SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450399|ref|YP_005237758.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450399|ref|YP_005237758.1|
Domain Number 1 Region: 15-555
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.53e-155
Family Acetyl-CoA synthetase-like 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450399|ref|YP_005237758.1|
Sequence length 561
Comment long-chain-fatty-acid--CoA ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MKKVWLNRYPADVPAEINPDRYQSLVELFEHAATRYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GAAAIIIVSNFAHTLEKVVEKTSVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALQHGYRMQYVKPEVVAEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVKA
TYGPLLHPGKELVVTALPLYHIFALTMNCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAMTGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQNVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPHDIDYHSGSIGLPVPSTEAKLVDDDDNEVAPGEAGELCVKGPQVMLGYWQ
RPDATDEIIKDGWLHTGDIAVMDEDGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHSGV
QEVAAVGVPSGSSGEAVKLFVVKKDPALTDDALITFCRRHLTGYKVPKQVEFREELPKSN
VGKILRRELRDEARGKVDNKA
Download sequence
Identical sequences A0A0F6B2C4 A0A0H3BTR6 A0A0H3NM44 A0A0J0X7P1 A0A0M0QWY7 A0A0N1QVB6 A0A0Q9ZF17 A0A0R9P9S7 A0A1C3A3B2 A0A1J7AJR5 A0A1S0ZG83 A0A1S1AIU5 A0A1X2RH15 A0A1X2YD86 A0A1Z3QDE9 A0A221YLI0 A0A221ZA17 A0A265B5G2 A0A271CMV7 A0A271CSU9 A0A2D3ACH4 A0A2D3U377 A0A2G1P8I9 A0A2H9YB38 A0A2I6MF15 A0A2I6MSH0 A0A2I6NXS3 A0A2K2ZY84 G5L8A5 G5MHF3 G5Q1V1 G5QI46 G5QYX5 P63521 P63522 V1W373 V7UAN9
gi|559997177|ref|YP_008253277.2| gi|29141534|ref|NP_804876.1| gi|386591648|ref|YP_006088048.1| gi|194735459|ref|YP_002114852.1| gi|378450399|ref|YP_005237758.1| gi|194444947|ref|YP_002041075.1| gi|525817705|ref|YP_008247723.1| gi|16765159|ref|NP_460774.1| gi|549724440|ref|YP_008644630.1| gi|378699695|ref|YP_005181652.1| 209261.t1059 220341.STY1948 272994.SPAB_01397 423368.SNSL254_A1958 439843.SeSA_A1961 439851.SeD_A1498 454169.SeHA_C2018 550537.SEN1219 99287.STM1818 gi|161613673|ref|YP_001587638.1| NP_456325.1.84458 NP_460774.1.58477 WP_000758418.1.100002 WP_000758418.1.100008 WP_000758418.1.100010 WP_000758418.1.100017 WP_000758418.1.100031 WP_000758418.1.100036 WP_000758418.1.100077 WP_000758418.1.100079 WP_000758418.1.100115 WP_000758418.1.100129 WP_000758418.1.100137 WP_000758418.1.100191 WP_000758418.1.100196 WP_000758418.1.100234 WP_000758418.1.100258 WP_000758418.1.100266 WP_000758418.1.100284 WP_000758418.1.100288 WP_000758418.1.100313 WP_000758418.1.100314 WP_000758418.1.100321 WP_000758418.1.100354 WP_000758418.1.100376 WP_000758418.1.100392 WP_000758418.1.100412 WP_000758418.1.100421 WP_000758418.1.100424 WP_000758418.1.100432 WP_000758418.1.100436 WP_000758418.1.100446 WP_000758418.1.100450 WP_000758418.1.100457 WP_000758418.1.100472 WP_000758418.1.100484 WP_000758418.1.100488 WP_000758418.1.100502 WP_000758418.1.100519 WP_000758418.1.100557 WP_000758418.1.100584 WP_000758418.1.100589 WP_000758418.1.100592 WP_000758418.1.100597 WP_000758418.1.100605 WP_000758418.1.100610 WP_000758418.1.100642 WP_000758418.1.10065 WP_000758418.1.100650 WP_000758418.1.100707 WP_000758418.1.100711 WP_000758418.1.100714 WP_000758418.1.100730 WP_000758418.1.100732 WP_000758418.1.100733 WP_000758418.1.100739 WP_000758418.1.10074 WP_000758418.1.100750 WP_000758418.1.10076 WP_000758418.1.100764 WP_000758418.1.100776 WP_000758418.1.100781 WP_000758418.1.100793 WP_000758418.1.100799 WP_000758418.1.10081 WP_000758418.1.100814 WP_000758418.1.100857 WP_000758418.1.100865 WP_000758418.1.100869 WP_000758418.1.100870 WP_000758418.1.100871 WP_000758418.1.100886 WP_000758418.1.100895 WP_000758418.1.100941 WP_000758418.1.100953 WP_000758418.1.101007 WP_000758418.1.101011 WP_000758418.1.101020 WP_000758418.1.101042 WP_000758418.1.101074 WP_000758418.1.101078 WP_000758418.1.10108 WP_000758418.1.101088 WP_000758418.1.101112 WP_000758418.1.101126 WP_000758418.1.101147 WP_000758418.1.101180 WP_000758418.1.101185 WP_000758418.1.101199 WP_000758418.1.101223 WP_000758418.1.101226 WP_000758418.1.10124 WP_000758418.1.101259 WP_000758418.1.101271 WP_000758418.1.101284 WP_000758418.1.101291 WP_000758418.1.1013 WP_000758418.1.101312 WP_000758418.1.101320 WP_000758418.1.101322 WP_000758418.1.101353 WP_000758418.1.101374 WP_000758418.1.101386 WP_000758418.1.101404 WP_000758418.1.101420 WP_000758418.1.101425 WP_000758418.1.101454 WP_000758418.1.101519 WP_000758418.1.101520 WP_000758418.1.101541 WP_000758418.1.101543 WP_000758418.1.101589 WP_000758418.1.101609 WP_000758418.1.101612 WP_000758418.1.101616 WP_000758418.1.101634 WP_000758418.1.101636 WP_000758418.1.101666 WP_000758418.1.101674 WP_000758418.1.101707 WP_000758418.1.101734 WP_000758418.1.101740 WP_000758418.1.101741 WP_000758418.1.101744 WP_000758418.1.101759 WP_000758418.1.101776 WP_000758418.1.101832 WP_000758418.1.101839 WP_000758418.1.101841 WP_000758418.1.101868 WP_000758418.1.101878 WP_000758418.1.101890 WP_000758418.1.10191 WP_000758418.1.101917 WP_000758418.1.101927 WP_000758418.1.101941 WP_000758418.1.101949 WP_000758418.1.101953 WP_000758418.1.101975 WP_000758418.1.102050 WP_000758418.1.102087 WP_000758418.1.102103 WP_000758418.1.102111 WP_000758418.1.10220 WP_000758418.1.10231 WP_000758418.1.10266 WP_000758418.1.10276 WP_000758418.1.10293 WP_000758418.1.10300 WP_000758418.1.10310 WP_000758418.1.10338 WP_000758418.1.1038 WP_000758418.1.10394 WP_000758418.1.104 WP_000758418.1.10401 WP_000758418.1.10428 WP_000758418.1.10429 WP_000758418.1.10439 WP_000758418.1.10459 WP_000758418.1.10475 WP_000758418.1.10498 WP_000758418.1.10511 WP_000758418.1.10514 WP_000758418.1.10521 WP_000758418.1.10530 WP_000758418.1.10532 WP_000758418.1.10547 WP_000758418.1.10562 WP_000758418.1.10566 WP_000758418.1.10568 WP_000758418.1.10595 WP_000758418.1.106 WP_000758418.1.10631 WP_000758418.1.10642 WP_000758418.1.10654 WP_000758418.1.10675 WP_000758418.1.10677 WP_000758418.1.10711 WP_000758418.1.10720 WP_000758418.1.10753 WP_000758418.1.10755 WP_000758418.1.10857 WP_000758418.1.10868 WP_000758418.1.10873 WP_000758418.1.10898 WP_000758418.1.10926 WP_000758418.1.10936 WP_000758418.1.10992 WP_000758418.1.11000 