007901834.1| 99287.STM1467 gi|526220128|ref|YP_008265664.1| gi|525838328|ref|YP_008255338.1| gi|378984021|ref|YP_005247176.1| NP_460428.1.58477 WP_001170627.1.100010 WP_001170627.1.100234 WP_001170627.1.100376 WP_001170627.1.100424 WP_001170627.1.100436 WP_001170627.1.100484 WP_001170627.1.100488 WP_001170627.1.100597 WP_001170627.1.10076 WP_001170627.1.100781 WP_001170627.1.100793 WP_001170627.1.100869 WP_001170627.1.100871 WP_001170627.1.100882 WP_001170627.1.100948 WP_001170627.1.101007 WP_001170627.1.101020 WP_001170627.1.101074 WP_001170627.1.101078 WP_001170627.1.101180 WP_001170627.1.101259 WP_001170627.1.101284 WP_001170627.1.101291 WP_001170627.1.101386 WP_001170627.1.101404 WP_001170627.1.101420 WP_001170627.1.101589 WP_001170627.1.101707 WP_001170627.1.101734 WP_001170627.1.101878 WP_001170627.1.101953 WP_001170627.1.10220 WP_001170627.1.10266 WP_001170627.1.10429 WP_001170627.1.10439 WP_001170627.1.10678 WP_001170627.1.10753 WP_001170627.1.10992 WP_001170627.1.11024 WP_001170627.1.11031 WP_001170627.1.11098 WP_001170627.1.11168 WP_001170627.1.11190 WP_001170627.1.11295 WP_001170627.1.11455 WP_001170627.1.11458 WP_001170627.1.11518 WP_001170627.1.11532 WP_001170627.1.11543 WP_001170627.1.11763 WP_001170627.1.11772 WP_001170627.1.11865 WP_001170627.1.11897 WP_001170627.1.12114 WP_001170627.1.12351 WP_001170627.1.12370 WP_001170627.1.12546 WP_001170627.1.1264 WP_001170627.1.12728 WP_001170627.1.12879 WP_001170627.1.12936 WP_001170627.1.12995 WP_001170627.1.13027 WP_001170627.1.13106 WP_001170627.1.13130 WP_001170627.1.13311 WP_001170627.1.13414 WP_001170627.1.13488 WP_001170627.1.13509 WP_001170627.1.13669 WP_001170627.1.13741 WP_001170627.1.1387 WP_001170627.1.13908 WP_001170627.1.13932 WP_001170627.1.13968 WP_001170627.1.14001 WP_001170627.1.14151 WP_001170627.1.14239 WP_001170627.1.14320 WP_001170627.1.14379 WP_001170627.1.14406 WP_001170627.1.14410 WP_001170627.1.14466 WP_001170627.1.14524 WP_001170627.1.14554 WP_001170627.1.14725 WP_001170627.1.14737 WP_001170627.1.14852 WP_001170627.1.1489 WP_001170627.1.14932 WP_001170627.1.15055 WP_001170627.1.15124 WP_001170627.1.15223 WP_001170627.1.15226 WP_001170627.1.15316 WP_001170627.1.15369 WP_001170627.1.1540 WP_001170627.1.15508 WP_001170627.1.1551 WP_001170627.1.15784 WP_001170627.1.15830 WP_001170627.1.16062 WP_001170627.1.16063 WP_001170627.1.16103 WP_001170627.1.16125 WP_001170627.1.16226 WP_001170627.1.16233 WP_001170627.1.16284 WP_001170627.1.16328 WP_001170627.1.1635 WP_001170627.1.16468 WP_001170627.1.16614 WP_001170627.1.16650 WP_001170627.1.16686 WP_001170627.1.16691 WP_001170627.1.16732 WP_001170627.1.16735 WP_001170627.1.16786 WP_001170627.1.16858 WP_001170627.1.16896 WP_001170627.1.16916 WP_001170627.1.16965 WP_001170627.1.1700 WP_001170627.1.17307 WP_001170627.1.174 WP_001170627.1.17480 WP_001170627.1.17546 WP_001170627.1.17702 WP_001170627.1.17705 WP_001170627.1.18019 WP_001170627.1.18111 WP_001170627.1.18163 WP_001170627.1.18249 WP_001170627.1.18265 