SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450228|ref|YP_005237587.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450228|ref|YP_005237587.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 3.14e-81
Family Aldo-keto reductases (NADP) 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450228|ref|YP_005237587.1|
Sequence length 289
Comment putative aldo/keto reductase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVR
EAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS
AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKH
YNVQPEAWAPLGGGRHKPYENVMLQGIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERI
EENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVRGCLGVKIHD
Download sequence
Identical sequences A0A0D6FZ80 A0A0F6B1V4 A0A0H3NDC3 A0A0U1F7W5 A0A0W4MTY5 A0A2D3AQ45 A0A2H9YKT4 A0A2J0RKR0 E8XK05 Q8ZP71
gi|378445087|ref|YP_005232719.1| gi|378699554|ref|YP_005181511.1| gi|550901035|ref|YP_008670127.1| gi|549724300|ref|YP_008644490.1| gi|378450228|ref|YP_005237587.1| gi|526220299|ref|YP_008265885.1| gi|378984239|ref|YP_005247394.1| gi|379700845|ref|YP_005242573.1| gi|383496372|ref|YP_005397061.1| gi|525838156|ref|YP_008255119.1| gi|378989014|ref|YP_005252178.1| ABAO01000028|CDS_11471-10602 AE006468|CDS_1769673-1768804 CP001363|CDS_1779651-1778782 FN424405|CDS_1762189-1761320 99287.STM1676 gi|16765019|ref|NP_460634.1| gi|482903490|ref|YP_007902050.1| NP_460634.1.58477 WP_000456774.1.100010 WP_000456774.1.100234 WP_000456774.1.100376 WP_000456774.1.100424 WP_000456774.1.100436 WP_000456774.1.100484 WP_000456774.1.100488 WP_000456774.1.100597 WP_000456774.1.10076 WP_000456774.1.100781 WP_000456774.1.100793 WP_000456774.1.100869 WP_000456774.1.100871 WP_000456774.1.100882 WP_000456774.1.101007 WP_000456774.1.101020 WP_000456774.1.101074 WP_000456774.1.101078 WP_000456774.1.101180 WP_000456774.1.101259 WP_000456774.1.101284 WP_000456774.1.101291 WP_000456774.1.101353 WP_000456774.1.101386 WP_000456774.1.101404 WP_000456774.1.101420 WP_000456774.1.101589 WP_000456774.1.101707 WP_000456774.1.101734 WP_000456774.1.101878 WP_000456774.1.101953 WP_000456774.1.10220 WP_000456774.1.10266 WP_000456774.1.10429 WP_000456774.1.10439 WP_000456774.1.10678 WP_000456774.1.10753 WP_000456774.1.10992 WP_000456774.1.11024 WP_000456774.1.11031 WP_000456774.1.11098 WP_000456774.1.11168 WP_000456774.1.11190 WP_000456774.1.11295 WP_000456774.1.11455 WP_000456774.1.11458 WP_000456774.1.11518 WP_000456774.1.11532 WP_000456774.1.11543 WP_000456774.1.11763 WP_000456774.1.11772 WP_000456774.1.11868 WP_000456774.1.11897 WP_000456774.1.12114 WP_000456774.1.12351 WP_000456774.1.12370 WP_000456774.1.12546 WP_000456774.1.1264 WP_000456774.1.12728 WP_000456774.1.12879 WP_000456774.1.12936 WP_000456774.1.12995 WP_000456774.1.13027 WP_000456774.1.13106 WP_000456774.1.13130 WP_000456774.1.13414 WP_000456774.1.13488 WP_000456774.1.13509 WP_000456774.1.13669 WP_000456774.1.13741 WP_000456774.1.1387 WP_000456774.1.13908 WP_000456774.1.13932 WP_000456774.1.13968 WP_000456774.1.14001 WP_000456774.1.14151 WP_000456774.1.14239 