SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450396|ref|YP_005237755.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450396|ref|YP_005237755.1|
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.74e-67
Family DnaQ-like 3'-5' exonuclease 0.0000000182
Further Details:      
 
Domain Number 2 Region: 195-301
Classification Level Classification E-value
Superfamily HRDC-like 2.99e-29
Family RNase D C-terminal domains 0.00000689
Further Details:      
 
Domain Number 3 Region: 295-372
Classification Level Classification E-value
Superfamily HRDC-like 5.75e-23
Family RNase D C-terminal domains 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450396|ref|YP_005237755.1|
Sequence length 375
Comment ribonuclease D [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNYQMIETDDALASLCEAVRACPAIALDTEFVRTRTYYPQLGLIQLFDGANVALIDPLGI
SDWSPLKAVLRDTGITKFLHAGSEDLEVFLNAFGELPEPLIDTQILAAFCGRPLSWGFAS
MVEEYTGVALDKSESRTDWLARPLSERQCEYAAADVWYLLPIAKKLMIETEAAGWLPAAL
DECRLMQQRRQEIQAPEEAWRDITNAWQLRTRQLACLQLLADWRLRKARERDMAVNFVVR
EENLWAVARYMPGSLGELDSLGLSGSEIRFHGKTLISLVAKAQALPEEALPEPLLNLMDM
PGYRKAFKAIKALVAEVSASHHVSGELLASRRQINQLLNWHWKLKPQNGQPELISGWRAE
LMEEKLTLLLQEYPL
Download sequence
Identical sequences A0A0F6B2C1 A0A0H3NCF3 A0A249UXU4 A0A265B5X7 A0A2C6ZEC0 A0A2H9YL85 A0A2J0R9C7 A0A2K2LP20 Q8ZP09
APC23456 gi|378699693|ref|YP_005181650.1| gi|525838036|ref|YP_008254980.1| gi|549724438|ref|YP_008644628.1| 454169.SeHA_C2016 99287.STM1817 gi|550901172|ref|YP_008670264.1| gi|525817704|ref|YP_008247722.1| gi|16765158|ref|NP_460773.1| gi|378450396|ref|YP_005237755.1| NP_460773.1.58477 WP_001109130.1.100010 WP_001109130.1.100234 WP_001109130.1.100258 WP_001109130.1.100376 WP_001109130.1.100424 WP_001109130.1.100436 WP_001109130.1.100484 WP_001109130.1.100488 WP_001109130.1.100597 WP_001109130.1.100650 WP_001109130.1.100730 WP_001109130.1.10076 WP_001109130.1.100781 WP_001109130.1.100793 WP_001109130.1.100869 WP_001109130.1.100871 WP_001109130.1.100882 WP_001109130.1.101007 WP_001109130.1.101020 WP_001109130.1.101074 WP_001109130.1.101078 WP_001109130.1.101180 WP_001109130.1.101259 WP_001109130.1.101284 WP_001109130.1.101291 WP_001109130.1.1013 WP_001109130.1.101320 WP_001109130.1.101353 WP_001109130.1.101386 WP_001109130.1.101404 WP_001109130.1.101589 WP_001109130.1.101707 WP_001109130.1.101734 WP_001109130.1.101878 WP_001109130.1.101953 WP_001109130.1.10220 WP_001109130.1.10231 WP_001109130.1.10266 WP_001109130.1.10429 WP_001109130.1.10439 WP_001109130.1.10566 WP_001109130.1.10678 WP_001109130.1.10753 WP_001109130.1.10992 WP_001109130.1.11000 WP_001109130.1.11024 WP_001109130.1.11031 WP_001109130.1.11098 WP_001109130.1.11156 WP_001109130.1.11168 WP_001109130.1.11190 WP_001109130.1.11295 WP_001109130.1.11455 WP_001109130.1.11458 WP_001109130.1.11518 WP_001109130.1.11532 WP_001109130.1.11543 WP_001109130.1.11588 WP_001109130.1.11677 WP_001109130.1.11687 WP_001109130.1.11735 WP_001109130.1.11763 WP_001109130.1.11772 WP_001109130.1.11897 WP_001109130.1.12017 WP_001109130.1.12025 WP_001109130.1.12114 WP_001109130.1.12351 WP_001109130.1.12370 WP_001109130.1.12546 WP_001109130.1.1264 WP_001109130.1.12728 WP_001109130.1.12879 WP_001109130.1.12936 WP_001109130.1.12995 WP_001109130.1.13027 WP_001109130.1.13106 WP_001109130.1.13130 WP_001109130.1.13207 WP_001109130.1.13334 WP_001109130.1.13414 WP_001109130.1.13488 WP_001109130.1.13509 WP_001109130.1.13661 WP_001109130.1.13669 WP_001109130.1.13741 WP_001109130.1.1387 WP_001109130.1.13908 WP_001109130.1.13932 WP_001109130.1.13968 WP_001109130.1.14001 WP_001109130.1.14111 WP_001109130.1.14151 WP_001109130.1.14239 WP_001109130.1.14320 WP_001109130.1.14379 WP_001109130.1.14406 WP_001109130.1.14410 WP_001109130.1.14436 WP_001109130.1.14458 WP_001109130.1.14466 WP_001109130.1.14524 WP_001109130.1.14554 WP_001109130.1.14618 WP_001109130.1.14725 