WP_001170627.1.18267 WP_001170627.1.18441 WP_001170627.1.18468 WP_001170627.1.18607 WP_001170627.1.18705 WP_001170627.1.18715 WP_001170627.1.18776 WP_001170627.1.18822 WP_001170627.1.18881 WP_001170627.1.18940 WP_001170627.1.18949 WP_001170627.1.19053 WP_001170627.1.19163 WP_001170627.1.19320 WP_001170627.1.19458 WP_001170627.1.19460 WP_001170627.1.19461 WP_001170627.1.19614 WP_001170627.1.19702 WP_001170627.1.19706 WP_001170627.1.19724 WP_001170627.1.19749 WP_001170627.1.19784 WP_001170627.1.19802 WP_001170627.1.19809 WP_001170627.1.19867 WP_001170627.1.1998 WP_001170627.1.20 WP_001170627.1.2010 WP_001170627.1.20212 WP_001170627.1.20266 WP_001170627.1.20271 WP_001170627.1.20362 WP_001170627.1.20418 WP_001170627.1.20443 WP_001170627.1.20525 WP_001170627.1.2054 WP_001170627.1.20626 WP_001170627.1.20646 WP_001170627.1.20886 WP_001170627.1.20908 WP_001170627.1.21049 WP_001170627.1.21146 WP_001170627.1.21245 WP_001170627.1.21246 WP_001170627.1.21269 WP_001170627.1.21400 WP_001170627.1.21497 WP_001170627.1.21603 WP_001170627.1.21751 WP_001170627.1.21757 WP_001170627.1.22024 WP_001170627.1.2205 WP_001170627.1.22062 WP_001170627.1.22067 WP_001170627.1.2221 WP_001170627.1.2235 WP_001170627.1.22379 WP_001170627.1.22427 WP_001170627.1.2246 WP_001170627.1.22485 WP_001170627.1.22620 WP_001170627.1.22870 WP_001170627.1.22979 WP_001170627.1.23102 WP_001170627.1.23114 WP_001170627.1.2314 WP_001170627.1.23172 WP_001170627.1.23192 WP_001170627.1.23259 WP_001170627.1.23460 WP_001170627.1.23472 WP_001170627.1.23482 WP_001170627.1.23634 WP_001170627.1.2364 WP_001170627.1.23932 WP_001170627.1.24017 WP_001170627.1.24206 WP_001170627.1.24308 WP_001170627.1.24578 WP_001170627.1.24737 WP_001170627.1.24779 WP_001170627.1.25008 WP_001170627.1.25015 WP_001170627.1.25454 WP_001170627.1.25493 WP_001170627.1.25668 WP_001170627.1.25690 WP_001170627.1.2570 WP_001170627.1.25740 WP_001170627.1.25793 WP_001170627.1.25814 WP_001170627.1.25988 WP_001170627.1.26282 WP_001170627.1.26311 WP_001170627.1.26319 WP_001170627.1.26429 WP_001170627.1.26440 WP_001170627.1.26493 WP_001170627.1.26551 WP_001170627.1.26567 WP_001170627.1.27010 WP_001170627.1.27173 WP_001170627.1.27206 WP_001170627.1.27423 WP_001170627.1.27561 WP_001170627.1.2763 WP_001170627.1.27665 WP_001170627.1.27707 WP_001170627.1.27761 WP_001170627.1.2777 WP_001170627.1.27857 WP_001170627.1.27977 WP_001170627.1.28094 WP_001170627.1.28170 WP_001170627.1.28302 WP_001170627.1.2835 WP_001170627.1.28370 WP_001170627.1.28504 WP_001170627.1.28538 WP_001170627.1.28575 WP_001170627.1.28625 WP_001170627.1.28655 WP_001170627.1.28694 WP_001170627.1.28776 WP_001170627.1.2879 WP_001170627.1.2890 WP_001170627.1.28938 WP_001170627.1.28946 WP_001170627.1.29006 WP_001170627.1.29010 WP_001170627.1.2910 WP_001170627.1.29174 WP_001170627.1.29588 WP_001170627.1.29601 WP_001170627.1.29606 WP_001170627.1.29615 WP_001170627.1.29619 WP_001170627.1.29704 WP_001170627.1.29969 WP_001170627.1.30006 WP_001170627.1.30027 WP_001170627.1.30180 