WP_000456774.1.14320 WP_000456774.1.14379 WP_000456774.1.1440 WP_000456774.1.14406 WP_000456774.1.14410 WP_000456774.1.14466 WP_000456774.1.14524 WP_000456774.1.14554 WP_000456774.1.14725 WP_000456774.1.14852 WP_000456774.1.1489 WP_000456774.1.14932 WP_000456774.1.15055 WP_000456774.1.15124 WP_000456774.1.15223 WP_000456774.1.15226 WP_000456774.1.15316 WP_000456774.1.15369 WP_000456774.1.1540 WP_000456774.1.15508 WP_000456774.1.15784 WP_000456774.1.15830 WP_000456774.1.16062 WP_000456774.1.16063 WP_000456774.1.16103 WP_000456774.1.16226 WP_000456774.1.16233 WP_000456774.1.16284 WP_000456774.1.16328 WP_000456774.1.1635 WP_000456774.1.16468 WP_000456774.1.16614 WP_000456774.1.16650 WP_000456774.1.16686 WP_000456774.1.16691 WP_000456774.1.16732 WP_000456774.1.16735 WP_000456774.1.16786 WP_000456774.1.16858 WP_000456774.1.16896 WP_000456774.1.16916 WP_000456774.1.16965 WP_000456774.1.1700 WP_000456774.1.17307 WP_000456774.1.174 WP_000456774.1.17480 WP_000456774.1.17546 WP_000456774.1.17702 WP_000456774.1.17705 WP_000456774.1.18019 WP_000456774.1.18111 WP_000456774.1.18163 WP_000456774.1.18265 WP_000456774.1.18267 WP_000456774.1.18468 WP_000456774.1.18607 WP_000456774.1.18705 WP_000456774.1.18715 WP_000456774.1.18776 WP_000456774.1.18822 WP_000456774.1.18881 WP_000456774.1.18940 WP_000456774.1.18949 WP_000456774.1.19053 WP_000456774.1.19320 WP_000456774.1.19458 WP_000456774.1.19460 WP_000456774.1.19461 WP_000456774.1.19614 WP_000456774.1.19702 WP_000456774.1.19706 WP_000456774.1.19724 WP_000456774.1.19749 WP_000456774.1.19784 WP_000456774.1.19802 WP_000456774.1.19809 WP_000456774.1.19867 WP_000456774.1.1998 WP_000456774.1.20 WP_000456774.1.2010 WP_000456774.1.20212 WP_000456774.1.20266 WP_000456774.1.20271 WP_000456774.1.20362 WP_000456774.1.20418 WP_000456774.1.20443 WP_000456774.1.20525 WP_000456774.1.2054 WP_000456774.1.20553 WP_000456774.1.20626 WP_000456774.1.20646 WP_000456774.1.20886 WP_000456774.1.20908 WP_000456774.1.21049 WP_000456774.1.21146 WP_000456774.1.21245 WP_000456774.1.21246 WP_000456774.1.21269 WP_000456774.1.21400 WP_000456774.1.21497 WP_000456774.1.21499 WP_000456774.1.21603 WP_000456774.1.21751 WP_000456774.1.21757 WP_000456774.1.22024 WP_000456774.1.2205 WP_000456774.1.22062 WP_000456774.1.22067 WP_000456774.1.2221 WP_000456774.1.2235 WP_000456774.1.22379 WP_000456774.1.22427 WP_000456774.1.2246 WP_000456774.1.22485 WP_000456774.1.22582 WP_000456774.1.22620 WP_000456774.1.22870 WP_000456774.1.22979 WP_000456774.1.23102 WP_000456774.1.23114 WP_000456774.1.2314 WP_000456774.1.23192 WP_000456774.1.23259 WP_000456774.1.23460 WP_000456774.1.23472 WP_000456774.1.23482 WP_000456774.1.23634 WP_000456774.1.2364 WP_000456774.1.23932 WP_000456774.1.24017 WP_000456774.1.24206 WP_000456774.1.24308 WP_000456774.1.24578 WP_000456774.1.24737 WP_000456774.1.24779 WP_000456774.1.25008 WP_000456774.1.25405 WP_000456774.1.25454 WP_000456774.1.25493 WP_000456774.1.25668 WP_000456774.1.25690 WP_000456774.1.2570 WP_000456774.1.25740 WP_000456774.1.25793 WP_000456774.1.25814 WP_000456774.1.25988 WP_000456774.1.26311 