WP_000758418.1.11012 WP_000758418.1.11024 WP_000758418.1.11031 WP_000758418.1.11041 WP_000758418.1.11055 WP_000758418.1.1110 WP_000758418.1.11119 WP_000758418.1.11126 WP_000758418.1.11142 WP_000758418.1.11156 WP_000758418.1.11168 WP_000758418.1.11190 WP_000758418.1.11216 WP_000758418.1.11239 WP_000758418.1.11253 WP_000758418.1.11254 WP_000758418.1.11295 WP_000758418.1.113 WP_000758418.1.11304 WP_000758418.1.11314 WP_000758418.1.1135 WP_000758418.1.11385 WP_000758418.1.11386 WP_000758418.1.1142 WP_000758418.1.11426 WP_000758418.1.11429 WP_000758418.1.11444 WP_000758418.1.11455 WP_000758418.1.11458 WP_000758418.1.11479 WP_000758418.1.1150 WP_000758418.1.11511 WP_000758418.1.11518 WP_000758418.1.11526 WP_000758418.1.11528 WP_000758418.1.11532 WP_000758418.1.11543 WP_000758418.1.11557 WP_000758418.1.1156 WP_000758418.1.11565 WP_000758418.1.11567 WP_000758418.1.11588 WP_000758418.1.11603 WP_000758418.1.11638 WP_000758418.1.11677 WP_000758418.1.11681 WP_000758418.1.11687 WP_000758418.1.1169 WP_000758418.1.11735 WP_000758418.1.1174 WP_000758418.1.11763 WP_000758418.1.11772 WP_000758418.1.11824 WP_000758418.1.11834 WP_000758418.1.11841 WP_000758418.1.11868 WP_000758418.1.11875 WP_000758418.1.11883 WP_000758418.1.11897 WP_000758418.1.11900 WP_000758418.1.11908 WP_000758418.1.11914 WP_000758418.1.11938 WP_000758418.1.11964 WP_000758418.1.11978 WP_000758418.1.12017 WP_000758418.1.12025 WP_000758418.1.12027 WP_000758418.1.12040 WP_000758418.1.12061 WP_000758418.1.1207 WP_000758418.1.12106 WP_000758418.1.12114 WP_000758418.1.12141 WP_000758418.1.12144 WP_000758418.1.1215 WP_000758418.1.12159 WP_000758418.1.12168 WP_000758418.1.12172 WP_000758418.1.12192 WP_000758418.1.1224 WP_000758418.1.12244 WP_000758418.1.12280 WP_000758418.1.12282 WP_000758418.1.1232 WP_000758418.1.12340 WP_000758418.1.12351 WP_000758418.1.12364 WP_000758418.1.12370 WP_000758418.1.12374 WP_000758418.1.1239 WP_000758418.1.12397 WP_000758418.1.12398 WP_000758418.1.12441 WP_000758418.1.1246 WP_000758418.1.12472 WP_000758418.1.12485 WP_000758418.1.1250 WP_000758418.1.12546 WP_000758418.1.12568 WP_000758418.1.12569 WP_000758418.1.12581 WP_000758418.1.12584 WP_000758418.1.12585 WP_000758418.1.12620 WP_000758418.1.12648 WP_000758418.1.12683 WP_000758418.1.12696 WP_000758418.1.12701 WP_000758418.1.12718 WP_000758418.1.12726 WP_000758418.1.12727 WP_000758418.1.12728 WP_000758418.1.12741 WP_000758418.1.12834 WP_000758418.1.12864 WP_000758418.1.12879 WP_000758418.1.12995 WP_000758418.1.1300 WP_000758418.1.13027 WP_000758418.1.13076 WP_000758418.1.13102 WP_000758418.1.13106 WP_000758418.1.13108 WP_000758418.1.13130 WP_000758418.1.13161 WP_000758418.1.13207 WP_000758418.1.1321 WP_000758418.1.13247 WP_000758418.1.1326 WP_000758418.1.13268 WP_000758418.1.13274 WP_000758418.1.13291 WP_000758418.1.133 WP_000758418.1.13314 WP_000758418.1.13334 WP_000758418.1.13338 WP_000758418.1.13342 WP_000758418.1.13352 WP_000758418.1.13367 WP_000758418.1.13391 WP_000758418.1.13406 WP_000758418.1.13414 WP_000758418.1.13440 WP_000758418.1.13443 WP_000758418.1.13446 WP_000758418.1.1346 WP_000758418.1.13476 WP_000758418.1.13488 WP_000758418.1.13509 WP_000758418.1.13543 WP_000758418.1.13573 WP_000758418.1.13599 WP_000758418.1.13625 WP_000758418.1.13661 WP_000758418.1.13669 WP_000758418.1.13677 WP_000758418.1.13686 WP_000758418.1.13691 WP_000758418.1.1372 WP_000758418.1.13732 WP_000758418.1.13741 WP_000758418.1.13750 WP_000758418.1.13764 WP_000758418.1.13799 WP_000758418.1.1382 WP_000758418.1.13827 WP_000758418.1.13848 WP_000758418.1.13857 WP_000758418.1.1387 WP_000758418.1.13908 WP_000758418.1.13932 WP_000758418.1.13968 WP_000758418.1.1397 WP_000758418.1.13972 WP_000758418.1.13980 WP_000758418.1.140 WP_000758418.1.14001 WP_000758418.1.1401 WP_000758418.1.14041 WP_000758418.1.14050 WP_000758418.1.14056 WP_000758418.1.1408 WP_000758418.1.14089 WP_000758418.1.14099 WP_000758418.1.14111 WP_000758418.1.1412 WP_000758418.1.14120 WP_000758418.1.14123 WP_000758418.1.14150 WP_000758418.1.14151 WP_000758418.1.14191 WP_000758418.1.14197 WP_000758418.1.14212 WP_000758418.1.14239 WP_000758418.1.14280 WP_000758418.1.14286 WP_000758418.1.14296 WP_000758418.1.14320 WP_000758418.1.14333 WP_000758418.1.14369 WP_000758418.1.14379 WP_000758418.1.14399 WP_000758418.1.1440 WP_000758418.1.14406 WP_000758418.1.14410 WP_000758418.1.14436 WP_000758418.1.14444 WP_000758418.1.14458 WP_000758418.1.14466 WP_000758418.1.14467 WP_000758418.1.14474 WP_000758418.1.14495 WP_000758418.1.14500 WP_000758418.1.14516 WP_000758418.1.14519 WP_000758418.1.14524 WP_000758418.1.14526 WP_000758418.1.14550 WP_000758418.1.14554 WP_000758418.1.14575 WP_000758418.1.146 WP_000758418.1.14618 WP_000758418.1.14688 WP_000758418.1.14701 WP_000758418.1.14703 WP_000758418.1.14708 WP_000758418.1.14719 WP_000758418.1.14725 WP_000758418.1.1473 WP_000758418.1.14765 WP_000758418.1.14789 WP_000758418.1.14793 WP_000758418.1.14810 WP_000758418.1.14819 WP_000758418.1.14852 WP_000758418.1.14876 WP_000758418.1.14877 WP_000758418.1.14884 WP_000758418.1.1489 WP_000758418.1.14894 WP_000758418.1.14913 WP_000758418.1.14917 WP_000758418.1.14927 WP_000758418.1.14930 WP_000758418.1.14932 WP_000758418.1.14936 WP_000758418.1.14947 WP_000758418.1.14948 WP_000758418.1.14964 WP_000758418.1.15046 WP_000758418.1.15054 WP_000758418.1.15055 WP_000758418.1.15059 WP_000758418.1.15067 WP_000758418.1.15102 WP_000758418.1.15124 WP_000758418.1.15184 WP_000758418.1.15214 WP_000758418.1.15223 WP_000758418.1.15226 WP_000758418.1.15244 WP_000758418.1.15265 WP_000758418.1.15276 WP_000758418.1.15316 WP_000758418.1.15353 WP_000758418.1.15362 WP_000758418.1.15369 WP_000758418.1.1540 WP_000758418.1.15415 WP_000758418.1.15423 WP_000758418.1.15439 WP_000758418.1.15483 WP_000758418.1.15487 WP_000758418.1.15508 WP_000758418.1.1551 WP_000758418.1.15535 WP_000758418.1.15581 WP_000758418.1.15585 WP_000758418.1.15597 WP_000758418.1.15612 WP_000758418.1.15625 WP_000758418.1.15627 WP_000758418.1.15667 WP_000758418.1.1568 WP_000758418.1.15708 WP_000758418.1.15710 WP_000758418.1.15717 WP_000758418.1.15775 WP_000758418.1.15777 WP_000758418.1.15784 WP_000758418.1.15795 WP_000758418.1.15830 WP_000758418.1.15835 WP_000758418.1.15862 