WP_001109130.1.14852 WP_001109130.1.1489 WP_001109130.1.14932 WP_001109130.1.15124 WP_001109130.1.15223 WP_001109130.1.15226 WP_001109130.1.15316 WP_001109130.1.15369 WP_001109130.1.1540 WP_001109130.1.15508 WP_001109130.1.15784 WP_001109130.1.15830 WP_001109130.1.15862 WP_001109130.1.15910 WP_001109130.1.15986 WP_001109130.1.16004 WP_001109130.1.16047 WP_001109130.1.16062 WP_001109130.1.16063 WP_001109130.1.16103 WP_001109130.1.16226 WP_001109130.1.16233 WP_001109130.1.16284 WP_001109130.1.16328 WP_001109130.1.1635 WP_001109130.1.16361 WP_001109130.1.16468 WP_001109130.1.16525 WP_001109130.1.16614 WP_001109130.1.16650 WP_001109130.1.16691 WP_001109130.1.167 WP_001109130.1.16732 WP_001109130.1.16735 WP_001109130.1.16786 WP_001109130.1.16858 WP_001109130.1.16873 WP_001109130.1.16896 WP_001109130.1.16903 WP_001109130.1.16916 WP_001109130.1.16944 WP_001109130.1.16965 WP_001109130.1.1700 WP_001109130.1.17093 WP_001109130.1.17307 WP_001109130.1.174 WP_001109130.1.17480 WP_001109130.1.17546 WP_001109130.1.17702 WP_001109130.1.17705 WP_001109130.1.17743 WP_001109130.1.17747 WP_001109130.1.17891 WP_001109130.1.1798 WP_001109130.1.18019 WP_001109130.1.18111 WP_001109130.1.18122 WP_001109130.1.18163 WP_001109130.1.1818 WP_001109130.1.18254 WP_001109130.1.18265 WP_001109130.1.18267 WP_001109130.1.18282 WP_001109130.1.18468 WP_001109130.1.18607 WP_001109130.1.18705 WP_001109130.1.18715 WP_001109130.1.18776 WP_001109130.1.18822 WP_001109130.1.18881 WP_001109130.1.18940 WP_001109130.1.18949 WP_001109130.1.19053 WP_001109130.1.19273 WP_001109130.1.19320 WP_001109130.1.19458 WP_001109130.1.19460 WP_001109130.1.19461 WP_001109130.1.19588 WP_001109130.1.19614 WP_001109130.1.19616 WP_001109130.1.19642 WP_001109130.1.19702 WP_001109130.1.19706 WP_001109130.1.19724 WP_001109130.1.19749 WP_001109130.1.19784 WP_001109130.1.19793 WP_001109130.1.19802 WP_001109130.1.19809 WP_001109130.1.19867 WP_001109130.1.19975 WP_001109130.1.1998 WP_001109130.1.20 WP_001109130.1.2010 WP_001109130.1.20212 WP_001109130.1.20266 WP_001109130.1.20271 WP_001109130.1.20330 WP_001109130.1.20362 WP_001109130.1.20418 WP_001109130.1.20443 WP_001109130.1.20446 WP_001109130.1.20525 WP_001109130.1.2054 WP_001109130.1.20553 WP_001109130.1.20626 WP_001109130.1.20646 WP_001109130.1.20886 WP_001109130.1.20908 WP_001109130.1.21049 WP_001109130.1.21136 WP_001109130.1.21245 WP_001109130.1.21246 WP_001109130.1.21269 WP_001109130.1.21351 WP_001109130.1.21400 WP_001109130.1.21497 WP_001109130.1.21499 WP_001109130.1.21548 WP_001109130.1.21603 WP_001109130.1.21751 WP_001109130.1.21757 WP_001109130.1.21991 WP_001109130.1.22024 WP_001109130.1.2205 WP_001109130.1.22062 WP_001109130.1.22067 WP_001109130.1.2221 WP_001109130.1.22235 WP_001109130.1.2235 WP_001109130.1.22379 WP_001109130.1.22427 WP_001109130.1.2246 WP_001109130.1.22485 WP_001109130.1.22537 WP_001109130.1.22620 WP_001109130.1.22692 WP_001109130.1.22758 WP_001109130.1.22864 WP_001109130.1.22870 WP_001109130.1.22979 WP_001109130.1.23102 WP_001109130.1.23114 WP_001109130.1.2314 WP_001109130.1.23192 WP_001109130.1.23259 WP_001109130.1.23379 WP_001109130.1.23460 WP_001109130.1.23472 WP_001109130.1.23482 WP_001109130.1.23509 WP_001109130.1.23634 WP_001109130.1.2364 WP_001109130.1.23932 WP_001109130.1.23959 WP_001109130.1.24017 WP_001109130.1.24082 WP_001109130.1.24206 WP_001109130.1.24308 WP_001109130.1.24578 WP_001109130.1.24737 WP_001109130.1.24779 WP_001109130.1.25008 WP_001109130.1.25015 WP_001109130.1.25119 WP_001109130.1.25206 WP_001109130.1.25405 WP_001109130.1.25454 WP_001109130.1.25493 WP_001109130.1.25668 WP_001109130.1.25690 WP_001109130.1.2570 WP_001109130.1.25740 WP_001109130.1.25814 WP_001109130.1.25988 WP_001109130.1.26282 WP_001109130.1.26311 WP_001109130.1.26319 WP_001109130.1.26429 WP_001109130.1.26440 WP_001109130.1.26493 WP_001109130.1.26551 WP_001109130.1.26567 