WP_000456774.1.26319 WP_000456774.1.26429 WP_000456774.1.26440 WP_000456774.1.26493 WP_000456774.1.26551 WP_000456774.1.26567 WP_000456774.1.27010 WP_000456774.1.27173 WP_000456774.1.27206 WP_000456774.1.27423 WP_000456774.1.27561 WP_000456774.1.2763 WP_000456774.1.27665 WP_000456774.1.27761 WP_000456774.1.2777 WP_000456774.1.27857 WP_000456774.1.27977 WP_000456774.1.28094 WP_000456774.1.28170 WP_000456774.1.28302 WP_000456774.1.2835 WP_000456774.1.28370 WP_000456774.1.28538 WP_000456774.1.28575 WP_000456774.1.28625 WP_000456774.1.28655 WP_000456774.1.28694 WP_000456774.1.2879 WP_000456774.1.2890 WP_000456774.1.28938 WP_000456774.1.28946 WP_000456774.1.29006 WP_000456774.1.29010 WP_000456774.1.2910 WP_000456774.1.29588 WP_000456774.1.29601 WP_000456774.1.29606 WP_000456774.1.29615 WP_000456774.1.29619 WP_000456774.1.29704 WP_000456774.1.29969 WP_000456774.1.30006 WP_000456774.1.30027 WP_000456774.1.30195 WP_000456774.1.30469 WP_000456774.1.30505 WP_000456774.1.30507 WP_000456774.1.30535 WP_000456774.1.30547 WP_000456774.1.30794 WP_000456774.1.30833 WP_000456774.1.30835 WP_000456774.1.30972 WP_000456774.1.31 WP_000456774.1.3113 WP_000456774.1.31185 WP_000456774.1.3119 WP_000456774.1.31190 WP_000456774.1.31195 WP_000456774.1.31196 WP_000456774.1.31281 WP_000456774.1.31362 WP_000456774.1.31504 WP_000456774.1.31515 WP_000456774.1.31578 WP_000456774.1.31658 WP_000456774.1.31940 WP_000456774.1.31967 WP_000456774.1.31972 WP_000456774.1.32192 WP_000456774.1.32206 WP_000456774.1.32438 WP_000456774.1.32515 WP_000456774.1.32660 WP_000456774.1.32702 WP_000456774.1.32714 WP_000456774.1.32786 WP_000456774.1.32804 WP_000456774.1.32907 WP_000456774.1.33030 WP_000456774.1.33127 WP_000456774.1.33143 WP_000456774.1.33248 WP_000456774.1.33261 WP_000456774.1.333 WP_000456774.1.33492 WP_000456774.1.33553 WP_000456774.1.33592 WP_000456774.1.33894 WP_000456774.1.34043 WP_000456774.1.34075 WP_000456774.1.34257 WP_000456774.1.34279 WP_000456774.1.34319 WP_000456774.1.3445 WP_000456774.1.34453 WP_000456774.1.34610 WP_000456774.1.34856 WP_000456774.1.34975 WP_000456774.1.35045 WP_000456774.1.35129 WP_000456774.1.35184 WP_000456774.1.35404 WP_000456774.1.35408 WP_000456774.1.35425 WP_000456774.1.35446 WP_000456774.1.35463 WP_000456774.1.35503 WP_000456774.1.35509 WP_000456774.1.35590 WP_000456774.1.35940 WP_000456774.1.36003 WP_000456774.1.3601 WP_000456774.1.36609 WP_000456774.1.36690 WP_000456774.1.3670 WP_000456774.1.36705 WP_000456774.1.36918 WP_000456774.1.36931 WP_000456774.1.37073 WP_000456774.1.37111 WP_000456774.1.37112 WP_000456774.1.37256 WP_000456774.1.37293 WP_000456774.1.37351 WP_000456774.1.37370 WP_000456774.1.37376 WP_000456774.1.3744 WP_000456774.1.37498 WP_000456774.1.37504 WP_000456774.1.37618 WP_000456774.1.37968 WP_000456774.1.37978 WP_000456774.1.38125 WP_000456774.1.38145 WP_000456774.1.383 WP_000456774.1.3848 WP_000456774.1.38613 WP_000456774.1.38673 WP_000456774.1.38693 WP_000456774.1.38773 WP_000456774.1.38882 WP_000456774.1.3891 WP_000456774.1.38913 WP_000456774.1.39003 WP_000456774.1.39136 WP_000456774.1.39197 WP_000456774.1.39229 