WP_000758418.1.15905 WP_000758418.1.15910 WP_000758418.1.15912 WP_000758418.1.15922 WP_000758418.1.15944 WP_000758418.1.15970 WP_000758418.1.15986 WP_000758418.1.15995 WP_000758418.1.16000 WP_000758418.1.16004 WP_000758418.1.16006 WP_000758418.1.16028 WP_000758418.1.16032 WP_000758418.1.16046 WP_000758418.1.16047 WP_000758418.1.16051 WP_000758418.1.16058 WP_000758418.1.16062 WP_000758418.1.16063 WP_000758418.1.16103 WP_000758418.1.1611 WP_000758418.1.16150 WP_000758418.1.16155 WP_000758418.1.16172 WP_000758418.1.16201 WP_000758418.1.16233 WP_000758418.1.1626 WP_000758418.1.16264 WP_000758418.1.16273 WP_000758418.1.16284 WP_000758418.1.16328 WP_000758418.1.16331 WP_000758418.1.16344 WP_000758418.1.1635 WP_000758418.1.16361 WP_000758418.1.16363 WP_000758418.1.16365 WP_000758418.1.16366 WP_000758418.1.16394 WP_000758418.1.16452 WP_000758418.1.16453 WP_000758418.1.16461 WP_000758418.1.16462 WP_000758418.1.16465 WP_000758418.1.16468 WP_000758418.1.16474 WP_000758418.1.16508 WP_000758418.1.16522 WP_000758418.1.16525 WP_000758418.1.16551 WP_000758418.1.16563 WP_000758418.1.16588 WP_000758418.1.16614 WP_000758418.1.16650 WP_000758418.1.16658 WP_000758418.1.16666 WP_000758418.1.16673 WP_000758418.1.16686 WP_000758418.1.16691 WP_000758418.1.167 WP_000758418.1.16729 WP_000758418.1.16732 WP_000758418.1.16735 WP_000758418.1.16736 WP_000758418.1.1674 WP_000758418.1.16767 WP_000758418.1.16781 WP_000758418.1.16786 WP_000758418.1.16804 WP_000758418.1.16819 WP_000758418.1.16846 WP_000758418.1.16873 WP_000758418.1.16879 WP_000758418.1.16893 WP_000758418.1.16896 WP_000758418.1.16903 WP_000758418.1.16905 WP_000758418.1.16910 WP_000758418.1.16941 WP_000758418.1.16944 WP_000758418.1.16948 WP_000758418.1.16949 WP_000758418.1.16965 WP_000758418.1.16972 WP_000758418.1.16998 WP_000758418.1.1700 WP_000758418.1.17031 WP_000758418.1.17049 WP_000758418.1.17058 WP_000758418.1.17060 WP_000758418.1.17078 WP_000758418.1.17093 WP_000758418.1.17096 WP_000758418.1.17105 WP_000758418.1.17188 WP_000758418.1.17202 WP_000758418.1.17219 WP_000758418.1.1722 WP_000758418.1.17270 WP_000758418.1.17285 WP_000758418.1.17302 WP_000758418.1.17307 WP_000758418.1.17308 WP_000758418.1.1733 WP_000758418.1.17368 WP_000758418.1.17390 WP_000758418.1.174 WP_000758418.1.17405 WP_000758418.1.17406 WP_000758418.1.17447 WP_000758418.1.17480 WP_000758418.1.17482 WP_000758418.1.1749 WP_000758418.1.17504 WP_000758418.1.17513 WP_000758418.1.17525 WP_000758418.1.17543 WP_000758418.1.17546 WP_000758418.1.17563 WP_000758418.1.1757 WP_000758418.1.17578 WP_000758418.1.17583 WP_000758418.1.17622 WP_000758418.1.17629 WP_000758418.1.17659 WP_000758418.1.17667 WP_000758418.1.17686 WP_000758418.1.17693 WP_000758418.1.17705 WP_000758418.1.17732 WP_000758418.1.17741 WP_000758418.1.17743 WP_000758418.1.17747 WP_000758418.1.17840 WP_000758418.1.17886 WP_000758418.1.17891 WP_000758418.1.17914 WP_000758418.1.17919 WP_000758418.1.17936 WP_000758418.1.17956 WP_000758418.1.1798 WP_000758418.1.17991 WP_000758418.1.18005 WP_000758418.1.1801 WP_000758418.1.18019 WP_000758418.1.18021 WP_000758418.1.18056 WP_000758418.1.18061 WP_000758418.1.18089 WP_000758418.1.18092 WP_000758418.1.18099 WP_000758418.1.18109 WP_000758418.1.18111 WP_000758418.1.18122 WP_000758418.1.18124 WP_000758418.1.18144 WP_000758418.1.18149 WP_000758418.1.18163 WP_000758418.1.18173 WP_000758418.1.18177 WP_000758418.1.18178 WP_000758418.1.1818 WP_000758418.1.1825 WP_000758418.1.18254 WP_000758418.1.18265 WP_000758418.1.18267 WP_000758418.1.18270 WP_000758418.1.18277 WP_000758418.1.18280 WP_000758418.1.18282 WP_000758418.1.18328 WP_000758418.1.18358 WP_000758418.1.18365 WP_000758418.1.18370 WP_000758418.1.18384 WP_000758418.1.18406 WP_000758418.1.18426 WP_000758418.1.18441 WP_000758418.1.18468 WP_000758418.1.18474 WP_000758418.1.18489 WP_000758418.1.18513 WP_000758418.1.18607 WP_000758418.1.18610 WP_000758418.1.18641 WP_000758418.1.18678 WP_000758418.1.18686 WP_000758418.1.18705 WP_000758418.1.18715 WP_000758418.1.18722 WP_000758418.1.18737 WP_000758418.1.18766 WP_000758418.1.1880 WP_000758418.1.18822 WP_000758418.1.18847 WP_000758418.1.1885 WP_000758418.1.18860 WP_000758418.1.18881 WP_000758418.1.18886 WP_000758418.1.18895 WP_000758418.1.18922 WP_000758418.1.18940 WP_000758418.1.18949 WP_000758418.1.1895 WP_000758418.1.18959 WP_000758418.1.1897 WP_000758418.1.19001 WP_000758418.1.19006 WP_000758418.1.19038 WP_000758418.1.19044 WP_000758418.1.19053 WP_000758418.1.19064 WP_000758418.1.19084 WP_000758418.1.19093 WP_000758418.1.19163 WP_000758418.1.19174 WP_000758418.1.19187 WP_000758418.1.19228 WP_000758418.1.19240 WP_000758418.1.19273 WP_000758418.1.19288 WP_000758418.1.19291 WP_000758418.1.19300 WP_000758418.1.19320 WP_000758418.1.19340 WP_000758418.1.19373 WP_000758418.1.1939 WP_000758418.1.19405 WP_000758418.1.19422 WP_000758418.1.19433 WP_000758418.1.19454 WP_000758418.1.19456 WP_000758418.1.19458 WP_000758418.1.19460 WP_000758418.1.19461 WP_000758418.1.19496 WP_000758418.1.19535 WP_000758418.1.19538 WP_000758418.1.1954 WP_000758418.1.1955 WP_000758418.1.19588 WP_000758418.1.19589 WP_000758418.1.19614 WP_000758418.1.19616 WP_000758418.1.19642 WP_000758418.1.19656 WP_000758418.1.19660 WP_000758418.1.19663 WP_000758418.1.1968 WP_000758418.1.19683 WP_000758418.1.19686 WP_000758418.1.19702 WP_000758418.1.19706 WP_000758418.1.19724 WP_000758418.1.19731 WP_000758418.1.19740 WP_000758418.1.19749 WP_000758418.1.19784 WP_000758418.1.19793 WP_000758418.1.19794 WP_000758418.1.19802 WP_000758418.1.19809 WP_000758418.1.19834 WP_000758418.1.19851 WP_000758418.1.19867 WP_000758418.1.19884 WP_000758418.1.1992 WP_000758418.1.19970 WP_000758418.1.19975 WP_000758418.1.1998 WP_000758418.1.19999 WP_000758418.1.20 WP_000758418.1.20034 WP_000758418.1.20086 WP_000758418.1.20089 WP_000758418.1.2010 WP_000758418.1.20119 WP_000758418.1.20153 WP_000758418.1.20212 WP_000758418.1.20218 WP_000758418.1.20254 WP_000758418.1.20255 WP_000758418.1.2026 WP_000758418.1.20261 WP_000758418.1.20266 WP_000758418.1.20271 WP_000758418.1.20296 WP_000758418.1.20330 WP_000758418.1.20339 WP_000758418.1.20349 WP_000758418.1.20362 WP_000758418.1.20364 WP_000758418.1.20376 