WP_001109130.1.26741 WP_001109130.1.27010 WP_001109130.1.27084 WP_001109130.1.27173 WP_001109130.1.27206 WP_001109130.1.27223 WP_001109130.1.27423 WP_001109130.1.27544 WP_001109130.1.27561 WP_001109130.1.2763 WP_001109130.1.27665 WP_001109130.1.27707 WP_001109130.1.27761 WP_001109130.1.27857 WP_001109130.1.27977 WP_001109130.1.28032 WP_001109130.1.28094 WP_001109130.1.28126 WP_001109130.1.28170 WP_001109130.1.28302 WP_001109130.1.2835 WP_001109130.1.28538 WP_001109130.1.28575 WP_001109130.1.28625 WP_001109130.1.28655 WP_001109130.1.28694 WP_001109130.1.2879 WP_001109130.1.2890 WP_001109130.1.28938 WP_001109130.1.28946 WP_001109130.1.29006 WP_001109130.1.29010 WP_001109130.1.2910 WP_001109130.1.29509 WP_001109130.1.29588 WP_001109130.1.29601 WP_001109130.1.29606 WP_001109130.1.29615 WP_001109130.1.29619 WP_001109130.1.29704 WP_001109130.1.29827 WP_001109130.1.29969 WP_001109130.1.29990 WP_001109130.1.30006 WP_001109130.1.30022 WP_001109130.1.30027 WP_001109130.1.30202 WP_001109130.1.30469 WP_001109130.1.30505 WP_001109130.1.30507 WP_001109130.1.30535 WP_001109130.1.30547 WP_001109130.1.30794 WP_001109130.1.30833 WP_001109130.1.30835 WP_001109130.1.30972 WP_001109130.1.31 WP_001109130.1.31092 WP_001109130.1.31122 WP_001109130.1.3113 WP_001109130.1.31185 WP_001109130.1.3119 WP_001109130.1.31190 WP_001109130.1.31195 WP_001109130.1.31196 WP_001109130.1.31219 WP_001109130.1.31281 WP_001109130.1.31362 WP_001109130.1.31451 WP_001109130.1.31504 WP_001109130.1.31515 WP_001109130.1.31578 WP_001109130.1.31658 WP_001109130.1.31940 WP_001109130.1.31967 WP_001109130.1.31972 WP_001109130.1.32192 WP_001109130.1.32206 WP_001109130.1.32260 WP_001109130.1.32438 WP_001109130.1.32515 WP_001109130.1.32527 WP_001109130.1.32660 WP_001109130.1.32702 WP_001109130.1.32714 WP_001109130.1.32786 WP_001109130.1.32804 WP_001109130.1.32860 WP_001109130.1.32907 WP_001109130.1.33030 WP_001109130.1.33127 WP_001109130.1.33143 WP_001109130.1.33248 WP_001109130.1.33261 WP_001109130.1.333 WP_001109130.1.33492 WP_001109130.1.33553 WP_001109130.1.33580 WP_001109130.1.33592 WP_001109130.1.33894 WP_001109130.1.3394 WP_001109130.1.34043 WP_001109130.1.34075 WP_001109130.1.34257 WP_001109130.1.34279 WP_001109130.1.34319 WP_001109130.1.34417 WP_001109130.1.34453 WP_001109130.1.34610 WP_001109130.1.3476 WP_001109130.1.34856 WP_001109130.1.34977 WP_001109130.1.35045 WP_001109130.1.35129 WP_001109130.1.35184 WP_001109130.1.35193 WP_001109130.1.35404 WP_001109130.1.35408 WP_001109130.1.35425 WP_001109130.1.35429 WP_001109130.1.35446 WP_001109130.1.35463 WP_001109130.1.35503 WP_001109130.1.35509 WP_001109130.1.35590 WP_001109130.1.35892 WP_001109130.1.35940 WP_001109130.1.36003 WP_001109130.1.3601 WP_001109130.1.36017 WP_001109130.1.36547 WP_001109130.1.36609 WP_001109130.1.36690 WP_001109130.1.3670 WP_001109130.1.36918 WP_001109130.1.36931 WP_001109130.1.37063 WP_001109130.1.37073 WP_001109130.1.37111 WP_001109130.1.37112 WP_001109130.1.37256 WP_001109130.1.37293 WP_001109130.1.37370 WP_001109130.1.37376 WP_001109130.1.3744 WP_001109130.1.37498 WP_001109130.1.37504 WP_001109130.1.37618 WP_001109130.1.37687 WP_001109130.1.37968 WP_001109130.1.37978 WP_001109130.1.38125 WP_001109130.1.38145 WP_001109130.1.383 WP_001109130.1.38393 WP_001109130.1.3848 WP_001109130.1.38569 WP_001109130.1.38613 WP_001109130.1.38673 WP_001109130.1.3869 WP_001109130.1.38693 WP_001109130.1.38773 WP_001109130.1.38781 WP_001109130.1.38882 WP_001109130.1.38913 WP_001109130.1.39003 WP_001109130.1.39136 WP_001109130.1.39197 WP_001109130.1.39229 WP_001109130.1.39265 WP_001109130.1.39405 WP_001109130.1.39420 WP_001109130.1.39449 WP_001109130.1.39512 WP_001109130.1.39556 WP_001109130.1.39584 WP_001109130.1.39629 WP_001109130.1.39724 WP_001109130.1.39763 WP_001109130.1.39862 WP_001109130.1.39921 WP_001109130.1.39923 WP_001109130.1.40017 