WP_000456774.1.39405 WP_000456774.1.39420 WP_000456774.1.39449 WP_000456774.1.39512 WP_000456774.1.39629 WP_000456774.1.39763 WP_000456774.1.39862 WP_000456774.1.39921 WP_000456774.1.39923 WP_000456774.1.40017 WP_000456774.1.40072 WP_000456774.1.40073 WP_000456774.1.4011 WP_000456774.1.40208 WP_000456774.1.40240 WP_000456774.1.40257 WP_000456774.1.40292 WP_000456774.1.40305 WP_000456774.1.40311 WP_000456774.1.40380 WP_000456774.1.40395 WP_000456774.1.40465 WP_000456774.1.40710 WP_000456774.1.4075 WP_000456774.1.4087 WP_000456774.1.40877 WP_000456774.1.41017 WP_000456774.1.41086 WP_000456774.1.41091 WP_000456774.1.41226 WP_000456774.1.41279 WP_000456774.1.41516 WP_000456774.1.41554 WP_000456774.1.41572 WP_000456774.1.41591 WP_000456774.1.41662 WP_000456774.1.41708 WP_000456774.1.41761 WP_000456774.1.41882 WP_000456774.1.41979 WP_000456774.1.41985 WP_000456774.1.42104 WP_000456774.1.42320 WP_000456774.1.42342 WP_000456774.1.42422 WP_000456774.1.4276 WP_000456774.1.42864 WP_000456774.1.4288 WP_000456774.1.43018 WP_000456774.1.43041 WP_000456774.1.43244 WP_000456774.1.43312 WP_000456774.1.43334 WP_000456774.1.43437 WP_000456774.1.43522 WP_000456774.1.43613 WP_000456774.1.43668 WP_000456774.1.43886 WP_000456774.1.44005 WP_000456774.1.44043 WP_000456774.1.44099 WP_000456774.1.44121 WP_000456774.1.44291 WP_000456774.1.44310 WP_000456774.1.44386 WP_000456774.1.44479 WP_000456774.1.44640 WP_000456774.1.4467 WP_000456774.1.44747 WP_000456774.1.4485 WP_000456774.1.44877 WP_000456774.1.44927 WP_000456774.1.45067 WP_000456774.1.45074 WP_000456774.1.45079 WP_000456774.1.45098 WP_000456774.1.45177 WP_000456774.1.45184 WP_000456774.1.45259 WP_000456774.1.45349 WP_000456774.1.45365 WP_000456774.1.45550 WP_000456774.1.45585 WP_000456774.1.45660 WP_000456774.1.45690 WP_000456774.1.458 WP_000456774.1.46011 WP_000456774.1.46069 WP_000456774.1.46112 WP_000456774.1.46173 WP_000456774.1.46174 WP_000456774.1.46187 WP_000456774.1.46303 WP_000456774.1.46595 WP_000456774.1.46675 WP_000456774.1.47057 WP_000456774.1.47214 WP_000456774.1.47429 WP_000456774.1.47448 WP_000456774.1.4747 WP_000456774.1.47472 WP_000456774.1.47478 WP_000456774.1.47621 WP_000456774.1.47799 WP_000456774.1.48242 WP_000456774.1.48253 WP_000456774.1.483 WP_000456774.1.48367 WP_000456774.1.48377 WP_000456774.1.4853 WP_000456774.1.48788 WP_000456774.1.4885 WP_000456774.1.48876 WP_000456774.1.48894 WP_000456774.1.48919 WP_000456774.1.49084 WP_000456774.1.49155 WP_000456774.1.49204 WP_000456774.1.49239 WP_000456774.1.49256 WP_000456774.1.49290 WP_000456774.1.49340 WP_000456774.1.49366 WP_000456774.1.49490 WP_000456774.1.49515 WP_000456774.1.49572 WP_000456774.1.49626 WP_000456774.1.4979 WP_000456774.1.49803 WP_000456774.1.49805 WP_000456774.1.49929 WP_000456774.1.50080 WP_000456774.1.50161 WP_000456774.1.50211 WP_000456774.1.50376 WP_000456774.1.50389 WP_000456774.1.50676 WP_000456774.1.50804 WP_000456774.1.50808 WP_000456774.1.5088 WP_000456774.1.50908 WP_000456774.1.50941 WP_000456774.1.51014 WP_000456774.1.51022 WP_000456774.1.51179 WP_000456774.1.51182 WP_000456774.1.51186 