SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450219|ref|YP_005237578.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450219|ref|YP_005237578.1|
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily RmlC-like cupins 7.88e-17
Family Quercetin 2,3-dioxygenase-like 0.06
Further Details:      
 
Domain Number 2 Region: 18-84
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.85e-16
Family SinR domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450219|ref|YP_005237578.1|
Sequence length 200
Comment putative transcriptional regulator [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTKKVNLSTTAGADVSTINEAVSQRIKQFRSQKKMSLDELARRSGVSKGMLVEIEGCKAN
PSIALLCKIAAAMGVSVADVVNVASEPMVHLIDRDAIPVLWRGEKGGSAKLMAGTSGPDM
LELWQWIMHPGEQFESAGHPADTCELLFVNQGTLTLTVDGRRFIIREGCSAVARTDMPHA
YVNDTNEVLEFTMTVNEKSR
Download sequence
Identical sequences A0A0D6FYW2 A0A0F6B1U5 A0A0F7DIM2 A0A0H3NDB6 A0A0M0Q741 A0A0U1IXT6 A0A1S0ZJ52 A0A1X2RLF3 A0A221YL28 A0A2D1XRJ5 A0A2D3AQ78 A0A2H9YKS6 A0A2I6NDB0 A0A2I6NR05 E8XJZ4 G5L8T7 G5NCM4 Q8ZP82
gi|525838165|ref|YP_008255131.1| ABAK02000001|CDS_1087144-1086542 ABAM02000001|CDS_2218408-2217806 ABEH02000002|CDS_416297-415695 ABEI01000002|CDS_268653-268051 ABFG01000001|CDS_574407-575009 AE006468|CDS_1758491-1757889 CP001363|CDS_1768468-1767866 FN424405|CDS_1751006-1750404 gi|378984227|ref|YP_005247382.1| gi|383496362|ref|YP_005397051.1| gi|378699544|ref|YP_005181501.1| gi|378989004|ref|YP_005252168.1| gi|16765008|ref|NP_460623.1| 380031 gi|550901024|ref|YP_008670116.1| gi|526220291|ref|YP_008265873.1| 99287.STM1664 gi|482903479|ref|YP_007902039.1| NP_460623.1.58477 WP_000163371.1.100007 WP_000163371.1.100010 WP_000163371.1.100031 WP_000163371.1.100234 WP_000163371.1.100258 WP_000163371.1.100376 WP_000163371.1.100424 WP_000163371.1.100436 WP_000163371.1.100484 WP_000163371.1.100488 WP_000163371.1.100597 WP_000163371.1.10074 WP_000163371.1.10076 WP_000163371.1.100781 WP_000163371.1.100793 WP_000163371.1.100865 WP_000163371.1.100869 WP_000163371.1.100871 WP_000163371.1.100882 WP_000163371.1.100944 WP_000163371.1.100948 WP_000163371.1.101007 WP_000163371.1.101020 WP_000163371.1.101042 WP_000163371.1.101074 WP_000163371.1.101078 WP_000163371.1.101180 WP_000163371.1.101223 WP_000163371.1.101259 WP_000163371.1.101284 WP_000163371.1.101291 WP_000163371.1.101320 WP_000163371.1.101353 WP_000163371.1.101386 WP_000163371.1.101404 WP_000163371.1.101420 WP_000163371.1.101425 WP_000163371.1.101519 WP_000163371.1.101589 WP_000163371.1.101707 WP_000163371.1.101734 WP_000163371.1.101740 WP_000163371.1.101741 WP_000163371.1.101759 WP_000163371.1.10177 WP_000163371.1.101839 WP_000163371.1.101878 WP_000163371.1.101949 WP_000163371.1.101953 WP_000163371.1.10220 WP_000163371.1.10266 WP_000163371.1.10394 WP_000163371.1.10429 WP_000163371.1.10439 WP_000163371.1.10465 WP_000163371.1.10562 WP_000163371.1.10678 WP_000163371.1.10753 WP_000163371.1.10992 WP_000163371.1.11000 WP_000163371.1.11024 WP_000163371.1.11031 WP_000163371.1.11041 WP_000163371.1.11098 WP_000163371.1.11168 WP_000163371.1.11190 WP_000163371.1.11254 WP_000163371.1.11295 WP_000163371.1.113 WP_000163371.1.11455 WP_000163371.1.11458 WP_000163371.1.11518 WP_000163371.1.11532 WP_000163371.1.11543 WP_000163371.1.11763 WP_000163371.1.11772 WP_000163371.1.11865 WP_000163371.1.11875 WP_000163371.1.11897 WP_000163371.1.12007 WP_000163371.1.12025 WP_000163371.1.12047 WP_000163371.1.12114 WP_000163371.1.12159 WP_000163371.1.12351 WP_000163371.1.12370 WP_000163371.1.12397 WP_000163371.1.12456 WP_000163371.1.12472 WP_000163371.1.12546 WP_000163371.1.1264 WP_000163371.1.12728 WP_000163371.1.12879 WP_000163371.1.12936 WP_000163371.1.1299 WP_000163371.1.12995 WP_000163371.1.13027 WP_000163371.1.13106 WP_000163371.1.13130 WP_000163371.1.13311 WP_000163371.1.13334 WP_000163371.1.13414 WP_000163371.1.13509 WP_000163371.1.13669 WP_000163371.1.13741 WP_000163371.1.13764 WP_000163371.1.13857 WP_000163371.1.1387 WP_000163371.1.13908 WP_000163371.1.13932 WP_000163371.1.13968 WP_000163371.1.14001 WP_000163371.1.14041 WP_000163371.1.14151 WP_000163371.1.14239 WP_000163371.1.14320 WP_000163371.1.14369 WP_000163371.1.14379 WP_000163371.1.14406 WP_000163371.1.14410 WP_000163371.1.14466 WP_000163371.1.14495 WP_000163371.1.14524 WP_000163371.1.14554 WP_000163371.1.14725 WP_000163371.1.14737 WP_000163371.1.14789 WP_000163371.1.14808 WP_000163371.1.14852 WP_000163371.1.1489 WP_000163371.1.14932 WP_000163371.1.14964 WP_000163371.1.15046 WP_000163371.1.15055 WP_000163371.1.15079 WP_000163371.1.15102 WP_000163371.1.15124 WP_000163371.1.15223 WP_000163371.1.15226 WP_000163371.1.15316 WP_000163371.1.15369 WP_000163371.1.1540 WP_000163371.1.15508 