WP_001109130.1.40072 WP_001109130.1.40073 WP_001109130.1.4011 WP_001109130.1.40208 WP_001109130.1.40240 WP_001109130.1.40257 WP_001109130.1.40292 WP_001109130.1.40305 WP_001109130.1.40311 WP_001109130.1.40341 WP_001109130.1.40380 WP_001109130.1.40395 WP_001109130.1.40465 WP_001109130.1.40508 WP_001109130.1.40710 WP_001109130.1.4075 WP_001109130.1.4087 WP_001109130.1.40877 WP_001109130.1.40996 WP_001109130.1.41017 WP_001109130.1.41018 WP_001109130.1.41086 WP_001109130.1.41091 WP_001109130.1.41226 WP_001109130.1.41279 WP_001109130.1.41516 WP_001109130.1.41554 WP_001109130.1.41572 WP_001109130.1.41591 WP_001109130.1.41662 WP_001109130.1.41708 WP_001109130.1.41761 WP_001109130.1.41859 WP_001109130.1.41882 WP_001109130.1.41979 WP_001109130.1.41985 WP_001109130.1.42104 WP_001109130.1.42156 WP_001109130.1.42243 WP_001109130.1.42320 WP_001109130.1.42342 WP_001109130.1.42422 WP_001109130.1.42444 WP_001109130.1.42676 WP_001109130.1.4276 WP_001109130.1.42864 WP_001109130.1.4288 WP_001109130.1.43018 WP_001109130.1.43041 WP_001109130.1.43077 WP_001109130.1.43086 WP_001109130.1.43244 WP_001109130.1.43312 WP_001109130.1.43334 WP_001109130.1.43339 WP_001109130.1.43351 WP_001109130.1.43371 WP_001109130.1.43437 WP_001109130.1.43522 WP_001109130.1.43613 WP_001109130.1.43668 WP_001109130.1.43778 WP_001109130.1.43886 WP_001109130.1.43951 WP_001109130.1.44005 WP_001109130.1.44043 WP_001109130.1.44099 WP_001109130.1.44121 WP_001109130.1.44291 WP_001109130.1.44300 WP_001109130.1.44310 WP_001109130.1.44386 WP_001109130.1.44433 WP_001109130.1.44479 WP_001109130.1.44640 WP_001109130.1.4467 WP_001109130.1.44747 WP_001109130.1.4485 WP_001109130.1.44877 WP_001109130.1.44927 WP_001109130.1.44933 WP_001109130.1.44971 WP_001109130.1.45067 WP_001109130.1.45074 WP_001109130.1.45079 WP_001109130.1.45145 WP_001109130.1.45177 WP_001109130.1.45184 WP_001109130.1.45259 WP_001109130.1.45344 WP_001109130.1.45349 WP_001109130.1.45365 WP_001109130.1.45550 WP_001109130.1.45582 WP_001109130.1.45585 WP_001109130.1.45622 WP_001109130.1.45660 WP_001109130.1.45690 WP_001109130.1.45797 WP_001109130.1.458 WP_001109130.1.45848 WP_001109130.1.46011 WP_001109130.1.46069 WP_001109130.1.46112 WP_001109130.1.46173 WP_001109130.1.46174 WP_001109130.1.46187 WP_001109130.1.46278 WP_001109130.1.46303 WP_001109130.1.46434 WP_001109130.1.46595 WP_001109130.1.46675 WP_001109130.1.46930 WP_001109130.1.47057 WP_001109130.1.47214 WP_001109130.1.47429 WP_001109130.1.47448 WP_001109130.1.4747 WP_001109130.1.47472 WP_001109130.1.47478 WP_001109130.1.47579 WP_001109130.1.47621 WP_001109130.1.47799 WP_001109130.1.48242 WP_001109130.1.48253 WP_001109130.1.483 WP_001109130.1.48367 WP_001109130.1.48377 WP_001109130.1.4853 WP_001109130.1.48788 WP_001109130.1.4885 WP_001109130.1.48894 WP_001109130.1.48919 WP_001109130.1.49084 WP_001109130.1.49113 WP_001109130.1.49155 WP_001109130.1.49204 WP_001109130.1.49239 WP_001109130.1.49256 WP_001109130.1.49290 WP_001109130.1.49340 WP_001109130.1.49366 WP_001109130.1.49490 WP_001109130.1.49515 WP_001109130.1.49572 WP_001109130.1.49686 WP_001109130.1.4979 WP_001109130.1.49803 WP_001109130.1.49805 WP_001109130.1.49929 WP_001109130.1.50080 WP_001109130.1.50161 WP_001109130.1.50211 WP_001109130.1.50376 WP_001109130.1.50389 WP_001109130.1.50404 WP_001109130.1.50676 WP_001109130.1.50774 WP_001109130.1.50804 WP_001109130.1.50808 WP_001109130.1.5088 WP_001109130.1.50908 WP_001109130.1.50941 WP_001109130.1.50999 WP_001109130.1.51014 WP_001109130.1.51022 WP_001109130.1.51066 WP_001109130.1.51179 WP_001109130.1.51182 WP_001109130.1.51186 WP_001109130.1.51224 WP_001109130.1.51487 WP_001109130.1.51488 WP_001109130.1.51634 WP_001109130.1.51649 WP_001109130.1.51686 WP_001109130.1.51756 WP_001109130.1.51831 WP_001109130.1.51911 WP_001109130.1.51932 WP_001109130.1.51989 WP_001109130.1.52121 WP_001109130.1.52148 