SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450151|ref|YP_005237510.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450151|ref|YP_005237510.1|
Domain Number 1 Region: 51-176
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.48e-22
Family Probable transcriptional regulator VC1968, C-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.83e-18
Family Probable transcriptional regulator VC1968, N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450151|ref|YP_005237510.1|
Sequence length 178
Comment putative repressor [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MDNLTHYLATTLRTLRHQRGWSLSRLAEISGVSKAMLGQIERNESSPTVATLWKIATGLN
VPFSVFISPPQAEFPPTFDPQQQAMVITPLFPWDPELCFDYFSLLLAPGTVSESTPHKAG
VIEHVVVIQGRLDMCTGGVWQTIDAGKGLRFAGDTAHTYRNSSDQTVHFHSLIHYPRD
Download sequence
Identical sequences A0A0D6G217 A0A0F6B1M8 A0A0F7J6K3 A0A0H3NBI5 A0A0U1F2N6 A0A0W4I7L3 A0A2D3APX6 A0A2H9YKJ8 E8XJ52 Q8ZPC6
gi|16764949|ref|NP_460564.1| gi|525838212|ref|YP_008255192.1| gi|526220243|ref|YP_008265810.1| gi|378445019|ref|YP_005232651.1| 99287.STM1605 APC7594 gi|379700775|ref|YP_005242503.1| gi|550900965|ref|YP_008670057.1| gi|378988945|ref|YP_005252109.1| gi|378450151|ref|YP_005237510.1| gi|378699485|ref|YP_005181442.1| NP_460564.1.58477 WP_000369555.1.100010 WP_000369555.1.100234 WP_000369555.1.100376 WP_000369555.1.100424 WP_000369555.1.100436 WP_000369555.1.100484 WP_000369555.1.100488 WP_000369555.1.100597 WP_000369555.1.10076 WP_000369555.1.100781 WP_000369555.1.100793 WP_000369555.1.100869 WP_000369555.1.100871 WP_000369555.1.100882 WP_000369555.1.101007 WP_000369555.1.101020 WP_000369555.1.101074 WP_000369555.1.101078 WP_000369555.1.101180 WP_000369555.1.101259 WP_000369555.1.101284 WP_000369555.1.101291 WP_000369555.1.101353 WP_000369555.1.101386 WP_000369555.1.101404 WP_000369555.1.101420 WP_000369555.1.101589 WP_000369555.1.101707 WP_000369555.1.101734 WP_000369555.1.101878 WP_000369555.1.101953 WP_000369555.1.10220 WP_000369555.1.10266 WP_000369555.1.10429 WP_000369555.1.10439 WP_000369555.1.10678 WP_000369555.1.10753 WP_000369555.1.10992 WP_000369555.1.11031 WP_000369555.1.11098 WP_000369555.1.11168 WP_000369555.1.11190 WP_000369555.1.11295 WP_000369555.1.11455 WP_000369555.1.11458 WP_000369555.1.11518 WP_000369555.1.11532 WP_000369555.1.11543 WP_000369555.1.11763 WP_000369555.1.11772 WP_000369555.1.11897 WP_000369555.1.12114 WP_000369555.1.12351 WP_000369555.1.12370 WP_000369555.1.12546 WP_000369555.1.1264 WP_000369555.1.12728 WP_000369555.1.12879 WP_000369555.1.12936 WP_000369555.1.12995 WP_000369555.1.13027 WP_000369555.1.13106 WP_000369555.1.13130 WP_000369555.1.13414 WP_000369555.1.13488 WP_000369555.1.13509 WP_000369555.1.13669 WP_000369555.1.13741 WP_000369555.1.1387 WP_000369555.1.13908 WP_000369555.1.13932 WP_000369555.1.13968 WP_000369555.1.14001 WP_000369555.1.14151 WP_000369555.1.14239 WP_000369555.1.14320 WP_000369555.1.14379 WP_000369555.1.14406 WP_000369555.1.14410 WP_000369555.1.14466 WP_000369555.1.14524 WP_000369555.1.14554 WP_000369555.1.14725 WP_000369555.1.14852 WP_000369555.1.1489 