WP_000163371.1.15616 WP_000163371.1.15784 WP_000163371.1.15830 WP_000163371.1.15909 WP_000163371.1.16000 WP_000163371.1.16062 WP_000163371.1.16063 WP_000163371.1.16103 WP_000163371.1.16172 WP_000163371.1.16201 WP_000163371.1.16226 WP_000163371.1.16233 WP_000163371.1.16284 WP_000163371.1.16328 WP_000163371.1.1635 WP_000163371.1.16468 WP_000163371.1.16614 WP_000163371.1.16650 WP_000163371.1.16686 WP_000163371.1.16691 WP_000163371.1.167 WP_000163371.1.16732 WP_000163371.1.16735 WP_000163371.1.16786 WP_000163371.1.16817 WP_000163371.1.16846 WP_000163371.1.16858 WP_000163371.1.16896 WP_000163371.1.16916 WP_000163371.1.16965 WP_000163371.1.1700 WP_000163371.1.17031 WP_000163371.1.17188 WP_000163371.1.17307 WP_000163371.1.174 WP_000163371.1.17439 WP_000163371.1.17480 WP_000163371.1.1749 WP_000163371.1.17546 WP_000163371.1.17560 WP_000163371.1.17693 WP_000163371.1.17702 WP_000163371.1.17705 WP_000163371.1.17747 WP_000163371.1.17865 WP_000163371.1.17901 WP_000163371.1.18019 WP_000163371.1.18103 WP_000163371.1.18111 WP_000163371.1.18163 WP_000163371.1.18249 WP_000163371.1.18265 WP_000163371.1.18267 WP_000163371.1.18282 WP_000163371.1.18468 WP_000163371.1.18607 WP_000163371.1.18705 WP_000163371.1.18715 WP_000163371.1.18776 WP_000163371.1.18822 WP_000163371.1.18881 WP_000163371.1.18895 WP_000163371.1.18940 WP_000163371.1.18949 WP_000163371.1.19053 WP_000163371.1.19291 WP_000163371.1.19320 WP_000163371.1.19340 WP_000163371.1.19458 WP_000163371.1.19460 WP_000163371.1.19461 WP_000163371.1.1954 WP_000163371.1.19614 WP_000163371.1.19642 WP_000163371.1.19702 WP_000163371.1.19723 WP_000163371.1.19724 WP_000163371.1.19749 WP_000163371.1.19784 WP_000163371.1.19802 WP_000163371.1.19809 WP_000163371.1.19863 WP_000163371.1.19867 WP_000163371.1.19884 WP_000163371.1.19970 WP_000163371.1.1998 WP_000163371.1.19987 WP_000163371.1.20 WP_000163371.1.20023 WP_000163371.1.20091 WP_000163371.1.2010 WP_000163371.1.20212 WP_000163371.1.20266 WP_000163371.1.20271 WP_000163371.1.20330 WP_000163371.1.20349 WP_000163371.1.20362 WP_000163371.1.20418 WP_000163371.1.20443 WP_000163371.1.20525 WP_000163371.1.2054 WP_000163371.1.20553 WP_000163371.1.20626 WP_000163371.1.20631 WP_000163371.1.20646 WP_000163371.1.20886 WP_000163371.1.20908 WP_000163371.1.2091 WP_000163371.1.21075 WP_000163371.1.21181 WP_000163371.1.21245 WP_000163371.1.21246 WP_000163371.1.21269 WP_000163371.1.21286 WP_000163371.1.21309 WP_000163371.1.21326 WP_000163371.1.21399 WP_000163371.1.21400 WP_000163371.1.21423 WP_000163371.1.21443 WP_000163371.1.21497 WP_000163371.1.21499 WP_000163371.1.21548 WP_000163371.1.21603 WP_000163371.1.21751 WP_000163371.1.21757 WP_000163371.1.21825 WP_000163371.1.21877 WP_000163371.1.21910 WP_000163371.1.22024 WP_000163371.1.2205 WP_000163371.1.22062 WP_000163371.1.22067 WP_000163371.1.22169 WP_000163371.1.22205 WP_000163371.1.2221 WP_000163371.1.2235 WP_000163371.1.22379 WP_000163371.1.22388 WP_000163371.1.22427 WP_000163371.1.2246 WP_000163371.1.22485 WP_000163371.1.22537 WP_000163371.1.22565 WP_000163371.1.22582 WP_000163371.1.22620 WP_000163371.1.22855 WP_000163371.1.22870 WP_000163371.1.22979 WP_000163371.1.23102 WP_000163371.1.23114 WP_000163371.1.2314 WP_000163371.1.23172 WP_000163371.1.23175 WP_000163371.1.23192 WP_000163371.1.23201 WP_000163371.1.23246 WP_000163371.1.23259 WP_000163371.1.23311 WP_000163371.1.23343 WP_000163371.1.2342 WP_000163371.1.23460 WP_000163371.1.23472 WP_000163371.1.23482 WP_000163371.1.23500 WP_000163371.1.23513 WP_000163371.1.23634 WP_000163371.1.2364 WP_000163371.1.237 WP_000163371.1.23720 WP_000163371.1.2380 WP_000163371.1.23932 WP_000163371.1.24017 WP_000163371.1.24206 WP_000163371.1.24308 WP_000163371.1.24419 WP_000163371.1.24578 WP_000163371.1.2467 WP_000163371.1.24686 WP_000163371.1.24727 WP_000163371.1.24737 WP_000163371.1.24779 WP_000163371.1.24839 WP_000163371.1.25008 WP_000163371.1.25015 WP_000163371.1.25064 WP_000163371.1.25206 WP_000163371.1.25217 WP_000163371.1.25405 WP_000163371.1.25454 WP_000163371.1.25493 WP_000163371.1.25498 WP_000163371.1.2554 WP_000163371.1.25546 WP_000163371.1.25596 WP_000163371.1.25668 WP_000163371.1.25690 WP_000163371.1.2570 WP_000163371.1.25740 WP_000163371.1.25793 WP_000163371.1.25809 WP_000163371.1.25814 WP_000163371.1.25988 WP_000163371.1.26075 WP_000163371.1.26213 WP_000163371.1.26282 WP_000163371.1.26311 WP_000163371.1.26319 WP_000163371.1.26384 WP_000163371.1.26429 WP_000163371.1.26440 WP_000163371.1.26493 WP_000163371.1.26551 WP_000163371.1.26563 WP_000163371.1.26567 WP_000163371.1.26758 WP_000163371.1.26892 WP_000163371.1.26924 WP_000163371.1.26980 WP_000163371.1.27010 WP_000163371.1.27122 WP_000163371.1.27169 WP_000163371.1.27173 WP_000163371.1.27206 