WP_000456774.1.51487 WP_000456774.1.51488 WP_000456774.1.51634 WP_000456774.1.51649 WP_000456774.1.51686 WP_000456774.1.51756 WP_000456774.1.51911 WP_000456774.1.51932 WP_000456774.1.51989 WP_000456774.1.52121 WP_000456774.1.52346 WP_000456774.1.52353 WP_000456774.1.52361 WP_000456774.1.52653 WP_000456774.1.52656 WP_000456774.1.52743 WP_000456774.1.52857 WP_000456774.1.52898 WP_000456774.1.53190 WP_000456774.1.53406 WP_000456774.1.53466 WP_000456774.1.53529 WP_000456774.1.53543 WP_000456774.1.53757 WP_000456774.1.53812 WP_000456774.1.54033 WP_000456774.1.54196 WP_000456774.1.54209 WP_000456774.1.54271 WP_000456774.1.54274 WP_000456774.1.54319 WP_000456774.1.54364 WP_000456774.1.54400 WP_000456774.1.54644 WP_000456774.1.54662 WP_000456774.1.54722 WP_000456774.1.54749 WP_000456774.1.54764 WP_000456774.1.55008 WP_000456774.1.55152 WP_000456774.1.55156 WP_000456774.1.55285 WP_000456774.1.55475 WP_000456774.1.55647 WP_000456774.1.55743 WP_000456774.1.55768 WP_000456774.1.55782 WP_000456774.1.55796 WP_000456774.1.56002 WP_000456774.1.56012 WP_000456774.1.56105 WP_000456774.1.56238 WP_000456774.1.56286 WP_000456774.1.56304 WP_000456774.1.56414 WP_000456774.1.56438 WP_000456774.1.56560 WP_000456774.1.56601 WP_000456774.1.56614 WP_000456774.1.56671 WP_000456774.1.56682 WP_000456774.1.56875 WP_000456774.1.56877 WP_000456774.1.57168 WP_000456774.1.57187 WP_000456774.1.57377 WP_000456774.1.57418 WP_000456774.1.57433 WP_000456774.1.57515 WP_000456774.1.57529 WP_000456774.1.57576 WP_000456774.1.57601 WP_000456774.1.57607 WP_000456774.1.57763 WP_000456774.1.57862 WP_000456774.1.57890 WP_000456774.1.57891 WP_000456774.1.57978 WP_000456774.1.5801 WP_000456774.1.58041 WP_000456774.1.58418 WP_000456774.1.58548 WP_000456774.1.5858 WP_000456774.1.58662 WP_000456774.1.58669 WP_000456774.1.58745 WP_000456774.1.58803 WP_000456774.1.5886 WP_000456774.1.59094 WP_000456774.1.59224 WP_000456774.1.59321 WP_000456774.1.59375 WP_000456774.1.59458 WP_000456774.1.59490 WP_000456774.1.59508 WP_000456774.1.59684 WP_000456774.1.59694 WP_000456774.1.59771 WP_000456774.1.5979 WP_000456774.1.59953 WP_000456774.1.60008 WP_000456774.1.60021 WP_000456774.1.60069 WP_000456774.1.60140 WP_000456774.1.60155 WP_000456774.1.60285 WP_000456774.1.60379 WP_000456774.1.60464 WP_000456774.1.60874 WP_000456774.1.60941 WP_000456774.1.61078 WP_000456774.1.6114 WP_000456774.1.61232 WP_000456774.1.6129 WP_000456774.1.61296 WP_000456774.1.61345 WP_000456774.1.61417 WP_000456774.1.61574 WP_000456774.1.61712 WP_000456774.1.61714 WP_000456774.1.61730 WP_000456774.1.61857 WP_000456774.1.61918 WP_000456774.1.61952 WP_000456774.1.62007 WP_000456774.1.62025 WP_000456774.1.62204 WP_000456774.1.62304 WP_000456774.1.62364 WP_000456774.1.62374 WP_000456774.1.62403 WP_000456774.1.6253 WP_000456774.1.62853 WP_000456774.1.62903 WP_000456774.1.62910 WP_000456774.1.62955 WP_000456774.1.63181 WP_000456774.1.63203 WP_000456774.1.63256 WP_000456774.1.63290 WP_000456774.1.63382 WP_000456774.1.63432 WP_000456774.1.63461 WP_000456774.1.63479 WP_000456774.1.63577 WP_000456774.1.63664 