WP_001170627.1.30469 WP_001170627.1.30505 WP_001170627.1.30507 WP_001170627.1.30535 WP_001170627.1.30547 WP_001170627.1.30794 WP_001170627.1.30833 WP_001170627.1.30835 WP_001170627.1.30972 WP_001170627.1.31 WP_001170627.1.3113 WP_001170627.1.31185 WP_001170627.1.3119 WP_001170627.1.31190 WP_001170627.1.31195 WP_001170627.1.31196 WP_001170627.1.31281 WP_001170627.1.31362 WP_001170627.1.31504 WP_001170627.1.31515 WP_001170627.1.31578 WP_001170627.1.31658 WP_001170627.1.31940 WP_001170627.1.31967 WP_001170627.1.31972 WP_001170627.1.32192 WP_001170627.1.32206 WP_001170627.1.32438 WP_001170627.1.32515 WP_001170627.1.32660 WP_001170627.1.32702 WP_001170627.1.32714 WP_001170627.1.32786 WP_001170627.1.32804 WP_001170627.1.32907 WP_001170627.1.33030 WP_001170627.1.33127 WP_001170627.1.33143 WP_001170627.1.33248 WP_001170627.1.33261 WP_001170627.1.333 WP_001170627.1.33492 WP_001170627.1.33553 WP_001170627.1.33592 WP_001170627.1.33817 WP_001170627.1.33894 WP_001170627.1.34043 WP_001170627.1.34075 WP_001170627.1.34257 WP_001170627.1.34279 WP_001170627.1.34319 WP_001170627.1.34453 WP_001170627.1.34610 WP_001170627.1.34856 WP_001170627.1.34975 WP_001170627.1.35045 WP_001170627.1.35129 WP_001170627.1.35184 WP_001170627.1.35404 WP_001170627.1.35408 WP_001170627.1.35425 WP_001170627.1.35463 WP_001170627.1.35503 WP_001170627.1.35509 WP_001170627.1.35590 WP_001170627.1.35940 WP_001170627.1.36003 WP_001170627.1.3601 WP_001170627.1.36609 WP_001170627.1.36690 WP_001170627.1.3670 WP_001170627.1.36918 WP_001170627.1.36931 WP_001170627.1.37073 WP_001170627.1.37111 WP_001170627.1.37112 WP_001170627.1.37256 WP_001170627.1.37293 WP_001170627.1.37370 WP_001170627.1.37376 WP_001170627.1.3744 WP_001170627.1.37498 WP_001170627.1.37504 WP_001170627.1.37618 WP_001170627.1.37968 WP_001170627.1.37978 WP_001170627.1.38125 WP_001170627.1.38145 WP_001170627.1.383 WP_001170627.1.3848 WP_001170627.1.38613 WP_001170627.1.38673 WP_001170627.1.38693 WP_001170627.1.38773 WP_001170627.1.38882 WP_001170627.1.38913 WP_001170627.1.39003 WP_001170627.1.39136 WP_001170627.1.39197 WP_001170627.1.39229 WP_001170627.1.39405 WP_001170627.1.39420 WP_001170627.1.39449 WP_001170627.1.39512 WP_001170627.1.39629 WP_001170627.1.39763 WP_001170627.1.39862 WP_001170627.1.39921 WP_001170627.1.39923 WP_001170627.1.40017 WP_001170627.1.40072 WP_001170627.1.40073 WP_001170627.1.4011 WP_001170627.1.40208 WP_001170627.1.40240 WP_001170627.1.40257 WP_001170627.1.40292 WP_001170627.1.40305 WP_001170627.1.40311 WP_001170627.1.40380 WP_001170627.1.40395 WP_001170627.1.40465 WP_001170627.1.40710 WP_001170627.1.4075 WP_001170627.1.4087 WP_001170627.1.40877 WP_001170627.1.41017 WP_001170627.1.41086 WP_001170627.1.41091 WP_001170627.1.41226 WP_001170627.1.41279 WP_001170627.1.41516 WP_001170627.1.41554 WP_001170627.1.41572 WP_001170627.1.41591 WP_001170627.1.41662 WP_001170627.1.41708 WP_001170627.1.41761 WP_001170627.1.41882 WP_001170627.1.41979 WP_001170627.1.41985 WP_001170627.1.42104 