WP_000758418.1.20391 WP_000758418.1.2041 WP_000758418.1.20415 WP_000758418.1.20418 WP_000758418.1.20419 WP_000758418.1.20425 WP_000758418.1.20437 WP_000758418.1.20443 WP_000758418.1.20446 WP_000758418.1.20465 WP_000758418.1.20488 WP_000758418.1.20492 WP_000758418.1.20503 WP_000758418.1.20525 WP_000758418.1.2053 WP_000758418.1.2054 WP_000758418.1.20553 WP_000758418.1.20614 WP_000758418.1.20626 WP_000758418.1.20635 WP_000758418.1.20646 WP_000758418.1.20695 WP_000758418.1.20700 WP_000758418.1.20718 WP_000758418.1.20721 WP_000758418.1.2073 WP_000758418.1.20740 WP_000758418.1.20760 WP_000758418.1.20767 WP_000758418.1.20787 WP_000758418.1.20789 WP_000758418.1.20810 WP_000758418.1.20828 WP_000758418.1.20839 WP_000758418.1.20862 WP_000758418.1.2087 WP_000758418.1.20883 WP_000758418.1.20886 WP_000758418.1.20900 WP_000758418.1.20908 WP_000758418.1.2091 WP_000758418.1.20947 WP_000758418.1.20953 WP_000758418.1.21010 WP_000758418.1.21049 WP_000758418.1.2106 WP_000758418.1.21062 WP_000758418.1.21075 WP_000758418.1.21079 WP_000758418.1.21103 WP_000758418.1.21136 WP_000758418.1.21144 WP_000758418.1.21146 WP_000758418.1.2116 WP_000758418.1.21162 WP_000758418.1.21181 WP_000758418.1.21184 WP_000758418.1.21185 WP_000758418.1.21194 WP_000758418.1.21202 WP_000758418.1.21241 WP_000758418.1.21245 WP_000758418.1.21246 WP_000758418.1.21269 WP_000758418.1.21286 WP_000758418.1.21332 WP_000758418.1.21351 WP_000758418.1.21362 WP_000758418.1.21366 WP_000758418.1.21399 WP_000758418.1.21400 WP_000758418.1.21443 WP_000758418.1.21453 WP_000758418.1.2146 WP_000758418.1.21473 WP_000758418.1.21492 WP_000758418.1.21497 WP_000758418.1.21499 WP_000758418.1.21548 WP_000758418.1.21603 WP_000758418.1.21616 WP_000758418.1.21674 WP_000758418.1.21681 WP_000758418.1.21715 WP_000758418.1.21728 WP_000758418.1.21730 WP_000758418.1.21751 WP_000758418.1.21757 WP_000758418.1.21792 WP_000758418.1.21825 WP_000758418.1.21845 WP_000758418.1.21877 WP_000758418.1.21886 WP_000758418.1.21909 WP_000758418.1.21910 WP_000758418.1.21940 WP_000758418.1.21946 WP_000758418.1.21950 WP_000758418.1.21966 WP_000758418.1.21991 WP_000758418.1.22019 WP_000758418.1.22024 WP_000758418.1.2205 WP_000758418.1.22051 WP_000758418.1.22062 WP_000758418.1.22064 WP_000758418.1.22067 WP_000758418.1.22069 WP_000758418.1.22096 WP_000758418.1.22117 WP_000758418.1.22118 WP_000758418.1.22126 WP_000758418.1.22136 WP_000758418.1.22158 WP_000758418.1.2216 WP_000758418.1.22162 WP_000758418.1.22205 WP_000758418.1.22208 WP_000758418.1.2221 WP_000758418.1.22235 WP_000758418.1.2224 WP_000758418.1.22240 WP_000758418.1.2227 WP_000758418.1.22296 WP_000758418.1.22323 WP_000758418.1.22337 WP_000758418.1.22346 WP_000758418.1.2235 WP_000758418.1.22373 WP_000758418.1.22379 WP_000758418.1.22427 WP_000758418.1.22449 WP_000758418.1.2246 WP_000758418.1.22476 WP_000758418.1.22485 WP_000758418.1.22514 WP_000758418.1.22537 WP_000758418.1.22565 WP_000758418.1.22582 WP_000758418.1.22590 WP_000758418.1.22595 WP_000758418.1.22605 WP_000758418.1.22614 WP_000758418.1.22620 WP_000758418.1.22652 WP_000758418.1.22683 WP_000758418.1.22692 WP_000758418.1.22758 WP_000758418.1.22760 WP_000758418.1.2283 WP_000758418.1.2284 WP_000758418.1.22855 WP_000758418.1.22857 WP_000758418.1.22864 WP_000758418.1.22870 WP_000758418.1.22880 WP_000758418.1.22895 WP_000758418.1.22902 WP_000758418.1.22926 WP_000758418.1.22943 WP_000758418.1.22947 WP_000758418.1.22966 WP_000758418.1.22967 WP_000758418.1.22979 WP_000758418.1.23040 WP_000758418.1.23053 WP_000758418.1.23058 WP_000758418.1.23102 WP_000758418.1.23114 WP_000758418.1.2314 WP_000758418.1.23148 WP_000758418.1.23169 WP_000758418.1.23175 WP_000758418.1.23192 WP_000758418.1.23218 WP_000758418.1.23219 WP_000758418.1.2324 WP_000758418.1.23259 WP_000758418.1.23274 WP_000758418.1.23279 WP_000758418.1.23309 WP_000758418.1.2331 WP_000758418.1.23311 WP_000758418.1.2332 WP_000758418.1.23329 WP_000758418.1.23340 WP_000758418.1.23343 WP_000758418.1.2336 WP_000758418.1.23365 WP_000758418.1.23379 WP_000758418.1.23409 WP_000758418.1.23412 WP_000758418.1.23426 WP_000758418.1.23442 WP_000758418.1.23444 WP_000758418.1.23460 WP_000758418.1.23466 WP_000758418.1.23472 WP_000758418.1.23482 WP_000758418.1.23492 WP_000758418.1.235 WP_000758418.1.23500 WP_000758418.1.23503 WP_000758418.1.23509 WP_000758418.1.23513 WP_000758418.1.23515 WP_000758418.1.23548 WP_000758418.1.23571 WP_000758418.1.2358 WP_000758418.1.23604 WP_000758418.1.23631 WP_000758418.1.23634 WP_000758418.1.23639 WP_000758418.1.2364 WP_000758418.1.23643 WP_000758418.1.23646 WP_000758418.1.23670 WP_000758418.1.23679 WP_000758418.1.23685 WP_000758418.1.237 WP_000758418.1.23707 WP_000758418.1.23720 WP_000758418.1.23728 WP_000758418.1.23736 WP_000758418.1.23746 WP_000758418.1.2375 WP_000758418.1.23783 WP_000758418.1.23786 WP_000758418.1.23787 WP_000758418.1.2380 WP_000758418.1.23801 WP_000758418.1.23819 WP_000758418.1.23932 WP_000758418.1.23959 WP_000758418.1.24017 WP_000758418.1.24028 WP_000758418.1.24061 WP_000758418.1.24082 WP_000758418.1.24083 WP_000758418.1.24117 WP_000758418.1.24125 WP_000758418.1.24138 WP_000758418.1.24145 WP_000758418.1.2415 WP_000758418.1.24153 WP_000758418.1.24206 WP_000758418.1.24214 WP_000758418.1.24250 WP_000758418.1.24259 WP_000758418.1.24291 WP_000758418.1.24297 WP_000758418.1.24303 WP_000758418.1.24308 WP_000758418.1.24322 WP_000758418.1.24325 WP_000758418.1.24355 WP_000758418.1.24361 WP_000758418.1.24375 WP_000758418.1.24400 WP_000758418.1.24408 WP_000758418.1.24409 WP_000758418.1.24412 WP_000758418.1.24420 WP_000758418.1.24444 WP_000758418.1.24450 WP_000758418.1.24476 WP_000758418.1.24494 WP_000758418.1.24521 WP_000758418.1.24578 WP_000758418.1.24619 WP_000758418.1.24643 WP_000758418.1.24673 WP_000758418.1.24686 WP_000758418.1.24688 WP_000758418.1.24689 WP_000758418.1.24716 WP_000758418.1.24727 WP_000758418.1.24737 WP_000758418.1.24779 WP_000758418.1.24803 WP_000758418.1.2481 WP_000758418.1.24832 WP_000758418.1.24839 WP_000758418.1.24901 WP_000758418.1.24944 WP_000758418.1.24964 WP_000758418.1.24995 WP_000758418.1.25008 WP_000758418.1.25015 WP_000758418.1.25017 WP_000758418.1.25032 WP_000758418.1.25036 WP_000758418.1.25041 WP_000758418.1.25053 