WP_001109130.1.52170 WP_001109130.1.52336 WP_001109130.1.52346 WP_001109130.1.52353 WP_001109130.1.52361 WP_001109130.1.52653 WP_001109130.1.52656 WP_001109130.1.52692 WP_001109130.1.52743 WP_001109130.1.52857 WP_001109130.1.52866 WP_001109130.1.52898 WP_001109130.1.52949 WP_001109130.1.52985 WP_001109130.1.53190 WP_001109130.1.53272 WP_001109130.1.53406 WP_001109130.1.53436 WP_001109130.1.53466 WP_001109130.1.53529 WP_001109130.1.53543 WP_001109130.1.53757 WP_001109130.1.53812 WP_001109130.1.53905 WP_001109130.1.54033 WP_001109130.1.54075 WP_001109130.1.54196 WP_001109130.1.542 WP_001109130.1.54209 WP_001109130.1.54271 WP_001109130.1.54273 WP_001109130.1.54274 WP_001109130.1.54319 WP_001109130.1.54364 WP_001109130.1.54400 WP_001109130.1.54526 WP_001109130.1.54644 WP_001109130.1.54662 WP_001109130.1.54722 WP_001109130.1.54749 WP_001109130.1.54764 WP_001109130.1.55008 WP_001109130.1.55152 WP_001109130.1.55156 WP_001109130.1.55285 WP_001109130.1.55325 WP_001109130.1.55430 WP_001109130.1.55475 WP_001109130.1.5560 WP_001109130.1.55647 WP_001109130.1.55743 WP_001109130.1.55768 WP_001109130.1.55782 WP_001109130.1.55796 WP_001109130.1.55973 WP_001109130.1.55993 WP_001109130.1.56002 WP_001109130.1.56012 WP_001109130.1.56105 WP_001109130.1.56238 WP_001109130.1.56244 WP_001109130.1.56286 WP_001109130.1.56304 WP_001109130.1.56414 WP_001109130.1.56438 WP_001109130.1.56559 WP_001109130.1.56597 WP_001109130.1.56601 WP_001109130.1.56614 WP_001109130.1.56660 WP_001109130.1.56671 WP_001109130.1.56682 WP_001109130.1.56875 WP_001109130.1.56877 WP_001109130.1.57168 WP_001109130.1.57187 WP_001109130.1.57232 WP_001109130.1.57356 WP_001109130.1.57377 WP_001109130.1.57418 WP_001109130.1.57433 WP_001109130.1.57515 WP_001109130.1.57529 WP_001109130.1.57576 WP_001109130.1.57601 WP_001109130.1.57607 WP_001109130.1.5774 WP_001109130.1.57763 WP_001109130.1.57890 WP_001109130.1.57891 WP_001109130.1.57978 WP_001109130.1.5801 WP_001109130.1.58041 WP_001109130.1.58358 WP_001109130.1.58407 WP_001109130.1.58418 WP_001109130.1.5854 WP_001109130.1.58548 WP_001109130.1.5858 WP_001109130.1.58662 WP_001109130.1.58669 WP_001109130.1.58745 WP_001109130.1.58803 WP_001109130.1.5886 WP_001109130.1.59094 WP_001109130.1.59224 WP_001109130.1.59321 WP_001109130.1.59375 WP_001109130.1.59420 WP_001109130.1.59490 WP_001109130.1.59508 WP_001109130.1.5953 WP_001109130.1.59684 WP_001109130.1.59694 WP_001109130.1.59771 WP_001109130.1.5979 WP_001109130.1.59953 WP_001109130.1.60008 WP_001109130.1.60021 WP_001109130.1.60140 WP_001109130.1.60155 WP_001109130.1.60285 WP_001109130.1.60379 WP_001109130.1.60464 WP_001109130.1.60545 WP_001109130.1.60561 WP_001109130.1.60772 WP_001109130.1.60874 WP_001109130.1.60941 WP_001109130.1.61078 WP_001109130.1.6114 WP_001109130.1.61232 WP_001109130.1.6129 WP_001109130.1.61296 WP_001109130.1.61345 WP_001109130.1.61417 WP_001109130.1.61574 WP_001109130.1.61609 WP_001109130.1.61712 WP_001109130.1.61714 WP_001109130.1.61730 WP_001109130.1.61857 WP_001109130.1.61918 WP_001109130.1.61952 WP_001109130.1.62007 WP_001109130.1.62020 WP_001109130.1.62025 WP_001109130.1.6209 WP_001109130.1.62204 WP_001109130.1.62257 WP_001109130.1.62304 WP_001109130.1.62364 WP_001109130.1.62374 WP_001109130.1.62403 WP_001109130.1.6253 WP_001109130.1.62570 WP_001109130.1.62853 WP_001109130.1.62903 WP_001109130.1.62910 WP_001109130.1.62955 WP_001109130.1.63063 WP_001109130.1.63181 WP_001109130.1.63203 WP_001109130.1.63256 WP_001109130.1.63290 WP_001109130.1.63382 WP_001109130.1.63422 WP_001109130.1.63461 WP_001109130.1.63479 WP_001109130.1.63577 WP_001109130.1.63664 WP_001109130.1.63718 WP_001109130.1.6375 WP_001109130.1.63757 WP_001109130.1.63797 WP_001109130.1.63834 WP_001109130.1.64018 WP_001109130.1.64046 WP_001109130.1.6423 WP_001109130.1.64244 WP_001109130.1.64387 WP_001109130.1.64403 WP_001109130.1.64649 