WP_001170627.1.42320 WP_001170627.1.42342 WP_001170627.1.42422 WP_001170627.1.4276 WP_001170627.1.42861 WP_001170627.1.42864 WP_001170627.1.4288 WP_001170627.1.43018 WP_001170627.1.43041 WP_001170627.1.43244 WP_001170627.1.43312 WP_001170627.1.43334 WP_001170627.1.43437 WP_001170627.1.43522 WP_001170627.1.43613 WP_001170627.1.43668 WP_001170627.1.43886 WP_001170627.1.44005 WP_001170627.1.44043 WP_001170627.1.44099 WP_001170627.1.44121 WP_001170627.1.44310 WP_001170627.1.44386 WP_001170627.1.44479 WP_001170627.1.44640 WP_001170627.1.4467 WP_001170627.1.44747 WP_001170627.1.4485 WP_001170627.1.44877 WP_001170627.1.44927 WP_001170627.1.45067 WP_001170627.1.45074 WP_001170627.1.45079 WP_001170627.1.45098 WP_001170627.1.45177 WP_001170627.1.45184 WP_001170627.1.45259 WP_001170627.1.45349 WP_001170627.1.45365 WP_001170627.1.45550 WP_001170627.1.45585 WP_001170627.1.45660 WP_001170627.1.45690 WP_001170627.1.458 WP_001170627.1.46011 WP_001170627.1.46069 WP_001170627.1.46112 WP_001170627.1.46173 WP_001170627.1.46174 WP_001170627.1.46187 WP_001170627.1.46303 WP_001170627.1.46595 WP_001170627.1.46675 WP_001170627.1.47057 WP_001170627.1.47214 WP_001170627.1.47429 WP_001170627.1.47448 WP_001170627.1.4747 WP_001170627.1.47472 WP_001170627.1.47478 WP_001170627.1.47621 WP_001170627.1.47799 WP_001170627.1.48242 WP_001170627.1.48253 WP_001170627.1.483 WP_001170627.1.48367 WP_001170627.1.48377 WP_001170627.1.4853 WP_001170627.1.48788 WP_001170627.1.4885 WP_001170627.1.48894 WP_001170627.1.48919 WP_001170627.1.49084 WP_001170627.1.49155 WP_001170627.1.49204 WP_001170627.1.49239 WP_001170627.1.49256 WP_001170627.1.49290 WP_001170627.1.49340 WP_001170627.1.49366 WP_001170627.1.49490 WP_001170627.1.49515 WP_001170627.1.49572 WP_001170627.1.49626 WP_001170627.1.4979 WP_001170627.1.49803 WP_001170627.1.49805 WP_001170627.1.49929 WP_001170627.1.50080 WP_001170627.1.50161 WP_001170627.1.50211 WP_001170627.1.50376 WP_001170627.1.50389 WP_001170627.1.50676 WP_001170627.1.50804 WP_001170627.1.50808 WP_001170627.1.5088 WP_001170627.1.50908 WP_001170627.1.50941 WP_001170627.1.51014 WP_001170627.1.51022 WP_001170627.1.51179 WP_001170627.1.51182 WP_001170627.1.51186 WP_001170627.1.51464 WP_001170627.1.51487 WP_001170627.1.51488 WP_001170627.1.51594 WP_001170627.1.51634 WP_001170627.1.51649 WP_001170627.1.51686 WP_001170627.1.51756 WP_001170627.1.51841 WP_001170627.1.51911 WP_001170627.1.51932 WP_001170627.1.51989 WP_001170627.1.52121 WP_001170627.1.52346 WP_001170627.1.52353 WP_001170627.1.52361 WP_001170627.1.52653 WP_001170627.1.52656 WP_001170627.1.52743 WP_001170627.1.52857 WP_001170627.1.52898 WP_001170627.1.52915 WP_001170627.1.53190 WP_001170627.1.53406 WP_001170627.1.53466 WP_001170627.1.53529 WP_001170627.1.53543 WP_001170627.1.53688 WP_001170627.1.53757 WP_001170627.1.53812 WP_001170627.1.54033 WP_001170627.1.54075 WP_001170627.1.54196 WP_001170627.1.54209 WP_001170627.1.54271 WP_001170627.1.54274 WP_001170627.1.54319 WP_001170627.1.54364 WP_001170627.1.54400 