WP_000456774.1.63718 WP_000456774.1.6375 WP_000456774.1.63757 WP_000456774.1.63834 WP_000456774.1.64046 WP_000456774.1.6423 WP_000456774.1.64244 WP_000456774.1.64403 WP_000456774.1.64649 WP_000456774.1.64702 WP_000456774.1.64757 WP_000456774.1.64781 WP_000456774.1.64831 WP_000456774.1.6489 WP_000456774.1.65018 WP_000456774.1.65028 WP_000456774.1.65052 WP_000456774.1.65171 WP_000456774.1.65185 WP_000456774.1.65248 WP_000456774.1.6535 WP_000456774.1.65474 WP_000456774.1.65633 WP_000456774.1.6565 WP_000456774.1.65696 WP_000456774.1.6575 WP_000456774.1.65782 WP_000456774.1.65876 WP_000456774.1.6630 WP_000456774.1.66314 WP_000456774.1.66358 WP_000456774.1.66362 WP_000456774.1.6638 WP_000456774.1.6640 WP_000456774.1.66698 WP_000456774.1.6680 WP_000456774.1.66834 WP_000456774.1.66901 WP_000456774.1.66962 WP_000456774.1.67037 WP_000456774.1.67045 WP_000456774.1.67181 WP_000456774.1.67268 WP_000456774.1.67347 WP_000456774.1.67465 WP_000456774.1.67552 WP_000456774.1.67682 WP_000456774.1.67829 WP_000456774.1.67887 WP_000456774.1.68073 WP_000456774.1.68201 WP_000456774.1.68206 WP_000456774.1.6827 WP_000456774.1.68275 WP_000456774.1.6849 WP_000456774.1.68547 WP_000456774.1.68589 WP_000456774.1.68655 WP_000456774.1.68656 WP_000456774.1.68778 WP_000456774.1.68787 WP_000456774.1.68894 WP_000456774.1.68928 WP_000456774.1.68975 WP_000456774.1.69006 WP_000456774.1.6913 WP_000456774.1.69146 WP_000456774.1.69255 WP_000456774.1.69397 WP_000456774.1.69564 WP_000456774.1.69644 WP_000456774.1.69704 WP_000456774.1.7021 WP_000456774.1.70241 WP_000456774.1.70269 WP_000456774.1.70289 WP_000456774.1.70447 WP_000456774.1.70485 WP_000456774.1.70643 WP_000456774.1.70683 WP_000456774.1.70883 WP_000456774.1.70922 WP_000456774.1.70948 WP_000456774.1.71116 WP_000456774.1.71146 WP_000456774.1.71165 WP_000456774.1.71188 WP_000456774.1.71202 WP_000456774.1.71243 WP_000456774.1.71306 WP_000456774.1.71337 WP_000456774.1.71378 WP_000456774.1.71401 WP_000456774.1.71702 WP_000456774.1.71750 WP_000456774.1.71845 WP_000456774.1.71881 WP_000456774.1.71908 WP_000456774.1.71952 WP_000456774.1.71973 WP_000456774.1.72105 WP_000456774.1.72203 WP_000456774.1.72376 WP_000456774.1.72594 WP_000456774.1.72871 WP_000456774.1.72975 WP_000456774.1.7315 WP_000456774.1.73200 WP_000456774.1.7334 WP_000456774.1.73377 WP_000456774.1.73481 WP_000456774.1.7356 WP_000456774.1.73581 WP_000456774.1.73617 WP_000456774.1.73753 WP_000456774.1.73758 WP_000456774.1.73794 WP_000456774.1.7387 WP_000456774.1.73924 WP_000456774.1.74029 WP_000456774.1.74181 WP_000456774.1.74191 WP_000456774.1.7433 WP_000456774.1.74379 WP_000456774.1.74410 WP_000456774.1.74466 WP_000456774.1.74529 WP_000456774.1.74545 WP_000456774.1.74745 WP_000456774.1.75187 WP_000456774.1.75288 WP_000456774.1.75334 WP_000456774.1.75362 WP_000456774.1.75385 WP_000456774.1.75392 WP_000456774.1.75760 WP_000456774.1.75764 WP_000456774.1.75837 WP_000456774.1.75874 WP_000456774.1.75945 WP_000456774.1.76020 WP_000456774.1.76252 WP_000456774.1.76445 WP_000456774.1.7660 WP_000456774.1.76673 WP_000456774.1.76706 WP_000456774.1.76721 WP_000456774.1.76756 