WP_000369555.1.14932 WP_000369555.1.15055 WP_000369555.1.15079 WP_000369555.1.15124 WP_000369555.1.15223 WP_000369555.1.15226 WP_000369555.1.15316 WP_000369555.1.15369 WP_000369555.1.1540 WP_000369555.1.15508 WP_000369555.1.15784 WP_000369555.1.15830 WP_000369555.1.15909 WP_000369555.1.16062 WP_000369555.1.16063 WP_000369555.1.16103 WP_000369555.1.16226 WP_000369555.1.16233 WP_000369555.1.16284 WP_000369555.1.16328 WP_000369555.1.1635 WP_000369555.1.16468 WP_000369555.1.16614 WP_000369555.1.16650 WP_000369555.1.16686 WP_000369555.1.16691 WP_000369555.1.16732 WP_000369555.1.16735 WP_000369555.1.16786 WP_000369555.1.16858 WP_000369555.1.16896 WP_000369555.1.16916 WP_000369555.1.16965 WP_000369555.1.1700 WP_000369555.1.17307 WP_000369555.1.174 WP_000369555.1.17480 WP_000369555.1.17546 WP_000369555.1.17702 WP_000369555.1.17705 WP_000369555.1.18019 WP_000369555.1.18111 WP_000369555.1.18163 WP_000369555.1.18265 WP_000369555.1.18267 WP_000369555.1.18468 WP_000369555.1.18607 WP_000369555.1.18705 WP_000369555.1.18715 WP_000369555.1.18776 WP_000369555.1.18822 WP_000369555.1.18881 WP_000369555.1.18940 WP_000369555.1.18949 WP_000369555.1.19053 WP_000369555.1.19320 WP_000369555.1.19458 WP_000369555.1.19460 WP_000369555.1.19461 WP_000369555.1.19614 WP_000369555.1.19702 WP_000369555.1.19706 WP_000369555.1.19724 WP_000369555.1.19749 WP_000369555.1.19784 WP_000369555.1.19802 WP_000369555.1.19809 WP_000369555.1.19867 WP_000369555.1.1998 WP_000369555.1.20 WP_000369555.1.2010 WP_000369555.1.20212 WP_000369555.1.20266 WP_000369555.1.20271 WP_000369555.1.20362 WP_000369555.1.20418 WP_000369555.1.20443 WP_000369555.1.20525 WP_000369555.1.2054 WP_000369555.1.20553 WP_000369555.1.20626 WP_000369555.1.20646 WP_000369555.1.20886 WP_000369555.1.20908 WP_000369555.1.21049 WP_000369555.1.21146 WP_000369555.1.21245 WP_000369555.1.21246 WP_000369555.1.21269 WP_000369555.1.21400 WP_000369555.1.21497 WP_000369555.1.21499 WP_000369555.1.21603 WP_000369555.1.21751 WP_000369555.1.21757 WP_000369555.1.22024 WP_000369555.1.2205 WP_000369555.1.22062 WP_000369555.1.22067 WP_000369555.1.2221 WP_000369555.1.2235 WP_000369555.1.22379 WP_000369555.1.22427 WP_000369555.1.2246 WP_000369555.1.22485 WP_000369555.1.22620 WP_000369555.1.22870 WP_000369555.1.22979 WP_000369555.1.23102 WP_000369555.1.23114 WP_000369555.1.2314 WP_000369555.1.23192 WP_000369555.1.23259 WP_000369555.1.23460 WP_000369555.1.23472 WP_000369555.1.23482 WP_000369555.1.23634 WP_000369555.1.2364 WP_000369555.1.23932 WP_000369555.1.24017 WP_000369555.1.24206 WP_000369555.1.24308 WP_000369555.1.24578 WP_000369555.1.24737 WP_000369555.1.24779 WP_000369555.1.25008 WP_000369555.1.25015 WP_000369555.1.25405 WP_000369555.1.25454 WP_000369555.1.25493 WP_000369555.1.25668 WP_000369555.1.25690 WP_000369555.1.2570 WP_000369555.1.25740 WP_000369555.1.25814 WP_000369555.1.25988 WP_000369555.1.26282 WP_000369555.1.26311 WP_000369555.1.26319 WP_000369555.1.26429 WP_000369555.1.26440 WP_000369555.1.26493 WP_000369555.1.26551 WP_000369555.1.26567 WP_000369555.1.27010 WP_000369555.1.27173 WP_000369555.1.27206 