WP_001170627.1.54644 WP_001170627.1.54662 WP_001170627.1.54722 WP_001170627.1.54749 WP_001170627.1.54764 WP_001170627.1.55008 WP_001170627.1.55152 WP_001170627.1.55156 WP_001170627.1.55285 WP_001170627.1.55475 WP_001170627.1.55647 WP_001170627.1.55743 WP_001170627.1.55768 WP_001170627.1.55782 WP_001170627.1.55796 WP_001170627.1.56002 WP_001170627.1.56012 WP_001170627.1.56105 WP_001170627.1.56238 WP_001170627.1.56261 WP_001170627.1.56286 WP_001170627.1.56304 WP_001170627.1.56414 WP_001170627.1.56438 WP_001170627.1.56560 WP_001170627.1.56601 WP_001170627.1.56614 WP_001170627.1.56671 WP_001170627.1.56682 WP_001170627.1.56875 WP_001170627.1.56877 WP_001170627.1.57084 WP_001170627.1.57168 WP_001170627.1.57187 WP_001170627.1.57377 WP_001170627.1.57418 WP_001170627.1.57433 WP_001170627.1.57515 WP_001170627.1.57529 WP_001170627.1.57534 WP_001170627.1.57576 WP_001170627.1.57601 WP_001170627.1.57607 WP_001170627.1.57763 WP_001170627.1.57862 WP_001170627.1.57890 WP_001170627.1.57891 WP_001170627.1.57978 WP_001170627.1.5801 WP_001170627.1.58418 WP_001170627.1.58548 WP_001170627.1.5858 WP_001170627.1.58662 WP_001170627.1.58669 WP_001170627.1.58745 WP_001170627.1.58803 WP_001170627.1.5886 WP_001170627.1.59094 WP_001170627.1.59224 WP_001170627.1.59375 WP_001170627.1.59458 WP_001170627.1.59490 WP_001170627.1.59508 WP_001170627.1.59684 WP_001170627.1.59694 WP_001170627.1.59771 WP_001170627.1.5979 WP_001170627.1.59953 WP_001170627.1.60008 WP_001170627.1.60021 WP_001170627.1.60069 WP_001170627.1.60140 WP_001170627.1.60155 WP_001170627.1.60285 WP_001170627.1.60379 WP_001170627.1.60464 WP_001170627.1.60874 WP_001170627.1.60941 WP_001170627.1.61078 WP_001170627.1.6114 WP_001170627.1.61232 WP_001170627.1.6129 WP_001170627.1.61296 WP_001170627.1.61345 WP_001170627.1.61417 WP_001170627.1.61574 WP_001170627.1.61712 WP_001170627.1.61714 WP_001170627.1.61730 WP_001170627.1.61857 WP_001170627.1.61918 WP_001170627.1.61952 WP_001170627.1.62007 WP_001170627.1.62025 WP_001170627.1.62204 WP_001170627.1.62304 WP_001170627.1.62364 WP_001170627.1.62374 WP_001170627.1.62403 WP_001170627.1.6253 WP_001170627.1.62853 WP_001170627.1.62903 WP_001170627.1.62910 WP_001170627.1.62955 WP_001170627.1.63181 WP_001170627.1.63203 WP_001170627.1.63256 WP_001170627.1.63290 WP_001170627.1.63382 WP_001170627.1.63432 WP_001170627.1.63461 WP_001170627.1.63479 WP_001170627.1.63525 WP_001170627.1.63577 WP_001170627.1.63664 WP_001170627.1.63718 WP_001170627.1.6375 WP_001170627.1.63757 WP_001170627.1.63834 WP_001170627.1.64046 WP_001170627.1.6423 WP_001170627.1.64244 WP_001170627.1.64403 WP_001170627.1.64649 WP_001170627.1.64702 WP_001170627.1.64757 WP_001170627.1.64781 WP_001170627.1.64831 WP_001170627.1.6489 WP_001170627.1.65018 WP_001170627.1.65028 WP_001170627.1.65171 WP_001170627.1.65248 WP_001170627.1.6535 WP_001170627.1.65474 WP_001170627.1.65633 WP_001170627.1.6565 WP_001170627.1.65696 WP_001170627.1.6575 WP_001170627.1.65782 WP_001170627.1.66074 WP_001170627.1.6630 