WP_000758418.1.25064 WP_000758418.1.25072 WP_000758418.1.25119 WP_000758418.1.25130 WP_000758418.1.25140 WP_000758418.1.25159 WP_000758418.1.25175 WP_000758418.1.25185 WP_000758418.1.25196 WP_000758418.1.25206 WP_000758418.1.25210 WP_000758418.1.25219 WP_000758418.1.25229 WP_000758418.1.25304 WP_000758418.1.25354 WP_000758418.1.25374 WP_000758418.1.25397 WP_000758418.1.25405 WP_000758418.1.25421 WP_000758418.1.25426 WP_000758418.1.25454 WP_000758418.1.25475 WP_000758418.1.25490 WP_000758418.1.25493 WP_000758418.1.25498 WP_000758418.1.25508 WP_000758418.1.25512 WP_000758418.1.2554 WP_000758418.1.25546 WP_000758418.1.25564 WP_000758418.1.25596 WP_000758418.1.25603 WP_000758418.1.25618 WP_000758418.1.2562 WP_000758418.1.25666 WP_000758418.1.25668 WP_000758418.1.2568 WP_000758418.1.25690 WP_000758418.1.2570 WP_000758418.1.25700 WP_000758418.1.25709 WP_000758418.1.25740 WP_000758418.1.25780 WP_000758418.1.25807 WP_000758418.1.25809 WP_000758418.1.2581 WP_000758418.1.25814 WP_000758418.1.25821 WP_000758418.1.25825 WP_000758418.1.25833 WP_000758418.1.25835 WP_000758418.1.25882 WP_000758418.1.25911 WP_000758418.1.25928 WP_000758418.1.25932 WP_000758418.1.25951 WP_000758418.1.25962 WP_000758418.1.25963 WP_000758418.1.25988 WP_000758418.1.26001 WP_000758418.1.26027 WP_000758418.1.26030 WP_000758418.1.26034 WP_000758418.1.26083 WP_000758418.1.26107 WP_000758418.1.26123 WP_000758418.1.2615 WP_000758418.1.26194 WP_000758418.1.26199 WP_000758418.1.26213 WP_000758418.1.26217 WP_000758418.1.26230 WP_000758418.1.26232 WP_000758418.1.26269 WP_000758418.1.26272 WP_000758418.1.26282 WP_000758418.1.26286 WP_000758418.1.26288 WP_000758418.1.26311 WP_000758418.1.26319 WP_000758418.1.2634 WP_000758418.1.26363 WP_000758418.1.26394 WP_000758418.1.26426 WP_000758418.1.26429 WP_000758418.1.26440 WP_000758418.1.26441 WP_000758418.1.26491 WP_000758418.1.26493 WP_000758418.1.26532 WP_000758418.1.2654 WP_000758418.1.26551 WP_000758418.1.26554 WP_000758418.1.26567 WP_000758418.1.26587 WP_000758418.1.2660 WP_000758418.1.26636 WP_000758418.1.2667 WP_000758418.1.26687 WP_000758418.1.26689 WP_000758418.1.2672 WP_000758418.1.26741 WP_000758418.1.26787 WP_000758418.1.2679 WP_000758418.1.26794 WP_000758418.1.26833 WP_000758418.1.26856 WP_000758418.1.26882 WP_000758418.1.26892 WP_000758418.1.26908 WP_000758418.1.26919 WP_000758418.1.2692 WP_000758418.1.26928 WP_000758418.1.26936 WP_000758418.1.26980 WP_000758418.1.270 WP_000758418.1.27008 WP_000758418.1.27010 WP_000758418.1.27027 WP_000758418.1.27051 WP_000758418.1.27055 WP_000758418.1.27070 WP_000758418.1.27072 WP_000758418.1.27077 WP_000758418.1.27084 WP_000758418.1.27086 WP_000758418.1.27087 WP_000758418.1.27111 WP_000758418.1.27115 WP_000758418.1.2713 WP_000758418.1.27169 WP_000758418.1.2717 WP_000758418.1.27173 WP_000758418.1.27206 WP_000758418.1.27223 WP_000758418.1.27228 WP_000758418.1.27255 WP_000758418.1.27272 WP_000758418.1.27279 WP_000758418.1.27282 WP_000758418.1.27285 WP_000758418.1.27309 WP_000758418.1.27314 WP_000758418.1.27329 WP_000758418.1.27361 WP_000758418.1.27383 WP_000758418.1.27419 WP_000758418.1.27423 WP_000758418.1.27452 WP_000758418.1.27523 WP_000758418.1.27535 WP_000758418.1.27544 WP_000758418.1.27547 WP_000758418.1.27556 WP_000758418.1.27565 WP_000758418.1.27595 WP_000758418.1.27598 WP_000758418.1.2763 WP_000758418.1.27632 WP_000758418.1.27638 WP_000758418.1.27655 WP_000758418.1.27658 WP_000758418.1.27665 WP_000758418.1.27706 WP_000758418.1.27707 WP_000758418.1.27761 WP_000758418.1.2777 WP_000758418.1.27775 WP_000758418.1.27785 WP_000758418.1.27798 WP_000758418.1.27800 WP_000758418.1.27815 WP_000758418.1.27833 WP_000758418.1.27857 WP_000758418.1.27883 WP_000758418.1.27900 WP_000758418.1.27928 WP_000758418.1.27945 WP_000758418.1.27969 WP_000758418.1.27977 WP_000758418.1.27995 WP_000758418.1.27997 WP_000758418.1.28004 WP_000758418.1.28032 WP_000758418.1.28037 WP_000758418.1.2806 WP_000758418.1.28073 WP_000758418.1.2809 WP_000758418.1.28094 WP_000758418.1.28116 WP_000758418.1.28126 WP_000758418.1.28139 WP_000758418.1.28155 WP_000758418.1.28170 WP_000758418.1.28174 WP_000758418.1.28198 WP_000758418.1.28200 WP_000758418.1.2822 WP_000758418.1.28225 WP_000758418.1.28229 WP_000758418.1.28232 WP_000758418.1.28233 WP_000758418.1.28235 WP_000758418.1.28267 WP_000758418.1.2829 WP_000758418.1.28301 WP_000758418.1.28302 WP_000758418.1.28303 WP_000758418.1.2835 WP_000758418.1.28370 WP_000758418.1.28384 WP_000758418.1.28386 WP_000758418.1.28395 WP_000758418.1.284 WP_000758418.1.2845 WP_000758418.1.28462 WP_000758418.1.28479 WP_000758418.1.28504 WP_000758418.1.28514 WP_000758418.1.2853 WP_000758418.1.28538 WP_000758418.1.28575 WP_000758418.1.28612 WP_000758418.1.28620 WP_000758418.1.28625 WP_000758418.1.28627 WP_000758418.1.28655 WP_000758418.1.28665 WP_000758418.1.28673 WP_000758418.1.28692 WP_000758418.1.28694 WP_000758418.1.287 WP_000758418.1.2873 WP_000758418.1.28773 WP_000758418.1.28776 WP_000758418.1.2879 WP_000758418.1.28830 WP_000758418.1.2890 WP_000758418.1.28902 WP_000758418.1.28917 WP_000758418.1.28938 WP_000758418.1.28946 WP_000758418.1.28948 WP_000758418.1.28962 WP_000758418.1.28963 WP_000758418.1.29006 WP_000758418.1.29010 WP_000758418.1.29023 WP_000758418.1.29042 WP_000758418.1.2905 WP_000758418.1.2907 WP_000758418.1.29081 WP_000758418.1.29089 WP_000758418.1.2910 WP_000758418.1.29113 WP_000758418.1.29130 WP_000758418.1.29153 WP_000758418.1.29168 WP_000758418.1.29174 WP_000758418.1.29203 WP_000758418.1.29218 WP_000758418.1.29237 WP_000758418.1.2924 WP_000758418.1.29248 WP_000758418.1.29265 WP_000758418.1.29274 WP_000758418.1.29288 WP_000758418.1.2932 WP_000758418.1.29349 WP_000758418.1.29379 WP_000758418.1.29389 WP_000758418.1.29422 WP_000758418.1.29436 WP_000758418.1.29439 WP_000758418.1.29454 WP_000758418.1.2946 WP_000758418.1.29462 WP_000758418.1.29509 WP_000758418.1.29563 WP_000758418.1.29576 WP_000758418.1.29588 WP_000758418.1.29601 WP_000758418.1.29606 WP_000758418.1.29615 WP_000758418.1.29619 WP_000758418.1.29727 WP_000758418.1.29743 WP_000758418.1.29774 WP_000758418.1.29775 WP_000758418.1.29782 WP_000758418.1.29827 WP_000758418.1.29833 WP_000758418.1.2984 WP_000758418.1.29845 WP_000758418.1.29851 