WP_000163371.1.27255 WP_000163371.1.27423 WP_000163371.1.27523 WP_000163371.1.27535 WP_000163371.1.27561 WP_000163371.1.2763 WP_000163371.1.27665 WP_000163371.1.27679 WP_000163371.1.27707 WP_000163371.1.27761 WP_000163371.1.2777 WP_000163371.1.27857 WP_000163371.1.27977 WP_000163371.1.28073 WP_000163371.1.28094 WP_000163371.1.28126 WP_000163371.1.28170 WP_000163371.1.28301 WP_000163371.1.28302 WP_000163371.1.2835 WP_000163371.1.28370 WP_000163371.1.28538 WP_000163371.1.28575 WP_000163371.1.28625 WP_000163371.1.28655 WP_000163371.1.28673 WP_000163371.1.28694 WP_000163371.1.2879 WP_000163371.1.2890 WP_000163371.1.28902 WP_000163371.1.28938 WP_000163371.1.28946 WP_000163371.1.29006 WP_000163371.1.29010 WP_000163371.1.2910 WP_000163371.1.29530 WP_000163371.1.29588 WP_000163371.1.29601 WP_000163371.1.29606 WP_000163371.1.29615 WP_000163371.1.29619 WP_000163371.1.29682 WP_000163371.1.29704 WP_000163371.1.29768 WP_000163371.1.29924 WP_000163371.1.29969 WP_000163371.1.30006 WP_000163371.1.30027 WP_000163371.1.30170 WP_000163371.1.30180 WP_000163371.1.30238 WP_000163371.1.30246 WP_000163371.1.30389 WP_000163371.1.30425 WP_000163371.1.30469 WP_000163371.1.30505 WP_000163371.1.30507 WP_000163371.1.30535 WP_000163371.1.30547 WP_000163371.1.30635 WP_000163371.1.3076 WP_000163371.1.30794 WP_000163371.1.3080 WP_000163371.1.30823 WP_000163371.1.30833 WP_000163371.1.30835 WP_000163371.1.3095 WP_000163371.1.30972 WP_000163371.1.31 WP_000163371.1.31011 WP_000163371.1.31042 WP_000163371.1.31086 WP_000163371.1.3113 WP_000163371.1.31156 WP_000163371.1.31185 WP_000163371.1.3119 WP_000163371.1.31190 WP_000163371.1.31195 WP_000163371.1.31196 WP_000163371.1.31198 WP_000163371.1.31219 WP_000163371.1.31281 WP_000163371.1.31362 WP_000163371.1.31504 WP_000163371.1.31515 WP_000163371.1.31578 WP_000163371.1.31658 WP_000163371.1.31725 WP_000163371.1.31940 WP_000163371.1.31967 WP_000163371.1.31972 WP_000163371.1.32038 WP_000163371.1.32054 WP_000163371.1.32056 WP_000163371.1.32170 WP_000163371.1.32192 WP_000163371.1.32206 WP_000163371.1.32277 WP_000163371.1.32368 WP_000163371.1.32438 WP_000163371.1.32459 WP_000163371.1.32515 WP_000163371.1.32527 WP_000163371.1.32545 WP_000163371.1.32660 WP_000163371.1.32702 WP_000163371.1.32714 WP_000163371.1.32786 WP_000163371.1.32804 WP_000163371.1.32860 WP_000163371.1.32907 WP_000163371.1.32930 WP_000163371.1.33010 WP_000163371.1.33030 WP_000163371.1.3310 WP_000163371.1.33127 WP_000163371.1.33143 WP_000163371.1.33248 WP_000163371.1.33261 WP_000163371.1.333 WP_000163371.1.33492 WP_000163371.1.33553 WP_000163371.1.33592 WP_000163371.1.33693 WP_000163371.1.33825 WP_000163371.1.33894 WP_000163371.1.34043 WP_000163371.1.34075 WP_000163371.1.34184 WP_000163371.1.34257 WP_000163371.1.34279 WP_000163371.1.34319 WP_000163371.1.3445 WP_000163371.1.34453 WP_000163371.1.34610 WP_000163371.1.34647 WP_000163371.1.34703 WP_000163371.1.34707 WP_000163371.1.34801 WP_000163371.1.34817 WP_000163371.1.34856 WP_000163371.1.34975 WP_000163371.1.34977 WP_000163371.1.35045 WP_000163371.1.35125 WP_000163371.1.35129 WP_000163371.1.35184 WP_000163371.1.35294 WP_000163371.1.35404 WP_000163371.1.35408 WP_000163371.1.3541 WP_000163371.1.35425 WP_000163371.1.35429 WP_000163371.1.35446 WP_000163371.1.35463 WP_000163371.1.35494 WP_000163371.1.35503 WP_000163371.1.35509 WP_000163371.1.3556 WP_000163371.1.35590 WP_000163371.1.35648 WP_000163371.1.3566 WP_000163371.1.35940 WP_000163371.1.36003 WP_000163371.1.3601 WP_000163371.1.3610 WP_000163371.1.36512 WP_000163371.1.36564 WP_000163371.1.36609 WP_000163371.1.36652 WP_000163371.1.36690 WP_000163371.1.3670 WP_000163371.1.36705 WP_000163371.1.36839 WP_000163371.1.36918 WP_000163371.1.36931 WP_000163371.1.37013 WP_000163371.1.37063 WP_000163371.1.37073 WP_000163371.1.37111 WP_000163371.1.37112 WP_000163371.1.37256 WP_000163371.1.37293 WP_000163371.1.37370 WP_000163371.1.37376 WP_000163371.1.3744 WP_000163371.1.37498 WP_000163371.1.37504 WP_000163371.1.3751 WP_000163371.1.37618 WP_000163371.1.37687 WP_000163371.1.37965 WP_000163371.1.37968 WP_000163371.1.37978 WP_000163371.1.38125 WP_000163371.1.38145 WP_000163371.1.383 WP_000163371.1.38322 WP_000163371.1.38349 WP_000163371.1.3848 WP_000163371.1.38512 WP_000163371.1.38613 WP_000163371.1.38622 WP_000163371.1.38673 WP_000163371.1.3869 WP_000163371.1.38693 WP_000163371.1.38773 WP_000163371.1.38830 WP_000163371.1.38882 WP_000163371.1.3891 WP_000163371.1.38913 WP_000163371.1.38942 WP_000163371.1.39003 WP_000163371.1.39113 WP_000163371.1.39128 WP_000163371.1.39136 WP_000163371.1.39197 WP_000163371.1.39229 WP_000163371.1.39275 WP_000163371.1.39405 WP_000163371.1.39420 WP_000163371.1.39449 WP_000163371.1.39471 