WP_001170627.1.66314 WP_001170627.1.66358 WP_001170627.1.66362 WP_001170627.1.6638 WP_001170627.1.6640 WP_001170627.1.66698 WP_001170627.1.6680 WP_001170627.1.66834 WP_001170627.1.66901 WP_001170627.1.66962 WP_001170627.1.67037 WP_001170627.1.67045 WP_001170627.1.67181 WP_001170627.1.67268 WP_001170627.1.67347 WP_001170627.1.67465 WP_001170627.1.67552 WP_001170627.1.67682 WP_001170627.1.67829 WP_001170627.1.67887 WP_001170627.1.68073 WP_001170627.1.68201 WP_001170627.1.68206 WP_001170627.1.6827 WP_001170627.1.68275 WP_001170627.1.6849 WP_001170627.1.68547 WP_001170627.1.68589 WP_001170627.1.68655 WP_001170627.1.68656 WP_001170627.1.68778 WP_001170627.1.68787 WP_001170627.1.68894 WP_001170627.1.68928 WP_001170627.1.68975 WP_001170627.1.69006 WP_001170627.1.6913 WP_001170627.1.69146 WP_001170627.1.69255 WP_001170627.1.69397 WP_001170627.1.69564 WP_001170627.1.69644 WP_001170627.1.69704 WP_001170627.1.7021 WP_001170627.1.70241 WP_001170627.1.70269 WP_001170627.1.70289 WP_001170627.1.70447 WP_001170627.1.70485 WP_001170627.1.70643 WP_001170627.1.70683 WP_001170627.1.70883 WP_001170627.1.70922 WP_001170627.1.70948 WP_001170627.1.70971 WP_001170627.1.71116 WP_001170627.1.71146 WP_001170627.1.71165 WP_001170627.1.71188 WP_001170627.1.71202 WP_001170627.1.71243 WP_001170627.1.71306 WP_001170627.1.71337 WP_001170627.1.71378 WP_001170627.1.71401 WP_001170627.1.71702 WP_001170627.1.71750 WP_001170627.1.71845 WP_001170627.1.71881 WP_001170627.1.71908 WP_001170627.1.71952 WP_001170627.1.71973 WP_001170627.1.72105 WP_001170627.1.72203 WP_001170627.1.72376 WP_001170627.1.72594 WP_001170627.1.72871 WP_001170627.1.72975 WP_001170627.1.7315 WP_001170627.1.73200 WP_001170627.1.7334 WP_001170627.1.73377 WP_001170627.1.73481 WP_001170627.1.7356 WP_001170627.1.73581 WP_001170627.1.73617 WP_001170627.1.73753 WP_001170627.1.73758 WP_001170627.1.73794 WP_001170627.1.7387 WP_001170627.1.73924 WP_001170627.1.74029 WP_001170627.1.74181 WP_001170627.1.74191 WP_001170627.1.7433 WP_001170627.1.74379 WP_001170627.1.74410 WP_001170627.1.74466 WP_001170627.1.74529 WP_001170627.1.74545 WP_001170627.1.74745 WP_001170627.1.75129 WP_001170627.1.75177 WP_001170627.1.75187 WP_001170627.1.75288 WP_001170627.1.75334 WP_001170627.1.75385 WP_001170627.1.75392 WP_001170627.1.75760 WP_001170627.1.75764 WP_001170627.1.75837 WP_001170627.1.75874 WP_001170627.1.75945 WP_001170627.1.76020 WP_001170627.1.76252 WP_001170627.1.76445 WP_001170627.1.7660 WP_001170627.1.76673 WP_001170627.1.76706 WP_001170627.1.76721 WP_001170627.1.76756 WP_001170627.1.76760 WP_001170627.1.76875 WP_001170627.1.76880 WP_001170627.1.76899 WP_001170627.1.77038 WP_001170627.1.77047 WP_001170627.1.77080 WP_001170627.1.7712 WP_001170627.1.77180 WP_001170627.1.77244 WP_001170627.1.77292 WP_001170627.1.77514 WP_001170627.1.77529 WP_001170627.1.77549 WP_001170627.1.77692 WP_001170627.1.7782 WP_001170627.1.77851 WP_001170627.1.77898 WP_001170627.1.77918 WP_001170627.1.77960 WP_001170627.1.78033 WP_001170627.1.78076 