WP_000758418.1.29865 WP_000758418.1.29886 WP_000758418.1.29898 WP_000758418.1.29919 WP_000758418.1.29924 WP_000758418.1.2994 WP_000758418.1.29964 WP_000758418.1.29969 WP_000758418.1.29983 WP_000758418.1.29990 WP_000758418.1.30006 WP_000758418.1.30009 WP_000758418.1.30013 WP_000758418.1.3002 WP_000758418.1.30022 WP_000758418.1.30027 WP_000758418.1.30034 WP_000758418.1.30049 WP_000758418.1.3005 WP_000758418.1.30058 WP_000758418.1.30059 WP_000758418.1.30093 WP_000758418.1.30165 WP_000758418.1.3017 WP_000758418.1.30170 WP_000758418.1.30172 WP_000758418.1.30179 WP_000758418.1.30185 WP_000758418.1.30195 WP_000758418.1.30202 WP_000758418.1.30210 WP_000758418.1.30213 WP_000758418.1.30225 WP_000758418.1.30238 WP_000758418.1.30278 WP_000758418.1.30354 WP_000758418.1.30357 WP_000758418.1.30362 WP_000758418.1.30386 WP_000758418.1.30389 WP_000758418.1.3042 WP_000758418.1.30421 WP_000758418.1.30425 WP_000758418.1.30437 WP_000758418.1.30440 WP_000758418.1.30448 WP_000758418.1.30469 WP_000758418.1.30489 WP_000758418.1.30492 WP_000758418.1.30505 WP_000758418.1.30507 WP_000758418.1.30517 WP_000758418.1.30542 WP_000758418.1.30544 WP_000758418.1.30547 WP_000758418.1.30556 WP_000758418.1.30572 WP_000758418.1.30573 WP_000758418.1.30585 WP_000758418.1.30589 WP_000758418.1.30602 WP_000758418.1.30618 WP_000758418.1.30627 WP_000758418.1.3066 WP_000758418.1.30664 WP_000758418.1.3067 WP_000758418.1.3068 WP_000758418.1.30688 WP_000758418.1.30752 WP_000758418.1.30794 WP_000758418.1.3080 WP_000758418.1.30802 WP_000758418.1.30803 WP_000758418.1.30806 WP_000758418.1.30819 WP_000758418.1.30833 WP_000758418.1.30835 WP_000758418.1.3089 WP_000758418.1.30909 WP_000758418.1.30934 WP_000758418.1.30967 WP_000758418.1.30968 WP_000758418.1.30972 WP_000758418.1.31 WP_000758418.1.31001 WP_000758418.1.31011 WP_000758418.1.31042 WP_000758418.1.31046 WP_000758418.1.31066 WP_000758418.1.31078 WP_000758418.1.31092 WP_000758418.1.31107 WP_000758418.1.31122 WP_000758418.1.3113 WP_000758418.1.31139 WP_000758418.1.3114 WP_000758418.1.31145 WP_000758418.1.31156 WP_000758418.1.31167 WP_000758418.1.31171 WP_000758418.1.31182 WP_000758418.1.31185 WP_000758418.1.3119 WP_000758418.1.31190 WP_000758418.1.31195 WP_000758418.1.31196 WP_000758418.1.31198 WP_000758418.1.31205 WP_000758418.1.3121 WP_000758418.1.31210 WP_000758418.1.31219 WP_000758418.1.31222 WP_000758418.1.31223 WP_000758418.1.3124 WP_000758418.1.31251 WP_000758418.1.31262 WP_000758418.1.3127 WP_000758418.1.31272 WP_000758418.1.31281 WP_000758418.1.31303 WP_000758418.1.3131 WP_000758418.1.31335 WP_000758418.1.31352 WP_000758418.1.31362 WP_000758418.1.31389 WP_000758418.1.31413 WP_000758418.1.31435 WP_000758418.1.31446 WP_000758418.1.31451 WP_000758418.1.31476 WP_000758418.1.31504 WP_000758418.1.31515 WP_000758418.1.31533 WP_000758418.1.31578 WP_000758418.1.31585 WP_000758418.1.31590 WP_000758418.1.31658 WP_000758418.1.31665 WP_000758418.1.3167 WP_000758418.1.3170 WP_000758418.1.31720 WP_000758418.1.31725 WP_000758418.1.31762 WP_000758418.1.31799 WP_000758418.1.31836 WP_000758418.1.3185 WP_000758418.1.31854 WP_000758418.1.31895 WP_000758418.1.31940 WP_000758418.1.31951 WP_000758418.1.31967 WP_000758418.1.31972 WP_000758418.1.31983 WP_000758418.1.32006 WP_000758418.1.32038 WP_000758418.1.32042 WP_000758418.1.32054 WP_000758418.1.32056 WP_000758418.1.3207 WP_000758418.1.32109 WP_000758418.1.32116 WP_000758418.1.32170 WP_000758418.1.32189 WP_000758418.1.32192 WP_000758418.1.32202 WP_000758418.1.32204 WP_000758418.1.32206 WP_000758418.1.32252 WP_000758418.1.32260 WP_000758418.1.32263 WP_000758418.1.32274 WP_000758418.1.32275 WP_000758418.1.32293 WP_000758418.1.32299 WP_000758418.1.32309 WP_000758418.1.32368 WP_000758418.1.32408 WP_000758418.1.32422 WP_000758418.1.32423 WP_000758418.1.32425 WP_000758418.1.32434 WP_000758418.1.32438 WP_000758418.1.32458 WP_000758418.1.32459 WP_000758418.1.32460 WP_000758418.1.32491 WP_000758418.1.32515 WP_000758418.1.32519 WP_000758418.1.32527 WP_000758418.1.32529 WP_000758418.1.32545 WP_000758418.1.32563 WP_000758418.1.32578 WP_000758418.1.32617 WP_000758418.1.32629 WP_000758418.1.32660 WP_000758418.1.32668 WP_000758418.1.3270 WP_000758418.1.32702 WP_000758418.1.32714 WP_000758418.1.32725 WP_000758418.1.32740 WP_000758418.1.32747 WP_000758418.1.32786 WP_000758418.1.32804 WP_000758418.1.32832 WP_000758418.1.32838 WP_000758418.1.32848 WP_000758418.1.32860 WP_000758418.1.32868 WP_000758418.1.32881 WP_000758418.1.32899 WP_000758418.1.3290 WP_000758418.1.32907 WP_000758418.1.32930 WP_000758418.1.32940 WP_000758418.1.32941 WP_000758418.1.3296 WP_000758418.1.32961 WP_000758418.1.32966 WP_000758418.1.32977 WP_000758418.1.32985 WP_000758418.1.33010 WP_000758418.1.33030 WP_000758418.1.33037 WP_000758418.1.3304 WP_000758418.1.3305 WP_000758418.1.33050 WP_000758418.1.33051 WP_000758418.1.33065 WP_000758418.1.33078 WP_000758418.1.33106 WP_000758418.1.33114 WP_000758418.1.33122 WP_000758418.1.33127 WP_000758418.1.33143 WP_000758418.1.33144 WP_000758418.1.3315 WP_000758418.1.33160 WP_000758418.1.33208 WP_000758418.1.33214 WP_000758418.1.33247 WP_000758418.1.33248 WP_000758418.1.33253 WP_000758418.1.33261 WP_000758418.1.33270 WP_000758418.1.33280 WP_000758418.1.33283 WP_000758418.1.333 WP_000758418.1.33313 WP_000758418.1.33339 WP_000758418.1.33382 WP_000758418.1.33409 WP_000758418.1.33486 WP_000758418.1.33490 WP_000758418.1.33492 WP_000758418.1.335 WP_000758418.1.33501 WP_000758418.1.33529 WP_000758418.1.33553 WP_000758418.1.3356 WP_000758418.1.33580 WP_000758418.1.33586 WP_000758418.1.33592 WP_000758418.1.33609 WP_000758418.1.33629 WP_000758418.1.3364 WP_000758418.1.33659 WP_000758418.1.33689 WP_000758418.1.33693 WP_000758418.1.3370 WP_000758418.1.33730 WP_000758418.1.33741 WP_000758418.1.33840 WP_000758418.1.33865 WP_000758418.1.33894 WP_000758418.1.3392 WP_000758418.1.33926 WP_000758418.1.3394 WP_000758418.1.3395 WP_000758418.1.33957 WP_000758418.1.3396 WP_000758418.1.33969 WP_000758418.1.33986 WP_000758418.1.34 WP_000758418.1.34001 WP_000758418.1.34022 WP_000758418.1.34043 WP_000758418.1.34059 WP_000758418.1.34075 WP_000758418.1.34081 WP_000758418.1.34091 WP_000758418.1.34107 WP_000758418.1.34118 