WP_000369555.1.27423 WP_000369555.1.27561 WP_000369555.1.2763 WP_000369555.1.27665 WP_000369555.1.27707 WP_000369555.1.27761 WP_000369555.1.2777 WP_000369555.1.27857 WP_000369555.1.27977 WP_000369555.1.28094 WP_000369555.1.28170 WP_000369555.1.28302 WP_000369555.1.2835 WP_000369555.1.28370 WP_000369555.1.28538 WP_000369555.1.28575 WP_000369555.1.28625 WP_000369555.1.28655 WP_000369555.1.28694 WP_000369555.1.2879 WP_000369555.1.2890 WP_000369555.1.28938 WP_000369555.1.28946 WP_000369555.1.29006 WP_000369555.1.29010 WP_000369555.1.2910 WP_000369555.1.29588 WP_000369555.1.29601 WP_000369555.1.29606 WP_000369555.1.29615 WP_000369555.1.29619 WP_000369555.1.29704 WP_000369555.1.29969 WP_000369555.1.30006 WP_000369555.1.30027 WP_000369555.1.30180 WP_000369555.1.30469 WP_000369555.1.30505 WP_000369555.1.30507 WP_000369555.1.30535 WP_000369555.1.30547 WP_000369555.1.30794 WP_000369555.1.30833 WP_000369555.1.30835 WP_000369555.1.30972 WP_000369555.1.31 WP_000369555.1.3113 WP_000369555.1.31185 WP_000369555.1.3119 WP_000369555.1.31190 WP_000369555.1.31195 WP_000369555.1.31196 WP_000369555.1.31281 WP_000369555.1.31362 WP_000369555.1.31504 WP_000369555.1.31515 WP_000369555.1.31578 WP_000369555.1.31658 WP_000369555.1.31940 WP_000369555.1.31967 WP_000369555.1.31972 WP_000369555.1.32192 WP_000369555.1.32206 WP_000369555.1.32438 WP_000369555.1.32515 WP_000369555.1.32660 WP_000369555.1.32702 WP_000369555.1.32714 WP_000369555.1.32786 WP_000369555.1.32804 WP_000369555.1.32907 WP_000369555.1.33030 WP_000369555.1.33127 WP_000369555.1.33143 WP_000369555.1.33248 WP_000369555.1.33261 WP_000369555.1.333 WP_000369555.1.33492 WP_000369555.1.33553 WP_000369555.1.33592 WP_000369555.1.33894 WP_000369555.1.34043 WP_000369555.1.34075 WP_000369555.1.34257 WP_000369555.1.34279 WP_000369555.1.34319 WP_000369555.1.34453 WP_000369555.1.34610 WP_000369555.1.34856 WP_000369555.1.34975 WP_000369555.1.35045 WP_000369555.1.35129 WP_000369555.1.35184 WP_000369555.1.35404 WP_000369555.1.35408 WP_000369555.1.35425 WP_000369555.1.35446 WP_000369555.1.35463 WP_000369555.1.35503 WP_000369555.1.35509 WP_000369555.1.35590 WP_000369555.1.35940 WP_000369555.1.36003 WP_000369555.1.3601 WP_000369555.1.36609 WP_000369555.1.36690 WP_000369555.1.3670 WP_000369555.1.36705 WP_000369555.1.36918 WP_000369555.1.36931 WP_000369555.1.37073 WP_000369555.1.37111 WP_000369555.1.37112 WP_000369555.1.37256 WP_000369555.1.37293 WP_000369555.1.37370 WP_000369555.1.37376 WP_000369555.1.3744 WP_000369555.1.37498 WP_000369555.1.37504 WP_000369555.1.37618 WP_000369555.1.37968 WP_000369555.1.37978 WP_000369555.1.38125 WP_000369555.1.38145 WP_000369555.1.383 WP_000369555.1.3848 WP_000369555.1.38613 WP_000369555.1.38673 WP_000369555.1.38693 WP_000369555.1.38773 WP_000369555.1.38882 WP_000369555.1.38913 WP_000369555.1.39003 WP_000369555.1.39136 WP_000369555.1.39197 WP_000369555.1.39229 WP_000369555.1.39405 WP_000369555.1.39420 WP_000369555.1.39449 WP_000369555.1.39512 WP_000369555.1.39629 WP_000369555.1.39763 WP_000369555.1.39862 WP_000369555.1.39921 WP_000369555.1.39923 WP_000369555.1.40017 