WP_001109130.1.64702 WP_001109130.1.64757 WP_001109130.1.64781 WP_001109130.1.64831 WP_001109130.1.6489 WP_001109130.1.64894 WP_001109130.1.65018 WP_001109130.1.65028 WP_001109130.1.65171 WP_001109130.1.65248 WP_001109130.1.65269 WP_001109130.1.6535 WP_001109130.1.65474 WP_001109130.1.65572 WP_001109130.1.65633 WP_001109130.1.6565 WP_001109130.1.65696 WP_001109130.1.6575 WP_001109130.1.65782 WP_001109130.1.65940 WP_001109130.1.65956 WP_001109130.1.66049 WP_001109130.1.6630 WP_001109130.1.66314 WP_001109130.1.66330 WP_001109130.1.66358 WP_001109130.1.66362 WP_001109130.1.6638 WP_001109130.1.6640 WP_001109130.1.66600 WP_001109130.1.66678 WP_001109130.1.66698 WP_001109130.1.6680 WP_001109130.1.66834 WP_001109130.1.66901 WP_001109130.1.66962 WP_001109130.1.67037 WP_001109130.1.67045 WP_001109130.1.67100 WP_001109130.1.67181 WP_001109130.1.67235 WP_001109130.1.67268 WP_001109130.1.67347 WP_001109130.1.6739 WP_001109130.1.67465 WP_001109130.1.67552 WP_001109130.1.67682 WP_001109130.1.67829 WP_001109130.1.67887 WP_001109130.1.68073 WP_001109130.1.68201 WP_001109130.1.68206 WP_001109130.1.6827 WP_001109130.1.68275 WP_001109130.1.68401 WP_001109130.1.68477 WP_001109130.1.6849 WP_001109130.1.68547 WP_001109130.1.68589 WP_001109130.1.68655 WP_001109130.1.68656 WP_001109130.1.68778 WP_001109130.1.68787 WP_001109130.1.68894 WP_001109130.1.68928 WP_001109130.1.68975 WP_001109130.1.69001 WP_001109130.1.69006 WP_001109130.1.6904 WP_001109130.1.6913 WP_001109130.1.69146 WP_001109130.1.69151 WP_001109130.1.69255 WP_001109130.1.69359 WP_001109130.1.69397 WP_001109130.1.6954 WP_001109130.1.69564 WP_001109130.1.69644 WP_001109130.1.69704 WP_001109130.1.69758 WP_001109130.1.7021 WP_001109130.1.70241 WP_001109130.1.70269 WP_001109130.1.70289 WP_001109130.1.70447 WP_001109130.1.70485 WP_001109130.1.70643 WP_001109130.1.70683 WP_001109130.1.70883 WP_001109130.1.70922 WP_001109130.1.70948 WP_001109130.1.70959 WP_001109130.1.71023 WP_001109130.1.71116 WP_001109130.1.71146 WP_001109130.1.71165 WP_001109130.1.71188 WP_001109130.1.71202 WP_001109130.1.71243 WP_001109130.1.71306 WP_001109130.1.71337 WP_001109130.1.71363 WP_001109130.1.71378 WP_001109130.1.71401 WP_001109130.1.71636 WP_001109130.1.71691 WP_001109130.1.71702 WP_001109130.1.71750 WP_001109130.1.71798 WP_001109130.1.71845 WP_001109130.1.71881 WP_001109130.1.71908 WP_001109130.1.71952 WP_001109130.1.71973 WP_001109130.1.72105 WP_001109130.1.72203 WP_001109130.1.72372 WP_001109130.1.72376 WP_001109130.1.72403 WP_001109130.1.72594 WP_001109130.1.72728 WP_001109130.1.72871 WP_001109130.1.72975 WP_001109130.1.73062 WP_001109130.1.73125 WP_001109130.1.7315 WP_001109130.1.73200 WP_001109130.1.7334 WP_001109130.1.73377 WP_001109130.1.73461 WP_001109130.1.73481 WP_001109130.1.7356 WP_001109130.1.73561 WP_001109130.1.73581 WP_001109130.1.73617 WP_001109130.1.73667 WP_001109130.1.73753 WP_001109130.1.73758 WP_001109130.1.73794 WP_001109130.1.73847 WP_001109130.1.7387 WP_001109130.1.73924 WP_001109130.1.73926 WP_001109130.1.74029 WP_001109130.1.74181 WP_001109130.1.74191 WP_001109130.1.7433 WP_001109130.1.74379 WP_001109130.1.74410 WP_001109130.1.745 WP_001109130.1.74529 WP_001109130.1.74545 WP_001109130.1.74745 WP_001109130.1.7491 WP_001109130.1.75129 WP_001109130.1.75187 WP_001109130.1.75288 WP_001109130.1.75334 WP_001109130.1.75362 WP_001109130.1.75385 WP_001109130.1.75392 WP_001109130.1.75760 WP_001109130.1.75764 WP_001109130.1.75828 WP_001109130.1.75837 WP_001109130.1.75874 WP_001109130.1.75945 WP_001109130.1.76020 WP_001109130.1.76252 WP_001109130.1.76327 WP_001109130.1.76445 WP_001109130.1.7660 WP_001109130.1.76673 WP_001109130.1.76706 WP_001109130.1.76721 WP_001109130.1.76756 WP_001109130.1.76760 WP_001109130.1.76875 WP_001109130.1.76880 WP_001109130.1.76899 WP_001109130.1.77038 WP_001109130.1.77047 WP_001109130.1.77080 WP_001109130.1.7712 