WP_000758418.1.34126 WP_000758418.1.34179 WP_000758418.1.34185 WP_000758418.1.34211 WP_000758418.1.34214 WP_000758418.1.34234 WP_000758418.1.34279 WP_000758418.1.34284 WP_000758418.1.34292 WP_000758418.1.34304 WP_000758418.1.34319 WP_000758418.1.34364 WP_000758418.1.34376 WP_000758418.1.3438 WP_000758418.1.34382 WP_000758418.1.34417 WP_000758418.1.34431 WP_000758418.1.3445 WP_000758418.1.34453 WP_000758418.1.34454 WP_000758418.1.34458 WP_000758418.1.34484 WP_000758418.1.34496 WP_000758418.1.345 WP_000758418.1.34517 WP_000758418.1.34530 WP_000758418.1.34610 WP_000758418.1.34614 WP_000758418.1.34647 WP_000758418.1.34665 WP_000758418.1.34667 WP_000758418.1.34684 WP_000758418.1.34694 WP_000758418.1.34703 WP_000758418.1.34704 WP_000758418.1.34707 WP_000758418.1.34711 WP_000758418.1.34745 WP_000758418.1.34751 WP_000758418.1.3476 WP_000758418.1.34801 WP_000758418.1.34808 WP_000758418.1.34820 WP_000758418.1.34824 WP_000758418.1.34834 WP_000758418.1.34854 WP_000758418.1.34856 WP_000758418.1.3489 WP_000758418.1.34932 WP_000758418.1.34962 WP_000758418.1.34972 WP_000758418.1.34975 WP_000758418.1.34977 WP_000758418.1.35001 WP_000758418.1.35035 WP_000758418.1.35040 WP_000758418.1.35045 WP_000758418.1.35074 WP_000758418.1.35075 WP_000758418.1.35125 WP_000758418.1.35129 WP_000758418.1.35175 WP_000758418.1.35184 WP_000758418.1.35193 WP_000758418.1.35240 WP_000758418.1.35274 WP_000758418.1.35294 WP_000758418.1.35298 WP_000758418.1.35321 WP_000758418.1.35332 WP_000758418.1.35404 WP_000758418.1.35408 WP_000758418.1.35425 WP_000758418.1.35429 WP_000758418.1.35446 WP_000758418.1.35463 WP_000758418.1.35494 WP_000758418.1.35503 WP_000758418.1.35509 WP_000758418.1.35532 WP_000758418.1.35560 WP_000758418.1.35563 WP_000758418.1.3557 WP_000758418.1.35570 WP_000758418.1.35590 WP_000758418.1.35594 WP_000758418.1.35619 WP_000758418.1.35624 WP_000758418.1.35628 WP_000758418.1.35648 WP_000758418.1.3570 WP_000758418.1.35712 WP_000758418.1.35713 WP_000758418.1.3572 WP_000758418.1.35736 WP_000758418.1.35777 WP_000758418.1.35791 WP_000758418.1.35795 WP_000758418.1.35809 WP_000758418.1.35847 WP_000758418.1.35870 WP_000758418.1.35887 WP_000758418.1.35892 WP_000758418.1.35916 WP_000758418.1.35936 WP_000758418.1.35938 WP_000758418.1.35940 WP_000758418.1.35961 WP_000758418.1.35966 WP_000758418.1.35993 WP_000758418.1.36000 WP_000758418.1.36003 WP_000758418.1.3601 WP_000758418.1.36011 WP_000758418.1.36034 WP_000758418.1.36036 WP_000758418.1.36037 WP_000758418.1.36063 WP_000758418.1.36069 WP_000758418.1.3610 WP_000758418.1.36157 WP_000758418.1.36172 WP_000758418.1.36236 WP_000758418.1.36286 WP_000758418.1.36291 WP_000758418.1.36298 WP_000758418.1.36308 WP_000758418.1.36323 WP_000758418.1.36343 WP_000758418.1.36445 WP_000758418.1.36460 WP_000758418.1.3649 WP_000758418.1.36495 WP_000758418.1.36512 WP_000758418.1.36526 WP_000758418.1.36542 WP_000758418.1.36547 WP_000758418.1.36564 WP_000758418.1.36567 WP_000758418.1.36579 WP_000758418.1.36584 WP_000758418.1.36592 WP_000758418.1.36609 WP_000758418.1.36617 WP_000758418.1.36618 WP_000758418.1.36643 WP_000758418.1.36663 WP_000758418.1.36690 WP_000758418.1.3670 WP_000758418.1.36701 WP_000758418.1.36705 WP_000758418.1.36721 WP_000758418.1.36725 WP_000758418.1.36764 WP_000758418.1.36765 WP_000758418.1.36779 WP_000758418.1.36792 WP_000758418.1.36798 WP_000758418.1.36802 WP_000758418.1.36821 WP_000758418.1.36839 WP_000758418.1.36853 WP_000758418.1.3688 WP_000758418.1.36889 WP_000758418.1.36899 WP_000758418.1.36918 WP_000758418.1.36931 WP_000758418.1.36949 WP_000758418.1.36950 WP_000758418.1.37013 WP_000758418.1.37014 WP_000758418.1.37028 WP_000758418.1.37029 WP_000758418.1.37063 WP_000758418.1.37073 WP_000758418.1.37100 WP_000758418.1.37111 WP_000758418.1.37112 WP_000758418.1.37114 WP_000758418.1.37133 WP_000758418.1.37176 WP_000758418.1.37190 WP_000758418.1.37191 WP_000758418.1.37199 WP_000758418.1.37200 WP_000758418.1.37256 WP_000758418.1.37258 WP_000758418.1.3726 WP_000758418.1.37267 WP_000758418.1.37293 WP_000758418.1.37297 WP_000758418.1.37303 WP_000758418.1.37320 WP_000758418.1.3734 WP_000758418.1.37351 WP_000758418.1.37363 WP_000758418.1.37370 WP_000758418.1.37376 WP_000758418.1.37405 WP_000758418.1.3744 WP_000758418.1.37478 WP_000758418.1.3748 WP_000758418.1.37498 WP_000758418.1.37504 WP_000758418.1.3751 WP_000758418.1.37513 WP_000758418.1.37521 WP_000758418.1.37558 WP_000758418.1.3756 WP_000758418.1.37584 WP_000758418.1.37590 WP_000758418.1.37593 WP_000758418.1.37600 WP_000758418.1.37610 WP_000758418.1.37613 WP_000758418.1.37618 WP_000758418.1.37659 WP_000758418.1.37662 WP_000758418.1.37666 WP_000758418.1.37675 WP_000758418.1.37687 WP_000758418.1.37691 WP_000758418.1.3771 WP_000758418.1.37719 WP_000758418.1.37761 WP_000758418.1.37775 WP_000758418.1.37777 WP_000758418.1.3778 WP_000758418.1.378 WP_000758418.1.37808 WP_000758418.1.37864 WP_000758418.1.379 WP_000758418.1.3790 WP_000758418.1.37911 WP_000758418.1.37941 WP_000758418.1.37965 WP_000758418.1.37968 WP_000758418.1.37978 WP_000758418.1.37985 WP_000758418.1.38001 WP_000758418.1.38026 WP_000758418.1.38037 WP_000758418.1.38047 WP_000758418.1.38061 WP_000758418.1.38064 WP_000758418.1.38108 WP_000758418.1.38145 WP_000758418.1.3816 WP_000758418.1.38199 WP_000758418.1.38207 WP_000758418.1.38261 WP_000758418.1.38266 WP_000758418.1.38273 WP_000758418.1.383 WP_000758418.1.38310 WP_000758418.1.38322 WP_000758418.1.3834 WP_000758418.1.38344 WP_000758418.1.38349 WP_000758418.1.38351 WP_000758418.1.3838 WP_000758418.1.38381 WP_000758418.1.38393 WP_000758418.1.38404 WP_000758418.1.38440 WP_000758418.1.3848 WP_000758418.1.38486 WP_000758418.1.38515 WP_000758418.1.38569 WP_000758418.1.38595 WP_000758418.1.3860 WP_000758418.1.38609 WP_000758418.1.38613 WP_000758418.1.38622 WP_000758418.1.38673 WP_000758418.1.3869 WP_000758418.1.38693 WP_000758418.1.38734 WP_000758418.1.38740 WP_000758418.1.38773 WP_000758418.1.38781 WP_000758418.1.38797 WP_000758418.1.38830 WP_000758418.1.38857 WP_000758418.1.38877 WP_000758418.1.38882 WP_000758418.1.38898 WP_000758418.1.38913 WP_000758418.1.38983 WP_000758418.1.38996 WP_000758418.1.39003 WP_000758418.1.39038 WP_000758418.1.39048 WP_000758418.1.39055 