WP_000369555.1.40072 WP_000369555.1.40073 WP_000369555.1.4011 WP_000369555.1.40208 WP_000369555.1.40240 WP_000369555.1.40257 WP_000369555.1.40292 WP_000369555.1.40305 WP_000369555.1.40311 WP_000369555.1.40380 WP_000369555.1.40395 WP_000369555.1.40465 WP_000369555.1.40710 WP_000369555.1.4075 WP_000369555.1.4087 WP_000369555.1.40877 WP_000369555.1.41017 WP_000369555.1.41086 WP_000369555.1.41091 WP_000369555.1.41226 WP_000369555.1.41279 WP_000369555.1.41516 WP_000369555.1.41554 WP_000369555.1.41572 WP_000369555.1.41591 WP_000369555.1.41662 WP_000369555.1.41708 WP_000369555.1.41761 WP_000369555.1.41882 WP_000369555.1.41979 WP_000369555.1.41985 WP_000369555.1.42104 WP_000369555.1.42320 WP_000369555.1.42342 WP_000369555.1.42422 WP_000369555.1.4276 WP_000369555.1.42864 WP_000369555.1.4288 WP_000369555.1.43018 WP_000369555.1.43041 WP_000369555.1.43244 WP_000369555.1.43312 WP_000369555.1.43334 WP_000369555.1.43437 WP_000369555.1.43522 WP_000369555.1.43613 WP_000369555.1.43668 WP_000369555.1.43886 WP_000369555.1.44005 WP_000369555.1.44043 WP_000369555.1.44099 WP_000369555.1.44121 WP_000369555.1.44291 WP_000369555.1.44310 WP_000369555.1.44386 WP_000369555.1.44479 WP_000369555.1.44640 WP_000369555.1.4467 WP_000369555.1.44747 WP_000369555.1.4485 WP_000369555.1.44877 WP_000369555.1.44927 WP_000369555.1.45067 WP_000369555.1.45074 WP_000369555.1.45079 WP_000369555.1.45098 WP_000369555.1.45177 WP_000369555.1.45184 WP_000369555.1.45259 WP_000369555.1.45349 WP_000369555.1.45365 WP_000369555.1.45550 WP_000369555.1.45585 WP_000369555.1.45660 WP_000369555.1.45690 WP_000369555.1.458 WP_000369555.1.46011 WP_000369555.1.46069 WP_000369555.1.46112 WP_000369555.1.46173 WP_000369555.1.46174 WP_000369555.1.46187 WP_000369555.1.46303 WP_000369555.1.46595 WP_000369555.1.46675 WP_000369555.1.47057 WP_000369555.1.47214 WP_000369555.1.47429 WP_000369555.1.47448 WP_000369555.1.4747 WP_000369555.1.47472 WP_000369555.1.47478 WP_000369555.1.47621 WP_000369555.1.47799 WP_000369555.1.47928 WP_000369555.1.48242 WP_000369555.1.48253 WP_000369555.1.483 WP_000369555.1.48367 WP_000369555.1.48377 WP_000369555.1.4853 WP_000369555.1.48788 WP_000369555.1.4885 WP_000369555.1.48876 WP_000369555.1.48894 WP_000369555.1.48919 WP_000369555.1.49084 WP_000369555.1.49155 WP_000369555.1.49204 WP_000369555.1.49239 WP_000369555.1.49256 WP_000369555.1.49290 WP_000369555.1.49340 WP_000369555.1.49366 WP_000369555.1.49490 WP_000369555.1.49515 WP_000369555.1.49572 WP_000369555.1.4979 WP_000369555.1.49803 WP_000369555.1.49805 WP_000369555.1.49929 WP_000369555.1.50080 WP_000369555.1.50161 WP_000369555.1.50211 WP_000369555.1.50376 WP_000369555.1.50389 WP_000369555.1.50676 WP_000369555.1.50804 WP_000369555.1.50808 WP_000369555.1.5088 WP_000369555.1.50908 WP_000369555.1.50941 WP_000369555.1.51014 WP_000369555.1.51022 WP_000369555.1.51179 WP_000369555.1.51182 WP_000369555.1.51186 WP_000369555.1.51487 WP_000369555.1.51488 WP_000369555.1.51634 WP_000369555.1.51649 WP_000369555.1.51686 WP_000369555.1.51756 WP_000369555.1.51911 WP_000369555.1.51932 WP_000369555.1.51989 WP_000369555.1.52121 