WP_001170627.1.78096 WP_001170627.1.78100 WP_001170627.1.78110 WP_001170627.1.78120 WP_001170627.1.78383 WP_001170627.1.78407 WP_001170627.1.7861 WP_001170627.1.78618 WP_001170627.1.78673 WP_001170627.1.78735 WP_001170627.1.78802 WP_001170627.1.78830 WP_001170627.1.78835 WP_001170627.1.78871 WP_001170627.1.78874 WP_001170627.1.78918 WP_001170627.1.78930 WP_001170627.1.79151 WP_001170627.1.79167 WP_001170627.1.79335 WP_001170627.1.79462 WP_001170627.1.79472 WP_001170627.1.79490 WP_001170627.1.79495 WP_001170627.1.79529 WP_001170627.1.79570 WP_001170627.1.7964 WP_001170627.1.79659 WP_001170627.1.79668 WP_001170627.1.79708 WP_001170627.1.79845 WP_001170627.1.80077 WP_001170627.1.80137 WP_001170627.1.80182 WP_001170627.1.80236 WP_001170627.1.80296 WP_001170627.1.80366 WP_001170627.1.80780 WP_001170627.1.80831 WP_001170627.1.80850 WP_001170627.1.80881 WP_001170627.1.80939 WP_001170627.1.8096 WP_001170627.1.81037 WP_001170627.1.81069 WP_001170627.1.81149 WP_001170627.1.81175 WP_001170627.1.8119 WP_001170627.1.81193 WP_001170627.1.81354 WP_001170627.1.81425 WP_001170627.1.81750 WP_001170627.1.81785 WP_001170627.1.81902 WP_001170627.1.81974 WP_001170627.1.82337 WP_001170627.1.82479 WP_001170627.1.82503 WP_001170627.1.82515 WP_001170627.1.82676 WP_001170627.1.82761 WP_001170627.1.8282 WP_001170627.1.82867 WP_001170627.1.82944 WP_001170627.1.82956 WP_001170627.1.83092 WP_001170627.1.83163 WP_001170627.1.83305 WP_001170627.1.83413 WP_001170627.1.83491 WP_001170627.1.83523 WP_001170627.1.8354 WP_001170627.1.83721 WP_001170627.1.83760 WP_001170627.1.83995 WP_001170627.1.84103 WP_001170627.1.84283 WP_001170627.1.84359 WP_001170627.1.84392 WP_001170627.1.8441 WP_001170627.1.84532 WP_001170627.1.84554 WP_001170627.1.84659 WP_001170627.1.84899 WP_001170627.1.8497 WP_001170627.1.85040 WP_001170627.1.85134 WP_001170627.1.85178 WP_001170627.1.85180 WP_001170627.1.85190 WP_001170627.1.8545 WP_001170627.1.85481 WP_001170627.1.85483 WP_001170627.1.85541 WP_001170627.1.8556 WP_001170627.1.85615 WP_001170627.1.85617 WP_001170627.1.85663 WP_001170627.1.85671 WP_001170627.1.85672 WP_001170627.1.85777 WP_001170627.1.85886 WP_001170627.1.85900 WP_001170627.1.85904 WP_001170627.1.85976 WP_001170627.1.86306 WP_001170627.1.86356 WP_001170627.1.86450 WP_001170627.1.86469 WP_001170627.1.86580 WP_001170627.1.86588 WP_001170627.1.86661 WP_001170627.1.8672 WP_001170627.1.8678 WP_001170627.1.86810 WP_001170627.1.8684 WP_001170627.1.86859 WP_001170627.1.86895 WP_001170627.1.86906 WP_001170627.1.87095 WP_001170627.1.8736 WP_001170627.1.87460 WP_001170627.1.87552 WP_001170627.1.87779 WP_001170627.1.87945 WP_001170627.1.88019 WP_001170627.1.88073 WP_001170627.1.8809 WP_001170627.1.88291 WP_001170627.1.8837 WP_001170627.1.88393 WP_001170627.1.88703 WP_001170627.1.88792 WP_001170627.1.88902 WP_001170627.1.8891 WP_001170627.1.89008 WP_001170627.1.89116 WP_001170627.1.89138 WP_001170627.1.89304 WP_001170627.1.89512 WP_001170627.1.89527 WP_001170627.1.89570 