WP_000163371.1.39503 WP_000163371.1.39512 WP_000163371.1.39556 WP_000163371.1.39629 WP_000163371.1.39632 WP_000163371.1.39723 WP_000163371.1.39763 WP_000163371.1.39862 WP_000163371.1.39921 WP_000163371.1.39923 WP_000163371.1.40017 WP_000163371.1.40025 WP_000163371.1.40072 WP_000163371.1.40073 WP_000163371.1.4011 WP_000163371.1.40208 WP_000163371.1.40240 WP_000163371.1.40254 WP_000163371.1.40257 WP_000163371.1.40292 WP_000163371.1.40305 WP_000163371.1.40311 WP_000163371.1.40374 WP_000163371.1.40395 WP_000163371.1.40465 WP_000163371.1.40508 WP_000163371.1.40605 WP_000163371.1.40710 WP_000163371.1.40722 WP_000163371.1.4075 WP_000163371.1.4087 WP_000163371.1.40877 WP_000163371.1.4088 WP_000163371.1.40979 WP_000163371.1.41017 WP_000163371.1.41086 WP_000163371.1.41091 WP_000163371.1.41226 WP_000163371.1.41279 WP_000163371.1.41468 WP_000163371.1.41516 WP_000163371.1.41554 WP_000163371.1.41572 WP_000163371.1.41591 WP_000163371.1.41662 WP_000163371.1.41708 WP_000163371.1.41761 WP_000163371.1.41859 WP_000163371.1.41882 WP_000163371.1.41897 WP_000163371.1.41904 WP_000163371.1.41979 WP_000163371.1.41985 WP_000163371.1.42104 WP_000163371.1.42109 WP_000163371.1.42244 WP_000163371.1.42320 WP_000163371.1.42342 WP_000163371.1.42422 WP_000163371.1.42433 WP_000163371.1.42655 WP_000163371.1.42707 WP_000163371.1.4276 WP_000163371.1.42794 WP_000163371.1.42864 WP_000163371.1.4288 WP_000163371.1.4289 WP_000163371.1.42978 WP_000163371.1.43018 WP_000163371.1.43041 WP_000163371.1.43244 WP_000163371.1.43258 WP_000163371.1.43312 WP_000163371.1.43334 WP_000163371.1.43351 WP_000163371.1.43437 WP_000163371.1.43438 WP_000163371.1.43520 WP_000163371.1.43522 WP_000163371.1.43613 WP_000163371.1.43668 WP_000163371.1.43710 WP_000163371.1.43782 WP_000163371.1.43839 WP_000163371.1.43886 WP_000163371.1.44005 WP_000163371.1.44043 WP_000163371.1.44099 WP_000163371.1.44121 WP_000163371.1.44291 WP_000163371.1.44310 WP_000163371.1.44386 WP_000163371.1.44438 WP_000163371.1.44479 WP_000163371.1.44549 WP_000163371.1.44578 WP_000163371.1.44640 WP_000163371.1.4467 WP_000163371.1.44747 WP_000163371.1.44795 WP_000163371.1.4485 WP_000163371.1.44877 WP_000163371.1.44927 WP_000163371.1.45067 WP_000163371.1.45074 WP_000163371.1.45079 WP_000163371.1.45098 WP_000163371.1.45123 WP_000163371.1.45177 WP_000163371.1.45184 WP_000163371.1.45229 WP_000163371.1.45259 WP_000163371.1.45344 WP_000163371.1.45349 WP_000163371.1.45365 WP_000163371.1.45550 WP_000163371.1.45585 WP_000163371.1.45660 WP_000163371.1.45690 WP_000163371.1.45797 WP_000163371.1.458 WP_000163371.1.46011 WP_000163371.1.46069 WP_000163371.1.46112 WP_000163371.1.46124 WP_000163371.1.46173 WP_000163371.1.46174 WP_000163371.1.46187 WP_000163371.1.46303 WP_000163371.1.46322 WP_000163371.1.46345 WP_000163371.1.46499 WP_000163371.1.46595 WP_000163371.1.46675 WP_000163371.1.46689 WP_000163371.1.46693 WP_000163371.1.46732 WP_000163371.1.46803 WP_000163371.1.46930 WP_000163371.1.47005 WP_000163371.1.47057 WP_000163371.1.47058 WP_000163371.1.47214 WP_000163371.1.47429 WP_000163371.1.47448 WP_000163371.1.4747 WP_000163371.1.47472 WP_000163371.1.47478 WP_000163371.1.47587 WP_000163371.1.47621 WP_000163371.1.47714 WP_000163371.1.47799 WP_000163371.1.47849 WP_000163371.1.47928 WP_000163371.1.48132 WP_000163371.1.48215 WP_000163371.1.48242 WP_000163371.1.48253 WP_000163371.1.483 WP_000163371.1.48367 WP_000163371.1.48377 WP_000163371.1.4853 WP_000163371.1.48788 WP_000163371.1.4885 WP_000163371.1.48876 WP_000163371.1.48894 WP_000163371.1.48918 WP_000163371.1.48919 WP_000163371.1.48931 WP_000163371.1.49084 WP_000163371.1.49155 WP_000163371.1.49204 WP_000163371.1.49239 WP_000163371.1.49256 WP_000163371.1.49276 WP_000163371.1.49290 WP_000163371.1.49340 WP_000163371.1.49358 WP_000163371.1.49366 WP_000163371.1.49443 WP_000163371.1.49490 WP_000163371.1.49515 WP_000163371.1.49550 WP_000163371.1.49572 WP_000163371.1.49590 WP_000163371.1.49780 WP_000163371.1.4979 WP_000163371.1.49803 WP_000163371.1.49805 WP_000163371.1.49929 WP_000163371.1.50 WP_000163371.1.50080 WP_000163371.1.50161 WP_000163371.1.50211 WP_000163371.1.50238 WP_000163371.1.50376 WP_000163371.1.50389 WP_000163371.1.50517 WP_000163371.1.50565 WP_000163371.1.50676 WP_000163371.1.50774 WP_000163371.1.50804 WP_000163371.1.50808 WP_000163371.1.5088 WP_000163371.1.50893 WP_000163371.1.50908 WP_000163371.1.50941 WP_000163371.1.51014 WP_000163371.1.51022 WP_000163371.1.51179 WP_000163371.1.51182 WP_000163371.1.51186 WP_000163371.1.51394 WP_000163371.1.51464 WP_000163371.1.51487 WP_000163371.1.51488 WP_000163371.1.51506 WP_000163371.1.51594 WP_000163371.1.51613 WP_000163371.1.51634 WP_000163371.1.51649 WP_000163371.1.51686 WP_000163371.1.51756 