WP_000456774.1.76760 WP_000456774.1.76875 WP_000456774.1.76880 WP_000456774.1.76899 WP_000456774.1.77038 WP_000456774.1.77047 WP_000456774.1.77080 WP_000456774.1.7712 WP_000456774.1.77180 WP_000456774.1.77244 WP_000456774.1.77292 WP_000456774.1.77349 WP_000456774.1.77514 WP_000456774.1.77529 WP_000456774.1.77549 WP_000456774.1.77692 WP_000456774.1.7782 WP_000456774.1.77851 WP_000456774.1.77898 WP_000456774.1.77918 WP_000456774.1.77960 WP_000456774.1.78033 WP_000456774.1.78076 WP_000456774.1.78096 WP_000456774.1.78100 WP_000456774.1.78110 WP_000456774.1.78120 WP_000456774.1.78383 WP_000456774.1.78407 WP_000456774.1.7861 WP_000456774.1.78618 WP_000456774.1.78673 WP_000456774.1.78735 WP_000456774.1.78802 WP_000456774.1.78830 WP_000456774.1.78835 WP_000456774.1.78871 WP_000456774.1.78874 WP_000456774.1.78918 WP_000456774.1.78930 WP_000456774.1.79151 WP_000456774.1.79167 WP_000456774.1.79335 WP_000456774.1.79462 WP_000456774.1.79472 WP_000456774.1.79490 WP_000456774.1.79495 WP_000456774.1.79529 WP_000456774.1.79570 WP_000456774.1.7964 WP_000456774.1.79659 WP_000456774.1.79668 WP_000456774.1.79708 WP_000456774.1.79845 WP_000456774.1.80077 WP_000456774.1.80137 WP_000456774.1.80182 WP_000456774.1.80296 WP_000456774.1.80366 WP_000456774.1.80780 WP_000456774.1.80831 WP_000456774.1.80850 WP_000456774.1.80881 WP_000456774.1.80939 WP_000456774.1.8096 WP_000456774.1.81037 WP_000456774.1.81069 WP_000456774.1.81149 WP_000456774.1.81175 WP_000456774.1.8119 WP_000456774.1.81193 WP_000456774.1.81354 WP_000456774.1.81425 WP_000456774.1.81750 WP_000456774.1.81785 WP_000456774.1.81902 WP_000456774.1.81974 WP_000456774.1.82337 WP_000456774.1.82479 WP_000456774.1.82503 WP_000456774.1.82515 WP_000456774.1.82676 WP_000456774.1.82761 WP_000456774.1.8282 WP_000456774.1.82944 WP_000456774.1.82956 WP_000456774.1.83092 WP_000456774.1.83128 WP_000456774.1.83163 WP_000456774.1.83305 WP_000456774.1.83382 WP_000456774.1.83413 WP_000456774.1.83491 WP_000456774.1.83523 WP_000456774.1.8354 WP_000456774.1.83721 WP_000456774.1.83760 WP_000456774.1.83995 WP_000456774.1.84103 WP_000456774.1.84283 WP_000456774.1.84392 WP_000456774.1.8441 WP_000456774.1.84532 WP_000456774.1.84554 WP_000456774.1.84659 WP_000456774.1.84899 WP_000456774.1.8497 WP_000456774.1.85040 WP_000456774.1.85134 WP_000456774.1.85178 WP_000456774.1.85180 WP_000456774.1.85190 WP_000456774.1.8533 WP_000456774.1.8545 WP_000456774.1.85481 WP_000456774.1.85483 WP_000456774.1.85541 WP_000456774.1.8556 WP_000456774.1.85615 WP_000456774.1.85617 WP_000456774.1.85663 WP_000456774.1.85671 WP_000456774.1.85672 WP_000456774.1.85777 WP_000456774.1.85886 WP_000456774.1.85900 WP_000456774.1.85904 WP_000456774.1.85976 WP_000456774.1.86306 WP_000456774.1.86356 WP_000456774.1.86450 WP_000456774.1.86469 WP_000456774.1.86580 WP_000456774.1.86588 WP_000456774.1.86661 WP_000456774.1.8672 WP_000456774.1.8678 WP_000456774.1.86810 WP_000456774.1.8684 WP_000456774.1.86895 WP_000456774.1.86906 WP_000456774.1.87095 WP_000456774.1.87148 WP_000456774.1.87323 WP_000456774.1.8736 WP_000456774.1.87460 WP_000456774.1.87552 