WP_001170627.1.89604 WP_001170627.1.89622 WP_001170627.1.89659 WP_001170627.1.89902 WP_001170627.1.8996 WP_001170627.1.90097 WP_001170627.1.90252 WP_001170627.1.90409 WP_001170627.1.90417 WP_001170627.1.90453 WP_001170627.1.90458 WP_001170627.1.90557 WP_001170627.1.90585 WP_001170627.1.90641 WP_001170627.1.90734 WP_001170627.1.91003 WP_001170627.1.91069 WP_001170627.1.91278 WP_001170627.1.91512 WP_001170627.1.91528 WP_001170627.1.91564 WP_001170627.1.91628 WP_001170627.1.91655 WP_001170627.1.91724 WP_001170627.1.91732 WP_001170627.1.91788 WP_001170627.1.92013 WP_001170627.1.92093 WP_001170627.1.92108 WP_001170627.1.92183 WP_001170627.1.92208 WP_001170627.1.92268 WP_001170627.1.92310 WP_001170627.1.92443 WP_001170627.1.92482 WP_001170627.1.92531 WP_001170627.1.92669 WP_001170627.1.92671 WP_001170627.1.92738 WP_001170627.1.93086 WP_001170627.1.93101 WP_001170627.1.93136 WP_001170627.1.93155 WP_001170627.1.93365 WP_001170627.1.93543 WP_001170627.1.93650 WP_001170627.1.93656 WP_001170627.1.93662 WP_001170627.1.937 WP_001170627.1.93705 WP_001170627.1.93804 WP_001170627.1.9389 WP_001170627.1.93994 WP_001170627.1.94072 WP_001170627.1.94162 WP_001170627.1.94168 WP_001170627.1.94198 WP_001170627.1.9432 WP_001170627.1.94354 WP_001170627.1.94380 WP_001170627.1.94458 WP_001170627.1.94565 WP_001170627.1.94584 WP_001170627.1.94674 WP_001170627.1.94796 WP_001170627.1.94959 WP_001170627.1.95051 WP_001170627.1.95085 WP_001170627.1.95121 WP_001170627.1.95282 WP_001170627.1.95546 WP_001170627.1.95630 WP_001170627.1.95911 WP_001170627.1.96139 WP_001170627.1.96317 WP_001170627.1.96343 WP_001170627.1.9644 WP_001170627.1.96469 WP_001170627.1.96500 WP_001170627.1.96555 WP_001170627.1.96563 WP_001170627.1.96732 WP_001170627.1.96771 WP_001170627.1.97015 WP_001170627.1.97145 WP_001170627.1.97190 WP_001170627.1.97318 WP_001170627.1.97369 WP_001170627.1.97594 WP_001170627.1.97597 WP_001170627.1.97613 WP_001170627.1.97620 WP_001170627.1.97727 WP_001170627.1.97732 WP_001170627.1.97736 WP_001170627.1.9775 WP_001170627.1.97846 WP_001170627.1.98006 WP_001170627.1.98019 WP_001170627.1.98022 WP_001170627.1.98110 WP_001170627.1.98146 WP_001170627.1.98219 WP_001170627.1.9841 WP_001170627.1.98495 WP_001170627.1.98531 WP_001170627.1.98577 WP_001170627.1.98608 WP_001170627.1.98676 WP_001170627.1.98677 WP_001170627.1.98760 WP_001170627.1.98843 WP_001170627.1.9898 WP_001170627.1.99098 WP_001170627.1.99184 WP_001170627.1.99267 WP_001170627.1.99276 WP_001170627.1.99646 WP_001170627.1.99657 WP_001170627.1.99660 WP_001170627.1.99712 WP_001170627.1.99813 WP_001170627.1.99858 WP_001170627.1.99889 WP_001170627.1.99958 ABAO01000036|CDS_40138-38963 AE006468|CDS_1541987-1540812 CP001363|CDS_1551963-1550788 FN424405|CDS_1538499-1537324 IDP01869 gi|550900829|ref|YP_008669921.1| gi|378444890|ref|YP_005232522.1| gi|383496169|ref|YP_005396858.1| gi|16764813|ref|NP_460428.1| gi|378699350|ref|YP_005181307.1| gi|378988803|ref|YP_005251967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]