WP_000163371.1.51841 WP_000163371.1.51911 WP_000163371.1.51932 WP_000163371.1.51989 WP_000163371.1.52121 WP_000163371.1.52148 WP_000163371.1.52346 WP_000163371.1.52353 WP_000163371.1.52356 WP_000163371.1.52361 WP_000163371.1.52653 WP_000163371.1.52656 WP_000163371.1.52743 WP_000163371.1.52824 WP_000163371.1.52857 WP_000163371.1.52898 WP_000163371.1.52915 WP_000163371.1.5301 WP_000163371.1.53190 WP_000163371.1.53203 WP_000163371.1.53274 WP_000163371.1.53316 WP_000163371.1.53406 WP_000163371.1.53436 WP_000163371.1.53466 WP_000163371.1.53529 WP_000163371.1.53543 WP_000163371.1.53688 WP_000163371.1.53757 WP_000163371.1.53812 WP_000163371.1.54033 WP_000163371.1.54075 WP_000163371.1.54196 WP_000163371.1.542 WP_000163371.1.54209 WP_000163371.1.54271 WP_000163371.1.54273 WP_000163371.1.54274 WP_000163371.1.54319 WP_000163371.1.54364 WP_000163371.1.54400 WP_000163371.1.54500 WP_000163371.1.5459 WP_000163371.1.54644 WP_000163371.1.54662 WP_000163371.1.54694 WP_000163371.1.54722 WP_000163371.1.54749 WP_000163371.1.54764 WP_000163371.1.54827 WP_000163371.1.55008 WP_000163371.1.55152 WP_000163371.1.55156 WP_000163371.1.55223 WP_000163371.1.55224 WP_000163371.1.5525 WP_000163371.1.55285 WP_000163371.1.55361 WP_000163371.1.55475 WP_000163371.1.55647 WP_000163371.1.55672 WP_000163371.1.55743 WP_000163371.1.55768 WP_000163371.1.55782 WP_000163371.1.55796 WP_000163371.1.55993 WP_000163371.1.56002 WP_000163371.1.56012 WP_000163371.1.56105 WP_000163371.1.56152 WP_000163371.1.56238 WP_000163371.1.56286 WP_000163371.1.56304 WP_000163371.1.56385 WP_000163371.1.56414 WP_000163371.1.56438 WP_000163371.1.56560 WP_000163371.1.56597 WP_000163371.1.56614 WP_000163371.1.56651 WP_000163371.1.56671 WP_000163371.1.56682 WP_000163371.1.56875 WP_000163371.1.56877 WP_000163371.1.57168 WP_000163371.1.57187 WP_000163371.1.57232 WP_000163371.1.57377 WP_000163371.1.57399 WP_000163371.1.57418 WP_000163371.1.57433 WP_000163371.1.57494 WP_000163371.1.57510 WP_000163371.1.57515 WP_000163371.1.57529 WP_000163371.1.57576 WP_000163371.1.57601 WP_000163371.1.57607 WP_000163371.1.57709 WP_000163371.1.57735 WP_000163371.1.57763 WP_000163371.1.57781 WP_000163371.1.57862 WP_000163371.1.57890 WP_000163371.1.57891 WP_000163371.1.57978 WP_000163371.1.5801 WP_000163371.1.58041 WP_000163371.1.58144 WP_000163371.1.58153 WP_000163371.1.58418 WP_000163371.1.5846 WP_000163371.1.5854 WP_000163371.1.58548 WP_000163371.1.5858 WP_000163371.1.58662 WP_000163371.1.58669 WP_000163371.1.58698 WP_000163371.1.58745 WP_000163371.1.58803 WP_000163371.1.5886 WP_000163371.1.59094 WP_000163371.1.59125 WP_000163371.1.59136 WP_000163371.1.59224 WP_000163371.1.59236 WP_000163371.1.59375 WP_000163371.1.59412 WP_000163371.1.59439 WP_000163371.1.59458 WP_000163371.1.59490 WP_000163371.1.59508 WP_000163371.1.5953 WP_000163371.1.59562 WP_000163371.1.59636 WP_000163371.1.59684 WP_000163371.1.59694 WP_000163371.1.59771 WP_000163371.1.5979 WP_000163371.1.59953 WP_000163371.1.60008 WP_000163371.1.60021 WP_000163371.1.60052 WP_000163371.1.60069 WP_000163371.1.60140 WP_000163371.1.60370 WP_000163371.1.60379 WP_000163371.1.60464 WP_000163371.1.60469 WP_000163371.1.6052 WP_000163371.1.6086 WP_000163371.1.60874 WP_000163371.1.60976 WP_000163371.1.61078 WP_000163371.1.6114 WP_000163371.1.61200 WP_000163371.1.61232 WP_000163371.1.6129 WP_000163371.1.61296 WP_000163371.1.61345 WP_000163371.1.61417 WP_000163371.1.61434 WP_000163371.1.61574 WP_000163371.1.61582 WP_000163371.1.61609 WP_000163371.1.61662 WP_000163371.1.61712 WP_000163371.1.61714 WP_000163371.1.61730 WP_000163371.1.61743 WP_000163371.1.61857 WP_000163371.1.61918 WP_000163371.1.61952 WP_000163371.1.61968 WP_000163371.1.62007 WP_000163371.1.62025 WP_000163371.1.62120 WP_000163371.1.62122 WP_000163371.1.62204 WP_000163371.1.62304 WP_000163371.1.62310 WP_000163371.1.62364 WP_000163371.1.62374 WP_000163371.1.62403 WP_000163371.1.62486 WP_000163371.1.62522 WP_000163371.1.6253 WP_000163371.1.62570 WP_000163371.1.62619 WP_000163371.1.62828 WP_000163371.1.62853 WP_000163371.1.62903 WP_000163371.1.62910 WP_000163371.1.62955 WP_000163371.1.62976 WP_000163371.1.63063 WP_000163371.1.63181 WP_000163371.1.63203 WP_000163371.1.63256 WP_000163371.1.63290 WP_000163371.1.63382 WP_000163371.1.63432 WP_000163371.1.63455 WP_000163371.1.63461 WP_000163371.1.63479 WP_000163371.1.63513 WP_000163371.1.6357 WP_000163371.1.63577 WP_000163371.1.63633 WP_000163371.1.63664 WP_000163371.1.63718 WP_000163371.1.6375 WP_000163371.1.63757 WP_000163371.1.63766 WP_000163371.1.63834 WP_000163371.1.63977 WP_000163371.1.64046 WP_000163371.1.64208 WP_000163371.1.64217 WP_000163371.1.6423 WP_000163371.1.64244 WP_000163371.1.64403 WP_000163371.1.64645 