WP_000456774.1.87779 WP_000456774.1.87945 WP_000456774.1.88019 WP_000456774.1.88073 WP_000456774.1.8809 WP_000456774.1.88291 WP_000456774.1.88293 WP_000456774.1.8837 WP_000456774.1.88393 WP_000456774.1.88703 WP_000456774.1.88792 WP_000456774.1.88902 WP_000456774.1.8891 WP_000456774.1.88981 WP_000456774.1.89008 WP_000456774.1.89116 WP_000456774.1.89138 WP_000456774.1.89304 WP_000456774.1.89512 WP_000456774.1.89527 WP_000456774.1.89570 WP_000456774.1.89604 WP_000456774.1.89622 WP_000456774.1.89659 WP_000456774.1.89902 WP_000456774.1.8996 WP_000456774.1.90097 WP_000456774.1.90252 WP_000456774.1.90417 WP_000456774.1.90453 WP_000456774.1.90458 WP_000456774.1.90557 WP_000456774.1.90585 WP_000456774.1.90641 WP_000456774.1.90734 WP_000456774.1.91003 WP_000456774.1.91069 WP_000456774.1.91278 WP_000456774.1.91512 WP_000456774.1.91564 WP_000456774.1.91628 WP_000456774.1.91655 WP_000456774.1.91724 WP_000456774.1.91732 WP_000456774.1.91788 WP_000456774.1.92013 WP_000456774.1.92093 WP_000456774.1.92108 WP_000456774.1.92183 WP_000456774.1.92208 WP_000456774.1.92268 WP_000456774.1.92310 WP_000456774.1.92443 WP_000456774.1.92482 WP_000456774.1.92531 WP_000456774.1.92669 WP_000456774.1.92671 WP_000456774.1.92738 WP_000456774.1.92926 WP_000456774.1.93086 WP_000456774.1.93101 WP_000456774.1.93136 WP_000456774.1.93155 WP_000456774.1.93322 WP_000456774.1.93365 WP_000456774.1.93650 WP_000456774.1.93656 WP_000456774.1.93662 WP_000456774.1.937 WP_000456774.1.93705 WP_000456774.1.93804 WP_000456774.1.9389 WP_000456774.1.93994 WP_000456774.1.94072 WP_000456774.1.94162 WP_000456774.1.94168 WP_000456774.1.94198 WP_000456774.1.9432 WP_000456774.1.94354 WP_000456774.1.94380 WP_000456774.1.94458 WP_000456774.1.94565 WP_000456774.1.94584 WP_000456774.1.94674 WP_000456774.1.94796 WP_000456774.1.94959 WP_000456774.1.95051 WP_000456774.1.95085 WP_000456774.1.95121 WP_000456774.1.95282 WP_000456774.1.95546 WP_000456774.1.95630 WP_000456774.1.95911 WP_000456774.1.96139 WP_000456774.1.96317 WP_000456774.1.96343 WP_000456774.1.9644 WP_000456774.1.96469 WP_000456774.1.96500 WP_000456774.1.96555 WP_000456774.1.96563 WP_000456774.1.96732 WP_000456774.1.96771 WP_000456774.1.97015 WP_000456774.1.97145 WP_000456774.1.97190 WP_000456774.1.97318 WP_000456774.1.97594 WP_000456774.1.97597 WP_000456774.1.97613 WP_000456774.1.97620 WP_000456774.1.97727 WP_000456774.1.97732 WP_000456774.1.97736 WP_000456774.1.9775 WP_000456774.1.97846 WP_000456774.1.98006 WP_000456774.1.98019 WP_000456774.1.98022 WP_000456774.1.98110 WP_000456774.1.98146 WP_000456774.1.98219 WP_000456774.1.9841 WP_000456774.1.98495 WP_000456774.1.98531 WP_000456774.1.98577 WP_000456774.1.98627 WP_000456774.1.98676 WP_000456774.1.98677 WP_000456774.1.98760 WP_000456774.1.98843 WP_000456774.1.9898 WP_000456774.1.99098 WP_000456774.1.99184 WP_000456774.1.99267 WP_000456774.1.99276 WP_000456774.1.99646 WP_000456774.1.99657 WP_000456774.1.99660 WP_000456774.1.99712 WP_000456774.1.99813 WP_000456774.1.99858 WP_000456774.1.99889 WP_000456774.1.99958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]