WP_000369555.1.52346 WP_000369555.1.52353 WP_000369555.1.52361 WP_000369555.1.52653 WP_000369555.1.52656 WP_000369555.1.52743 WP_000369555.1.52857 WP_000369555.1.52898 WP_000369555.1.52915 WP_000369555.1.53190 WP_000369555.1.53406 WP_000369555.1.53466 WP_000369555.1.53529 WP_000369555.1.53543 WP_000369555.1.53757 WP_000369555.1.53812 WP_000369555.1.54033 WP_000369555.1.54075 WP_000369555.1.54196 WP_000369555.1.54209 WP_000369555.1.54271 WP_000369555.1.54274 WP_000369555.1.54319 WP_000369555.1.54364 WP_000369555.1.54400 WP_000369555.1.54644 WP_000369555.1.54662 WP_000369555.1.54722 WP_000369555.1.54749 WP_000369555.1.54764 WP_000369555.1.55008 WP_000369555.1.55152 WP_000369555.1.55156 WP_000369555.1.55285 WP_000369555.1.55475 WP_000369555.1.55647 WP_000369555.1.55743 WP_000369555.1.55768 WP_000369555.1.55782 WP_000369555.1.55796 WP_000369555.1.56002 WP_000369555.1.56012 WP_000369555.1.56105 WP_000369555.1.56238 WP_000369555.1.56286 WP_000369555.1.56304 WP_000369555.1.56414 WP_000369555.1.56438 WP_000369555.1.56560 WP_000369555.1.56601 WP_000369555.1.56614 WP_000369555.1.56671 WP_000369555.1.56682 WP_000369555.1.56875 WP_000369555.1.56877 WP_000369555.1.57168 WP_000369555.1.57187 WP_000369555.1.57377 WP_000369555.1.57418 WP_000369555.1.57433 WP_000369555.1.57515 WP_000369555.1.57529 WP_000369555.1.57576 WP_000369555.1.57601 WP_000369555.1.57607 WP_000369555.1.57763 WP_000369555.1.57862 WP_000369555.1.57890 WP_000369555.1.57891 WP_000369555.1.57978 WP_000369555.1.5801 WP_000369555.1.58041 WP_000369555.1.58418 WP_000369555.1.58548 WP_000369555.1.5858 WP_000369555.1.58662 WP_000369555.1.58669 WP_000369555.1.58745 WP_000369555.1.58803 WP_000369555.1.5886 WP_000369555.1.59094 WP_000369555.1.59224 WP_000369555.1.59321 WP_000369555.1.59375 WP_000369555.1.59458 WP_000369555.1.59490 WP_000369555.1.59508 WP_000369555.1.59684 WP_000369555.1.59694 WP_000369555.1.59771 WP_000369555.1.5979 WP_000369555.1.59953 WP_000369555.1.60008 WP_000369555.1.60021 WP_000369555.1.60052 WP_000369555.1.60069 WP_000369555.1.60140 WP_000369555.1.60155 WP_000369555.1.60285 WP_000369555.1.60379 WP_000369555.1.60464 WP_000369555.1.60874 WP_000369555.1.60941 WP_000369555.1.61078 WP_000369555.1.6114 WP_000369555.1.61232 WP_000369555.1.6129 WP_000369555.1.61296 WP_000369555.1.61345 WP_000369555.1.61417 WP_000369555.1.61574 WP_000369555.1.61712 WP_000369555.1.61714 WP_000369555.1.61730 WP_000369555.1.61857 WP_000369555.1.61918 WP_000369555.1.61952 WP_000369555.1.62007 WP_000369555.1.62025 WP_000369555.1.62204 WP_000369555.1.62304 WP_000369555.1.62364 WP_000369555.1.62374 WP_000369555.1.62403 WP_000369555.1.6253 WP_000369555.1.62853 WP_000369555.1.62903 WP_000369555.1.62910 WP_000369555.1.62955 WP_000369555.1.63181 WP_000369555.1.63203 WP_000369555.1.63256 WP_000369555.1.63290 WP_000369555.1.63382 WP_000369555.1.63432 WP_000369555.1.63461 WP_000369555.1.63479 WP_000369555.1.63577 WP_000369555.1.63664 WP_000369555.1.63718 WP_000369555.1.6375 WP_000369555.1.63757 WP_000369555.1.63834 WP_000369555.1.64046 WP_000369555.1.64244 WP_000369555.1.64403 