WP_000163371.1.64649 WP_000163371.1.64702 WP_000163371.1.64757 WP_000163371.1.64781 WP_000163371.1.64831 WP_000163371.1.6489 WP_000163371.1.65018 WP_000163371.1.65022 WP_000163371.1.65028 WP_000163371.1.65168 WP_000163371.1.65171 WP_000163371.1.65185 WP_000163371.1.65238 WP_000163371.1.65248 WP_000163371.1.6525 WP_000163371.1.65295 WP_000163371.1.65348 WP_000163371.1.6535 WP_000163371.1.65437 WP_000163371.1.65474 WP_000163371.1.65558 WP_000163371.1.65572 WP_000163371.1.6560 WP_000163371.1.65633 WP_000163371.1.6565 WP_000163371.1.65696 WP_000163371.1.6575 WP_000163371.1.65782 WP_000163371.1.65876 WP_000163371.1.6594 WP_000163371.1.66082 WP_000163371.1.66129 WP_000163371.1.6630 WP_000163371.1.66314 WP_000163371.1.66358 WP_000163371.1.66362 WP_000163371.1.66365 WP_000163371.1.66368 WP_000163371.1.6638 WP_000163371.1.6640 WP_000163371.1.66462 WP_000163371.1.6647 WP_000163371.1.66600 WP_000163371.1.66698 WP_000163371.1.6680 WP_000163371.1.66800 WP_000163371.1.66820 WP_000163371.1.66825 WP_000163371.1.66834 WP_000163371.1.66901 WP_000163371.1.66962 WP_000163371.1.67037 WP_000163371.1.67045 WP_000163371.1.67181 WP_000163371.1.67268 WP_000163371.1.67347 WP_000163371.1.67465 WP_000163371.1.67552 WP_000163371.1.67603 WP_000163371.1.67617 WP_000163371.1.67633 WP_000163371.1.67682 WP_000163371.1.67707 WP_000163371.1.67731 WP_000163371.1.67829 WP_000163371.1.67887 WP_000163371.1.67970 WP_000163371.1.68073 WP_000163371.1.68075 WP_000163371.1.68147 WP_000163371.1.68167 WP_000163371.1.68201 WP_000163371.1.68206 WP_000163371.1.6827 WP_000163371.1.68275 WP_000163371.1.6849 WP_000163371.1.685 WP_000163371.1.68547 WP_000163371.1.68589 WP_000163371.1.68629 WP_000163371.1.68655 WP_000163371.1.68656 WP_000163371.1.68778 WP_000163371.1.68787 WP_000163371.1.68816 WP_000163371.1.68894 WP_000163371.1.68928 WP_000163371.1.68975 WP_000163371.1.68999 WP_000163371.1.69006 WP_000163371.1.69011 WP_000163371.1.6913 WP_000163371.1.69139 WP_000163371.1.69146 WP_000163371.1.69255 WP_000163371.1.69320 WP_000163371.1.69397 WP_000163371.1.69564 WP_000163371.1.69644 WP_000163371.1.69696 WP_000163371.1.69704 WP_000163371.1.69710 WP_000163371.1.69754 WP_000163371.1.69760 WP_000163371.1.69790 WP_000163371.1.69807 WP_000163371.1.70047 WP_000163371.1.70087 WP_000163371.1.7010 WP_000163371.1.7021 WP_000163371.1.70241 WP_000163371.1.70269 WP_000163371.1.70289 WP_000163371.1.70447 WP_000163371.1.70485 WP_000163371.1.70491 WP_000163371.1.7055 WP_000163371.1.70643 WP_000163371.1.70644 WP_000163371.1.70683 WP_000163371.1.70797 WP_000163371.1.70883 WP_000163371.1.70922 WP_000163371.1.70948 WP_000163371.1.71116 WP_000163371.1.71146 WP_000163371.1.71165 WP_000163371.1.71188 WP_000163371.1.71202 WP_000163371.1.71243 WP_000163371.1.71268 WP_000163371.1.71306 WP_000163371.1.71337 WP_000163371.1.71378 WP_000163371.1.71401 WP_000163371.1.71452 WP_000163371.1.71481 WP_000163371.1.71667 WP_000163371.1.71691 WP_000163371.1.71702 WP_000163371.1.71750 WP_000163371.1.71845 WP_000163371.1.71881 WP_000163371.1.71908 WP_000163371.1.71923 WP_000163371.1.71929 WP_000163371.1.71952 WP_000163371.1.71973 WP_000163371.1.72105 WP_000163371.1.72188 WP_000163371.1.72203 WP_000163371.1.72281 WP_000163371.1.72283 WP_000163371.1.72372 WP_000163371.1.72376 WP_000163371.1.72412 WP_000163371.1.7243 WP_000163371.1.72594 WP_000163371.1.72871 WP_000163371.1.72872 WP_000163371.1.72944 WP_000163371.1.72975 WP_000163371.1.73062 WP_000163371.1.7315 WP_000163371.1.7316 WP_000163371.1.73200 WP_000163371.1.73328 WP_000163371.1.7334 WP_000163371.1.73362 WP_000163371.1.73377 WP_000163371.1.73379 WP_000163371.1.73481 WP_000163371.1.7356 WP_000163371.1.73561 WP_000163371.1.73581 WP_000163371.1.73617 WP_000163371.1.73667 WP_000163371.1.7374 WP_000163371.1.73753 WP_000163371.1.73758 WP_000163371.1.73794 WP_000163371.1.7387 WP_000163371.1.73924 WP_000163371.1.73926 WP_000163371.1.74028 WP_000163371.1.74029 WP_000163371.1.74181 WP_000163371.1.74191 WP_000163371.1.7433 WP_000163371.1.74379 WP_000163371.1.74410 WP_000163371.1.74422 WP_000163371.1.74428 WP_000163371.1.74466 WP_000163371.1.74529 WP_000163371.1.74545 WP_000163371.1.74632 WP_000163371.1.74745 WP_000163371.1.74946 WP_000163371.1.75129 WP_000163371.1.75177 WP_000163371.1.75187 WP_000163371.1.75288 WP_000163371.1.75334 WP_000163371.1.75362 WP_000163371.1.75385 WP_000163371.1.75392 WP_000163371.1.75760 WP_000163371.1.75764 WP_000163371.1.75828 WP_000163371.1.75837 WP_000163371.1.75874 WP_000163371.1.75945 WP_000163371.1.75957 WP_000163371.1.76 WP_000163371.1.76020 WP_000163371.1.76164 WP_000163371.1.76252 WP_000163371.1.76445 WP_000163371.1.7655 WP_000163371.1.7660 WP_000163371.1.76673 WP_000163371.1.76706 