WP_001109130.1.77177 WP_001109130.1.77180 WP_001109130.1.77244 WP_001109130.1.77267 WP_001109130.1.77292 WP_001109130.1.77514 WP_001109130.1.77529 WP_001109130.1.77549 WP_001109130.1.77692 WP_001109130.1.77710 WP_001109130.1.7782 WP_001109130.1.77851 WP_001109130.1.77898 WP_001109130.1.77918 WP_001109130.1.77960 WP_001109130.1.78033 WP_001109130.1.78076 WP_001109130.1.78096 WP_001109130.1.78100 WP_001109130.1.78110 WP_001109130.1.78120 WP_001109130.1.78372 WP_001109130.1.78383 WP_001109130.1.78407 WP_001109130.1.7861 WP_001109130.1.78618 WP_001109130.1.78673 WP_001109130.1.78735 WP_001109130.1.78802 WP_001109130.1.78830 WP_001109130.1.78835 WP_001109130.1.78838 WP_001109130.1.78871 WP_001109130.1.78874 WP_001109130.1.78918 WP_001109130.1.78930 WP_001109130.1.79151 WP_001109130.1.79167 WP_001109130.1.79335 WP_001109130.1.79462 WP_001109130.1.79472 WP_001109130.1.79490 WP_001109130.1.79495 WP_001109130.1.79529 WP_001109130.1.79570 WP_001109130.1.7964 WP_001109130.1.79659 WP_001109130.1.79668 WP_001109130.1.79708 WP_001109130.1.79734 WP_001109130.1.7979 WP_001109130.1.79845 WP_001109130.1.80077 WP_001109130.1.80137 WP_001109130.1.80182 WP_001109130.1.80296 WP_001109130.1.80366 WP_001109130.1.80741 WP_001109130.1.80780 WP_001109130.1.80831 WP_001109130.1.80850 WP_001109130.1.80881 WP_001109130.1.80939 WP_001109130.1.8096 WP_001109130.1.81037 WP_001109130.1.81069 WP_001109130.1.81149 WP_001109130.1.81175 WP_001109130.1.8119 WP_001109130.1.81193 WP_001109130.1.81305 WP_001109130.1.81320 WP_001109130.1.81328 WP_001109130.1.81354 WP_001109130.1.81410 WP_001109130.1.81425 WP_001109130.1.81528 WP_001109130.1.81735 WP_001109130.1.81750 WP_001109130.1.81760 WP_001109130.1.81785 WP_001109130.1.81902 WP_001109130.1.81974 WP_001109130.1.82192 WP_001109130.1.82232 WP_001109130.1.82337 WP_001109130.1.82395 WP_001109130.1.82464 WP_001109130.1.82479 WP_001109130.1.82503 WP_001109130.1.82515 WP_001109130.1.82676 WP_001109130.1.82761 WP_001109130.1.8282 WP_001109130.1.82944 WP_001109130.1.82956 WP_001109130.1.83092 WP_001109130.1.83163 WP_001109130.1.83305 WP_001109130.1.83365 WP_001109130.1.83413 WP_001109130.1.83491 WP_001109130.1.83523 WP_001109130.1.8354 WP_001109130.1.83651 WP_001109130.1.83721 WP_001109130.1.83760 WP_001109130.1.83995 WP_001109130.1.84103 WP_001109130.1.84283 WP_001109130.1.84291 WP_001109130.1.84392 WP_001109130.1.84397 WP_001109130.1.8441 WP_001109130.1.84532 WP_001109130.1.84554 WP_001109130.1.84659 WP_001109130.1.84693 WP_001109130.1.84899 WP_001109130.1.8497 WP_001109130.1.85134 WP_001109130.1.85178 WP_001109130.1.85180 WP_001109130.1.85190 WP_001109130.1.8533 WP_001109130.1.8545 WP_001109130.1.85481 WP_001109130.1.85483 WP_001109130.1.85541 WP_001109130.1.8556 WP_001109130.1.85568 WP_001109130.1.85615 WP_001109130.1.85617 WP_001109130.1.85663 WP_001109130.1.85671 WP_001109130.1.85672 WP_001109130.1.85777 WP_001109130.1.85855 WP_001109130.1.85886 WP_001109130.1.85900 WP_001109130.1.85904 WP_001109130.1.85976 WP_001109130.1.86043 WP_001109130.1.86173 WP_001109130.1.86306 WP_001109130.1.86356 WP_001109130.1.86450 WP_001109130.1.86469 WP_001109130.1.86580 WP_001109130.1.86588 WP_001109130.1.86661 WP_001109130.1.8671 WP_001109130.1.8678 WP_001109130.1.86810 WP_001109130.1.8684 WP_001109130.1.86895 WP_001109130.1.86906 WP_001109130.1.87095 WP_001109130.1.87323 WP_001109130.1.8736 WP_001109130.1.87460 WP_001109130.1.87552 WP_001109130.1.87695 WP_001109130.1.87779 WP_001109130.1.87899 WP_001109130.1.8792 WP_001109130.1.87945 WP_001109130.1.88019 WP_001109130.1.88073 WP_001109130.1.8809 WP_001109130.1.88092 WP_001109130.1.88291 WP_001109130.1.88293 WP_001109130.1.8837 WP_001109130.1.88393 WP_001109130.1.88703 WP_001109130.1.88792 WP_001109130.1.88902 WP_001109130.1.8891 WP_001109130.1.88957 WP_001109130.1.88980 WP_001109130.1.88981 WP_001109130.1.89008 