WP_000369555.1.64649 WP_000369555.1.64702 WP_000369555.1.64757 WP_000369555.1.64781 WP_000369555.1.64831 WP_000369555.1.6489 WP_000369555.1.65018 WP_000369555.1.65028 WP_000369555.1.65171 WP_000369555.1.65248 WP_000369555.1.6535 WP_000369555.1.65474 WP_000369555.1.65633 WP_000369555.1.6565 WP_000369555.1.65696 WP_000369555.1.6575 WP_000369555.1.65782 WP_000369555.1.6630 WP_000369555.1.66314 WP_000369555.1.66358 WP_000369555.1.66362 WP_000369555.1.6638 WP_000369555.1.6640 WP_000369555.1.66698 WP_000369555.1.6680 WP_000369555.1.66834 WP_000369555.1.66901 WP_000369555.1.66962 WP_000369555.1.67037 WP_000369555.1.67045 WP_000369555.1.67181 WP_000369555.1.67268 WP_000369555.1.67347 WP_000369555.1.67465 WP_000369555.1.67552 WP_000369555.1.67682 WP_000369555.1.67829 WP_000369555.1.67887 WP_000369555.1.68073 WP_000369555.1.68201 WP_000369555.1.68206 WP_000369555.1.6827 WP_000369555.1.68275 WP_000369555.1.6849 WP_000369555.1.68547 WP_000369555.1.68589 WP_000369555.1.68655 WP_000369555.1.68656 WP_000369555.1.68778 WP_000369555.1.68787 WP_000369555.1.68894 WP_000369555.1.68928 WP_000369555.1.68975 WP_000369555.1.69006 WP_000369555.1.6913 WP_000369555.1.69146 WP_000369555.1.69255 WP_000369555.1.69397 WP_000369555.1.69564 WP_000369555.1.69644 WP_000369555.1.69704 WP_000369555.1.69754 WP_000369555.1.7021 WP_000369555.1.70241 WP_000369555.1.70269 WP_000369555.1.70289 WP_000369555.1.70447 WP_000369555.1.70485 WP_000369555.1.70643 WP_000369555.1.70683 WP_000369555.1.70883 WP_000369555.1.70922 WP_000369555.1.70948 WP_000369555.1.71116 WP_000369555.1.71146 WP_000369555.1.71165 WP_000369555.1.71188 WP_000369555.1.71202 WP_000369555.1.71243 WP_000369555.1.71306 WP_000369555.1.71337 WP_000369555.1.71378 WP_000369555.1.71401 WP_000369555.1.71702 WP_000369555.1.71750 WP_000369555.1.71845 WP_000369555.1.71881 WP_000369555.1.71908 WP_000369555.1.71952 WP_000369555.1.71973 WP_000369555.1.72105 WP_000369555.1.72203 WP_000369555.1.72376 WP_000369555.1.72594 WP_000369555.1.72871 WP_000369555.1.72975 WP_000369555.1.7315 WP_000369555.1.73200 WP_000369555.1.7334 WP_000369555.1.73377 WP_000369555.1.73481 WP_000369555.1.7356 WP_000369555.1.73581 WP_000369555.1.73617 WP_000369555.1.73753 WP_000369555.1.73758 WP_000369555.1.73794 WP_000369555.1.7387 WP_000369555.1.73924 WP_000369555.1.74029 WP_000369555.1.74181 WP_000369555.1.74191 WP_000369555.1.7433 WP_000369555.1.74379 WP_000369555.1.74410 WP_000369555.1.74466 WP_000369555.1.74529 WP_000369555.1.74545 WP_000369555.1.74745 WP_000369555.1.75129 WP_000369555.1.75187 WP_000369555.1.75288 WP_000369555.1.75334 WP_000369555.1.75362 WP_000369555.1.75385 WP_000369555.1.75392 WP_000369555.1.75760 WP_000369555.1.75764 WP_000369555.1.75837 WP_000369555.1.75874 WP_000369555.1.75945 WP_000369555.1.76020 WP_000369555.1.76252 WP_000369555.1.76445 WP_000369555.1.7660 WP_000369555.1.76673 WP_000369555.1.76706 WP_000369555.1.76721 WP_000369555.1.76756 WP_000369555.1.76760 WP_000369555.1.76875 WP_000369555.1.76880 WP_000369555.1.76899 WP_000369555.1.77038 WP_000369555.1.77047 WP_000369555.1.77080 WP_000369555.1.7712 