WP_000163371.1.76721 WP_000163371.1.76724 WP_000163371.1.76738 WP_000163371.1.76756 WP_000163371.1.76760 WP_000163371.1.76875 WP_000163371.1.76880 WP_000163371.1.76899 WP_000163371.1.77038 WP_000163371.1.77047 WP_000163371.1.77080 WP_000163371.1.7712 WP_000163371.1.77180 WP_000163371.1.77193 WP_000163371.1.77244 WP_000163371.1.77292 WP_000163371.1.77349 WP_000163371.1.77431 WP_000163371.1.77440 WP_000163371.1.77514 WP_000163371.1.77529 WP_000163371.1.77549 WP_000163371.1.77555 WP_000163371.1.77575 WP_000163371.1.77629 WP_000163371.1.77692 WP_000163371.1.7782 WP_000163371.1.77851 WP_000163371.1.77898 WP_000163371.1.77918 WP_000163371.1.77960 WP_000163371.1.78016 WP_000163371.1.78033 WP_000163371.1.78076 WP_000163371.1.78096 WP_000163371.1.78100 WP_000163371.1.78110 WP_000163371.1.78120 WP_000163371.1.78259 WP_000163371.1.78383 WP_000163371.1.78407 WP_000163371.1.78502 WP_000163371.1.7861 WP_000163371.1.78618 WP_000163371.1.78673 WP_000163371.1.78715 WP_000163371.1.78735 WP_000163371.1.78802 WP_000163371.1.78830 WP_000163371.1.78835 WP_000163371.1.78862 WP_000163371.1.78871 WP_000163371.1.78874 WP_000163371.1.7891 WP_000163371.1.78918 WP_000163371.1.78930 WP_000163371.1.79081 WP_000163371.1.79151 WP_000163371.1.79167 WP_000163371.1.79297 WP_000163371.1.79335 WP_000163371.1.79462 WP_000163371.1.79472 WP_000163371.1.79490 WP_000163371.1.79495 WP_000163371.1.79529 WP_000163371.1.7956 WP_000163371.1.79570 WP_000163371.1.7964 WP_000163371.1.79659 WP_000163371.1.79668 WP_000163371.1.79708 WP_000163371.1.7972 WP_000163371.1.79832 WP_000163371.1.79845 WP_000163371.1.79892 WP_000163371.1.79945 WP_000163371.1.80077 WP_000163371.1.80137 WP_000163371.1.80182 WP_000163371.1.80296 WP_000163371.1.80333 WP_000163371.1.80366 WP_000163371.1.80441 WP_000163371.1.80480 WP_000163371.1.80638 WP_000163371.1.80725 WP_000163371.1.80780 WP_000163371.1.80819 WP_000163371.1.80831 WP_000163371.1.80840 WP_000163371.1.80850 WP_000163371.1.80881 WP_000163371.1.80927 WP_000163371.1.80939 WP_000163371.1.8096 WP_000163371.1.81037 WP_000163371.1.81062 WP_000163371.1.81067 WP_000163371.1.81069 WP_000163371.1.81149 WP_000163371.1.81175 WP_000163371.1.8119 WP_000163371.1.81193 WP_000163371.1.81231 WP_000163371.1.81354 WP_000163371.1.81409 WP_000163371.1.81410 WP_000163371.1.81425 WP_000163371.1.81548 WP_000163371.1.8168 WP_000163371.1.81743 WP_000163371.1.81746 WP_000163371.1.81750 WP_000163371.1.81785 WP_000163371.1.81902 WP_000163371.1.8196 WP_000163371.1.81965 WP_000163371.1.81974 WP_000163371.1.82099 WP_000163371.1.82144 WP_000163371.1.82258 WP_000163371.1.82337 WP_000163371.1.8236 WP_000163371.1.82369 WP_000163371.1.82395 WP_000163371.1.82479 WP_000163371.1.82503 WP_000163371.1.82515 WP_000163371.1.82584 WP_000163371.1.82636 WP_000163371.1.82676 WP_000163371.1.82761 WP_000163371.1.8282 WP_000163371.1.82843 WP_000163371.1.82867 WP_000163371.1.82944 WP_000163371.1.82956 WP_000163371.1.83128 WP_000163371.1.83163 WP_000163371.1.83221 WP_000163371.1.83252 WP_000163371.1.83301 WP_000163371.1.83305 WP_000163371.1.83365 WP_000163371.1.83413 WP_000163371.1.83491 WP_000163371.1.83523 WP_000163371.1.8354 WP_000163371.1.83651 WP_000163371.1.83721 WP_000163371.1.83759 WP_000163371.1.83760 WP_000163371.1.83995 WP_000163371.1.84077 WP_000163371.1.84103 WP_000163371.1.84283 WP_000163371.1.84392 WP_000163371.1.8441 WP_000163371.1.84475 WP_000163371.1.84532 WP_000163371.1.84554 WP_000163371.1.84659 WP_000163371.1.84693 WP_000163371.1.84899 WP_000163371.1.8497 WP_000163371.1.85014 WP_000163371.1.85040 WP_000163371.1.85094 WP_000163371.1.85134 WP_000163371.1.85147 WP_000163371.1.85178 WP_000163371.1.85180 WP_000163371.1.85190 WP_000163371.1.85433 WP_000163371.1.8545 WP_000163371.1.85481 WP_000163371.1.85483 WP_000163371.1.85541 WP_000163371.1.8556 WP_000163371.1.85615 WP_000163371.1.85617 WP_000163371.1.85654 WP_000163371.1.85663 WP_000163371.1.85671 WP_000163371.1.85672 WP_000163371.1.85777 WP_000163371.1.85855 WP_000163371.1.85886 WP_000163371.1.85900 WP_000163371.1.85904 WP_000163371.1.85976 WP_000163371.1.86017 WP_000163371.1.86126 WP_000163371.1.86285 WP_000163371.1.86306 WP_000163371.1.86356 WP_000163371.1.86450 WP_000163371.1.86469 WP_000163371.1.86580 WP_000163371.1.86588 WP_000163371.1.86634 WP_000163371.1.86661 WP_000163371.1.86699 WP_000163371.1.8672 WP_000163371.1.86744 WP_000163371.1.8678 WP_000163371.1.86810 WP_000163371.1.8684 WP_000163371.1.86895 WP_000163371.1.86902 WP_000163371.1.86906 WP_000163371.1.87051 WP_000163371.1.87095 WP_000163371.1.87148 WP_000163371.1.87323 WP_000163371.1.8736 WP_000163371.1.87460 WP_000163371.1.87552 WP_000163371.1.87584 WP_000163371.1.8767 WP_000163371.1.87779 WP_000163371.1.87945 