WP_001109130.1.89114 WP_001109130.1.89116 WP_001109130.1.89119 WP_001109130.1.89138 WP_001109130.1.89304 WP_001109130.1.89512 WP_001109130.1.89527 WP_001109130.1.89570 WP_001109130.1.89604 WP_001109130.1.89622 WP_001109130.1.89657 WP_001109130.1.89659 WP_001109130.1.89765 WP_001109130.1.89817 WP_001109130.1.89902 WP_001109130.1.8996 WP_001109130.1.90097 WP_001109130.1.90252 WP_001109130.1.90348 WP_001109130.1.90417 WP_001109130.1.90453 WP_001109130.1.90458 WP_001109130.1.90557 WP_001109130.1.90585 WP_001109130.1.90641 WP_001109130.1.90734 WP_001109130.1.91003 WP_001109130.1.91056 WP_001109130.1.91069 WP_001109130.1.91179 WP_001109130.1.91278 WP_001109130.1.9131 WP_001109130.1.91512 WP_001109130.1.91524 WP_001109130.1.91564 WP_001109130.1.91621 WP_001109130.1.91628 WP_001109130.1.91655 WP_001109130.1.91724 WP_001109130.1.91732 WP_001109130.1.91788 WP_001109130.1.92013 WP_001109130.1.92060 WP_001109130.1.92093 WP_001109130.1.92108 WP_001109130.1.92165 WP_001109130.1.92171 WP_001109130.1.92183 WP_001109130.1.92208 WP_001109130.1.92268 WP_001109130.1.92310 WP_001109130.1.92318 WP_001109130.1.92443 WP_001109130.1.92482 WP_001109130.1.92531 WP_001109130.1.92669 WP_001109130.1.92671 WP_001109130.1.92738 WP_001109130.1.92893 WP_001109130.1.93059 WP_001109130.1.93086 WP_001109130.1.93101 WP_001109130.1.93136 WP_001109130.1.93155 WP_001109130.1.93275 WP_001109130.1.93339 WP_001109130.1.93365 WP_001109130.1.93376 WP_001109130.1.93543 WP_001109130.1.93650 WP_001109130.1.93656 WP_001109130.1.93662 WP_001109130.1.937 WP_001109130.1.93705 WP_001109130.1.93804 WP_001109130.1.9389 WP_001109130.1.93937 WP_001109130.1.93994 WP_001109130.1.94072 WP_001109130.1.94162 WP_001109130.1.94168 WP_001109130.1.94198 WP_001109130.1.9432 WP_001109130.1.94354 WP_001109130.1.94380 WP_001109130.1.94458 WP_001109130.1.94565 WP_001109130.1.94584 WP_001109130.1.94655 WP_001109130.1.94674 WP_001109130.1.94796 WP_001109130.1.94959 WP_001109130.1.95051 WP_001109130.1.95085 WP_001109130.1.95121 WP_001109130.1.95277 WP_001109130.1.95282 WP_001109130.1.95388 WP_001109130.1.95546 WP_001109130.1.95630 WP_001109130.1.95670 WP_001109130.1.95691 WP_001109130.1.95911 WP_001109130.1.96004 WP_001109130.1.96139 WP_001109130.1.96162 WP_001109130.1.96317 WP_001109130.1.9644 WP_001109130.1.96469 WP_001109130.1.96497 WP_001109130.1.96500 WP_001109130.1.96555 WP_001109130.1.96563 WP_001109130.1.96732 WP_001109130.1.9674 WP_001109130.1.96771 WP_001109130.1.97015 WP_001109130.1.97047 WP_001109130.1.97143 WP_001109130.1.97145 WP_001109130.1.97190 WP_001109130.1.97297 WP_001109130.1.97318 WP_001109130.1.97477 WP_001109130.1.97487 WP_001109130.1.97594 WP_001109130.1.97597 WP_001109130.1.97613 WP_001109130.1.97620 WP_001109130.1.97631 WP_001109130.1.97727 WP_001109130.1.97732 WP_001109130.1.97736 WP_001109130.1.9775 WP_001109130.1.97846 WP_001109130.1.9799 WP_001109130.1.98006 WP_001109130.1.98019 WP_001109130.1.98022 WP_001109130.1.98110 WP_001109130.1.98146 WP_001109130.1.98170 WP_001109130.1.98219 WP_001109130.1.9826 WP_001109130.1.9841 WP_001109130.1.98495 WP_001109130.1.98531 WP_001109130.1.98577 WP_001109130.1.98676 WP_001109130.1.98677 WP_001109130.1.98760 WP_001109130.1.98843 WP_001109130.1.9898 WP_001109130.1.99098 WP_001109130.1.99184 WP_001109130.1.99267 WP_001109130.1.99276 WP_001109130.1.99626 WP_001109130.1.99646 WP_001109130.1.99657 WP_001109130.1.99660 WP_001109130.1.99712 WP_001109130.1.99813 WP_001109130.1.99858 WP_001109130.1.99889 WP_001109130.1.99958 gi|378989157|ref|YP_005252321.1| gi|378445223|ref|YP_005232855.1| gi|482903629|ref|YP_007902189.1| gi|194448143|ref|YP_002045863.1| ABAM02000001|CDS_2375066-2373939 ABEL01000002|CDS_501710-500583 AE006468|CDS_1915149-1914022 CP001120|CDS_1962954-1961827 CP001363|CDS_1925838-1924711 FN424405|CDS_1907664-1906537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]