WP_000369555.1.77180 WP_000369555.1.77244 WP_000369555.1.77292 WP_000369555.1.77349 WP_000369555.1.77514 WP_000369555.1.77529 WP_000369555.1.77549 WP_000369555.1.77692 WP_000369555.1.7782 WP_000369555.1.77851 WP_000369555.1.77898 WP_000369555.1.77918 WP_000369555.1.77960 WP_000369555.1.78033 WP_000369555.1.78076 WP_000369555.1.78096 WP_000369555.1.78100 WP_000369555.1.78110 WP_000369555.1.78120 WP_000369555.1.78383 WP_000369555.1.78407 WP_000369555.1.7861 WP_000369555.1.78618 WP_000369555.1.78673 WP_000369555.1.78735 WP_000369555.1.78802 WP_000369555.1.78830 WP_000369555.1.78835 WP_000369555.1.78871 WP_000369555.1.78874 WP_000369555.1.78918 WP_000369555.1.78930 WP_000369555.1.79151 WP_000369555.1.79167 WP_000369555.1.79335 WP_000369555.1.79462 WP_000369555.1.79472 WP_000369555.1.79490 WP_000369555.1.79495 WP_000369555.1.79529 WP_000369555.1.79570 WP_000369555.1.7964 WP_000369555.1.79659 WP_000369555.1.79668 WP_000369555.1.79708 WP_000369555.1.79845 WP_000369555.1.80077 WP_000369555.1.80137 WP_000369555.1.80182 WP_000369555.1.80296 WP_000369555.1.80366 WP_000369555.1.80780 WP_000369555.1.80831 WP_000369555.1.80850 WP_000369555.1.80881 WP_000369555.1.80939 WP_000369555.1.8096 WP_000369555.1.81037 WP_000369555.1.81069 WP_000369555.1.81149 WP_000369555.1.81175 WP_000369555.1.8119 WP_000369555.1.81193 WP_000369555.1.81354 WP_000369555.1.81425 WP_000369555.1.81750 WP_000369555.1.81785 WP_000369555.1.81902 WP_000369555.1.81974 WP_000369555.1.82337 WP_000369555.1.82395 WP_000369555.1.82479 WP_000369555.1.82503 WP_000369555.1.82515 WP_000369555.1.82584 WP_000369555.1.82676 WP_000369555.1.82761 WP_000369555.1.8282 WP_000369555.1.82944 WP_000369555.1.82956 WP_000369555.1.83092 WP_000369555.1.83163 WP_000369555.1.83305 WP_000369555.1.83413 WP_000369555.1.83491 WP_000369555.1.83523 WP_000369555.1.8354 WP_000369555.1.83721 WP_000369555.1.83760 WP_000369555.1.83995 WP_000369555.1.84103 WP_000369555.1.84283 WP_000369555.1.84392 WP_000369555.1.8441 WP_000369555.1.84532 WP_000369555.1.84554 WP_000369555.1.84659 WP_000369555.1.84899 WP_000369555.1.8497 WP_000369555.1.85040 WP_000369555.1.85134 WP_000369555.1.85178 WP_000369555.1.85180 WP_000369555.1.85190 WP_000369555.1.8533 WP_000369555.1.8545 WP_000369555.1.85481 WP_000369555.1.85483 WP_000369555.1.85541 WP_000369555.1.8556 WP_000369555.1.85615 WP_000369555.1.85617 WP_000369555.1.85663 WP_000369555.1.85671 WP_000369555.1.85672 WP_000369555.1.85777 WP_000369555.1.85886 WP_000369555.1.85900 WP_000369555.1.85904 WP_000369555.1.85976 WP_000369555.1.86306 WP_000369555.1.86356 WP_000369555.1.86450 WP_000369555.1.86469 WP_000369555.1.86580 WP_000369555.1.86588 WP_000369555.1.86661 WP_000369555.1.8672 WP_000369555.1.8678 WP_000369555.1.86810 WP_000369555.1.8684 WP_000369555.1.86895 WP_000369555.1.86906 WP_000369555.1.87095 WP_000369555.1.87323 WP_000369555.1.8736 WP_000369555.1.87460 WP_000369555.1.87552 WP_000369555.1.87779 WP_000369555.1.87945 WP_000369555.1.88019 WP_000369555.1.88073 WP_000369555.1.8809 WP_000369555.1.88291 WP_000369555.1.88293 WP_000369555.1.8837 WP_000369555.1.88393 