WP_000163371.1.88019 WP_000163371.1.88073 WP_000163371.1.8809 WP_000163371.1.88291 WP_000163371.1.88293 WP_000163371.1.8837 WP_000163371.1.88393 WP_000163371.1.88483 WP_000163371.1.88609 WP_000163371.1.88620 WP_000163371.1.88703 WP_000163371.1.88792 WP_000163371.1.88902 WP_000163371.1.8891 WP_000163371.1.88942 WP_000163371.1.88967 WP_000163371.1.88981 WP_000163371.1.89008 WP_000163371.1.89116 WP_000163371.1.89138 WP_000163371.1.89174 WP_000163371.1.89304 WP_000163371.1.89512 WP_000163371.1.89527 WP_000163371.1.89570 WP_000163371.1.89604 WP_000163371.1.89622 WP_000163371.1.89647 WP_000163371.1.89659 WP_000163371.1.89746 WP_000163371.1.89777 WP_000163371.1.89902 WP_000163371.1.8996 WP_000163371.1.90084 WP_000163371.1.90097 WP_000163371.1.90248 WP_000163371.1.90252 WP_000163371.1.90409 WP_000163371.1.90417 WP_000163371.1.90440 WP_000163371.1.90453 WP_000163371.1.90458 WP_000163371.1.90557 WP_000163371.1.90585 WP_000163371.1.90620 WP_000163371.1.9064 WP_000163371.1.90641 WP_000163371.1.90686 WP_000163371.1.90734 WP_000163371.1.90792 WP_000163371.1.90866 WP_000163371.1.90876 WP_000163371.1.9089 WP_000163371.1.91003 WP_000163371.1.91049 WP_000163371.1.91069 WP_000163371.1.91278 WP_000163371.1.9131 WP_000163371.1.91512 WP_000163371.1.91524 WP_000163371.1.91564 WP_000163371.1.91628 WP_000163371.1.91655 WP_000163371.1.91724 WP_000163371.1.91732 WP_000163371.1.91788 WP_000163371.1.91914 WP_000163371.1.92013 WP_000163371.1.92039 WP_000163371.1.92060 WP_000163371.1.92093 WP_000163371.1.92108 WP_000163371.1.92171 WP_000163371.1.92183 WP_000163371.1.92208 WP_000163371.1.92268 WP_000163371.1.92310 WP_000163371.1.92318 WP_000163371.1.92375 WP_000163371.1.92443 WP_000163371.1.92482 WP_000163371.1.9253 WP_000163371.1.92531 WP_000163371.1.92669 WP_000163371.1.92671 WP_000163371.1.92738 WP_000163371.1.92875 WP_000163371.1.92895 WP_000163371.1.92988 WP_000163371.1.93086 WP_000163371.1.93101 WP_000163371.1.93136 WP_000163371.1.93155 WP_000163371.1.93275 WP_000163371.1.93322 WP_000163371.1.93365 WP_000163371.1.93376 WP_000163371.1.93543 WP_000163371.1.93604 WP_000163371.1.93650 WP_000163371.1.93656 WP_000163371.1.93662 WP_000163371.1.937 WP_000163371.1.93705 WP_000163371.1.93741 WP_000163371.1.93761 WP_000163371.1.93804 WP_000163371.1.93837 WP_000163371.1.9389 WP_000163371.1.93956 WP_000163371.1.93994 WP_000163371.1.94070 WP_000163371.1.94072 WP_000163371.1.94162 WP_000163371.1.94168 WP_000163371.1.94198 WP_000163371.1.9432 WP_000163371.1.94354 WP_000163371.1.94380 WP_000163371.1.94383 WP_000163371.1.94458 WP_000163371.1.94565 WP_000163371.1.94584 WP_000163371.1.94588 WP_000163371.1.94674 WP_000163371.1.94796 WP_000163371.1.94849 WP_000163371.1.94959 WP_000163371.1.95051 WP_000163371.1.95085 WP_000163371.1.95094 WP_000163371.1.95121 WP_000163371.1.95249 WP_000163371.1.95282 WP_000163371.1.95289 WP_000163371.1.95465 WP_000163371.1.95546 WP_000163371.1.95630 WP_000163371.1.95803 WP_000163371.1.95805 WP_000163371.1.95840 WP_000163371.1.95901 WP_000163371.1.95911 WP_000163371.1.9609 WP_000163371.1.96139 WP_000163371.1.96317 WP_000163371.1.96343 WP_000163371.1.9644 WP_000163371.1.96469 WP_000163371.1.96497 WP_000163371.1.96500 WP_000163371.1.96555 WP_000163371.1.96563 WP_000163371.1.96590 WP_000163371.1.96640 WP_000163371.1.96732 WP_000163371.1.96771 WP_000163371.1.96917 WP_000163371.1.97015 WP_000163371.1.97145 WP_000163371.1.97190 WP_000163371.1.97318 WP_000163371.1.97369 WP_000163371.1.97594 WP_000163371.1.97597 WP_000163371.1.97613 WP_000163371.1.97620 WP_000163371.1.97628 WP_000163371.1.97693 WP_000163371.1.97727 WP_000163371.1.97732 WP_000163371.1.97736 WP_000163371.1.9775 WP_000163371.1.97768 WP_000163371.1.97846 WP_000163371.1.98006 WP_000163371.1.98019 WP_000163371.1.98022 WP_000163371.1.9805 WP_000163371.1.98110 WP_000163371.1.98146 WP_000163371.1.98219 WP_000163371.1.9841 WP_000163371.1.98438 WP_000163371.1.98495 WP_000163371.1.98531 WP_000163371.1.98577 WP_000163371.1.98627 WP_000163371.1.98676 WP_000163371.1.98677 WP_000163371.1.98760 WP_000163371.1.98843 WP_000163371.1.9898 WP_000163371.1.99072 WP_000163371.1.99083 WP_000163371.1.99098 WP_000163371.1.99107 WP_000163371.1.99184 WP_000163371.1.99198 WP_000163371.1.99219 WP_000163371.1.99255 WP_000163371.1.99267 WP_000163371.1.99276 WP_000163371.1.99327 WP_000163371.1.99646 WP_000163371.1.99657 WP_000163371.1.99660 WP_000163371.1.99712 WP_000163371.1.99725 WP_000163371.1.99813 WP_000163371.1.99858 WP_000163371.1.99889 WP_000163371.1.99958 gi|378450219|ref|YP_005237578.1| gi|378445077|ref|YP_005232709.1| gi|379700834|ref|YP_005242562.1| gi|549724289|ref|YP_008644479.1| gi|452120154|ref|YP_007470402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]