WP_000369555.1.88703 WP_000369555.1.88792 WP_000369555.1.88902 WP_000369555.1.8891 WP_000369555.1.88981 WP_000369555.1.89008 WP_000369555.1.89116 WP_000369555.1.89138 WP_000369555.1.89304 WP_000369555.1.89512 WP_000369555.1.89527 WP_000369555.1.89570 WP_000369555.1.89604 WP_000369555.1.89622 WP_000369555.1.89659 WP_000369555.1.89902 WP_000369555.1.8996 WP_000369555.1.90097 WP_000369555.1.90252 WP_000369555.1.90417 WP_000369555.1.90453 WP_000369555.1.90458 WP_000369555.1.90557 WP_000369555.1.90585 WP_000369555.1.90641 WP_000369555.1.91003 WP_000369555.1.91069 WP_000369555.1.91278 WP_000369555.1.91512 WP_000369555.1.91564 WP_000369555.1.91628 WP_000369555.1.91655 WP_000369555.1.91724 WP_000369555.1.91732 WP_000369555.1.91788 WP_000369555.1.92013 WP_000369555.1.92093 WP_000369555.1.92108 WP_000369555.1.92183 WP_000369555.1.92208 WP_000369555.1.92268 WP_000369555.1.92310 WP_000369555.1.92443 WP_000369555.1.92482 WP_000369555.1.92531 WP_000369555.1.92669 WP_000369555.1.92671 WP_000369555.1.92738 WP_000369555.1.93086 WP_000369555.1.93101 WP_000369555.1.93136 WP_000369555.1.93155 WP_000369555.1.93365 WP_000369555.1.93543 WP_000369555.1.93650 WP_000369555.1.93656 WP_000369555.1.93662 WP_000369555.1.937 WP_000369555.1.93705 WP_000369555.1.93804 WP_000369555.1.9389 WP_000369555.1.93994 WP_000369555.1.94072 WP_000369555.1.94162 WP_000369555.1.94168 WP_000369555.1.94198 WP_000369555.1.9432 WP_000369555.1.94354 WP_000369555.1.94380 WP_000369555.1.94458 WP_000369555.1.94565 WP_000369555.1.94584 WP_000369555.1.94674 WP_000369555.1.94796 WP_000369555.1.94959 WP_000369555.1.95051 WP_000369555.1.95085 WP_000369555.1.95121 WP_000369555.1.95282 WP_000369555.1.95546 WP_000369555.1.95630 WP_000369555.1.95911 WP_000369555.1.96317 WP_000369555.1.96343 WP_000369555.1.9644 WP_000369555.1.96469 WP_000369555.1.96500 WP_000369555.1.96555 WP_000369555.1.96563 WP_000369555.1.96732 WP_000369555.1.96771 WP_000369555.1.97015 WP_000369555.1.97145 WP_000369555.1.97190 WP_000369555.1.97318 WP_000369555.1.97369 WP_000369555.1.97594 WP_000369555.1.97597 WP_000369555.1.97613 WP_000369555.1.97620 WP_000369555.1.97727 WP_000369555.1.97732 WP_000369555.1.97736 WP_000369555.1.9775 WP_000369555.1.97846 WP_000369555.1.98006 WP_000369555.1.98019 WP_000369555.1.98022 WP_000369555.1.98110 WP_000369555.1.98146 WP_000369555.1.98219 WP_000369555.1.9841 WP_000369555.1.98495 WP_000369555.1.98531 WP_000369555.1.98577 WP_000369555.1.98676 WP_000369555.1.98677 WP_000369555.1.98760 WP_000369555.1.98843 WP_000369555.1.9898 WP_000369555.1.99098 WP_000369555.1.99184 WP_000369555.1.99267 WP_000369555.1.99276 WP_000369555.1.99646 WP_000369555.1.99657 WP_000369555.1.99660 WP_000369555.1.99712 WP_000369555.1.99813 WP_000369555.1.99858 WP_000369555.1.99889 WP_000369555.1.99958 gi|482903415|ref|YP_007901975.1| gi|378984165|ref|YP_005247320.1| ABAO01000017|CDS_22094-21558 AE006468|CDS_1696215-1695679 CP001363|CDS_1706192-1705656 FN424405|CDS_1688730-1688194 gi|383496304|ref|YP_005396993.1| gi|549724229|ref|YP_008644419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]