WP_000758418.1.39056 WP_000758418.1.39065 WP_000758418.1.3907 WP_000758418.1.39075 WP_000758418.1.39082 WP_000758418.1.39105 WP_000758418.1.39113 WP_000758418.1.39128 WP_000758418.1.39136 WP_000758418.1.3914 WP_000758418.1.39140 WP_000758418.1.39146 WP_000758418.1.39147 WP_000758418.1.39161 WP_000758418.1.39197 WP_000758418.1.39210 WP_000758418.1.39229 WP_000758418.1.39235 WP_000758418.1.39265 WP_000758418.1.39275 WP_000758418.1.3931 WP_000758418.1.39311 WP_000758418.1.39312 WP_000758418.1.39385 WP_000758418.1.39395 WP_000758418.1.39405 WP_000758418.1.39414 WP_000758418.1.39420 WP_000758418.1.39435 WP_000758418.1.39449 WP_000758418.1.39471 WP_000758418.1.39497 WP_000758418.1.39502 WP_000758418.1.39503 WP_000758418.1.39512 WP_000758418.1.39530 WP_000758418.1.39553 WP_000758418.1.39556 WP_000758418.1.39584 WP_000758418.1.39609 WP_000758418.1.39614 WP_000758418.1.39619 WP_000758418.1.39620 WP_000758418.1.39624 WP_000758418.1.39629 WP_000758418.1.39632 WP_000758418.1.39659 WP_000758418.1.39667 WP_000758418.1.39724 WP_000758418.1.39763 WP_000758418.1.39775 WP_000758418.1.39808 WP_000758418.1.39862 WP_000758418.1.39879 WP_000758418.1.39890 WP_000758418.1.39921 WP_000758418.1.39923 WP_000758418.1.39941 WP_000758418.1.39945 WP_000758418.1.39947 WP_000758418.1.40017 WP_000758418.1.40025 WP_000758418.1.40072 WP_000758418.1.40073 WP_000758418.1.40081 WP_000758418.1.40095 WP_000758418.1.40097 WP_000758418.1.401 WP_000758418.1.4011 WP_000758418.1.40111 WP_000758418.1.40158 WP_000758418.1.40160 WP_000758418.1.40167 WP_000758418.1.40170 WP_000758418.1.40205 WP_000758418.1.40208 WP_000758418.1.40224 WP_000758418.1.40229 WP_000758418.1.40240 WP_000758418.1.40257 WP_000758418.1.40258 WP_000758418.1.40279 WP_000758418.1.40284 WP_000758418.1.40292 WP_000758418.1.40305 WP_000758418.1.40307 WP_000758418.1.40311 WP_000758418.1.40341 WP_000758418.1.40361 WP_000758418.1.40380 WP_000758418.1.40395 WP_000758418.1.4042 WP_000758418.1.40465 WP_000758418.1.40467 WP_000758418.1.40492 WP_000758418.1.40493 WP_000758418.1.40496 WP_000758418.1.40508 WP_000758418.1.40517 WP_000758418.1.40533 WP_000758418.1.40577 WP_000758418.1.40583 WP_000758418.1.40622 WP_000758418.1.40693 WP_000758418.1.40695 WP_000758418.1.40698 WP_000758418.1.40710 WP_000758418.1.40722 WP_000758418.1.40745 WP_000758418.1.4075 WP_000758418.1.40750 WP_000758418.1.40763 WP_000758418.1.40771 WP_000758418.1.40788 WP_000758418.1.40849 WP_000758418.1.40854 WP_000758418.1.4087 WP_000758418.1.40877 WP_000758418.1.4088 WP_000758418.1.4089 WP_000758418.1.40924 WP_000758418.1.40930 WP_000758418.1.40932 WP_000758418.1.40946 WP_000758418.1.40973 WP_000758418.1.40979 WP_000758418.1.40996 WP_000758418.1.41004 WP_000758418.1.41017 WP_000758418.1.41018 WP_000758418.1.4106 WP_000758418.1.41070 WP_000758418.1.41074 WP_000758418.1.41075 WP_000758418.1.41086 WP_000758418.1.41091 WP_000758418.1.41097 WP_000758418.1.41116 WP_000758418.1.41128 WP_000758418.1.41132 WP_000758418.1.41176 WP_000758418.1.41192 WP_000758418.1.41226 WP_000758418.1.41251 WP_000758418.1.41258 WP_000758418.1.41277 WP_000758418.1.41279 WP_000758418.1.41299 WP_000758418.1.41305 WP_000758418.1.41310 WP_000758418.1.41321 WP_000758418.1.41333 WP_000758418.1.41335 WP_000758418.1.4136 WP_000758418.1.4141 WP_000758418.1.41415 WP_000758418.1.41427 WP_000758418.1.41434 WP_000758418.1.41438 WP_000758418.1.41440 WP_000758418.1.41459 WP_000758418.1.41497 WP_000758418.1.41498 WP_000758418.1.41516 WP_000758418.1.41519 WP_000758418.1.41524 WP_000758418.1.41528 WP_000758418.1.41554 WP_000758418.1.41572 WP_000758418.1.41591 WP_000758418.1.41610 WP_000758418.1.41658 WP_000758418.1.41659 WP_000758418.1.41662 WP_000758418.1.41688 WP_000758418.1.41690 WP_000758418.1.41708 WP_000758418.1.41716 WP_000758418.1.41746 WP_000758418.1.41761 WP_000758418.1.4178 WP_000758418.1.41789 WP_000758418.1.41799 WP_000758418.1.41824 WP_000758418.1.41825 WP_000758418.1.41836 WP_000758418.1.41859 WP_000758418.1.41862 WP_000758418.1.41877 WP_000758418.1.41882 WP_000758418.1.41894 WP_000758418.1.41904 WP_000758418.1.41919 WP_000758418.1.41929 WP_000758418.1.41931 WP_000758418.1.4194 WP_000758418.1.41949 WP_000758418.1.41978 WP_000758418.1.41979 WP_000758418.1.41985 WP_000758418.1.41994 WP_000758418.1.41998 WP_000758418.1.42009 WP_000758418.1.42069 WP_000758418.1.42081 WP_000758418.1.42090 WP_000758418.1.42104 WP_000758418.1.42109 WP_000758418.1.42111 WP_000758418.1.42136 WP_000758418.1.42156 WP_000758418.1.42187 WP_000758418.1.422 WP_000758418.1.42200 WP_000758418.1.42219 WP_000758418.1.4222 WP_000758418.1.42238 WP_000758418.1.42244 WP_000758418.1.42257 WP_000758418.1.42261 WP_000758418.1.42262 WP_000758418.1.42263 WP_000758418.1.42320 WP_000758418.1.42322 WP_000758418.1.42342 WP_000758418.1.42349 WP_000758418.1.42356 WP_000758418.1.42364 WP_000758418.1.42371 WP_000758418.1.42379 WP_000758418.1.4239 WP_000758418.1.42391 WP_000758418.1.42392 WP_000758418.1.42399 WP_000758418.1.42404 WP_000758418.1.42422 WP_000758418.1.42433 WP_000758418.1.42444 WP_000758418.1.42489 WP_000758418.1.42539 WP_000758418.1.4257 WP_000758418.1.42603 WP_000758418.1.42650 WP_000758418.1.42666 WP_000758418.1.4267 WP_000758418.1.42675 WP_000758418.1.42676 WP_000758418.1.42683 WP_000758418.1.42685 WP_000758418.1.42701 WP_000758418.1.42707 WP_000758418.1.42734 WP_000758418.1.4276 WP_000758418.1.42794 WP_000758418.1.42797 WP_000758418.1.42805 WP_000758418.1.42815 WP_000758418.1.42829 WP_000758418.1.42859 WP_000758418.1.42861 WP_000758418.1.42864 WP_000758418.1.4288 WP_000758418.1.42887 WP_000758418.1.4289 WP_000758418.1.42892 WP_000758418.1.42932 WP_000758418.1.42957 WP_000758418.1.4298 WP_000758418.1.42981 WP_000758418.1.43008 WP_000758418.1.43016 WP_000758418.1.43018 WP_000758418.1.43019 WP_000758418.1.43041 WP_000758418.1.43065 WP_000758418.1.43068 WP_000758418.1.43069 WP_000758418.1.43070 WP_000758418.1.43077 WP_000758418.1.43086 WP_000758418.1.43089 WP_000758418.1.43126 WP_000758418.1.43128 WP_000758418.1.43141 WP_000758418.1.43149 WP_000758418.1.43157 WP_000758418.1.43161 WP_000758418.1.43190 WP_000758418.1.43198 WP_000758418.1.43201 WP_000758418.1.43244 WP_000758418.1.43258 WP_000758418.1.4326 WP_000758418.1.43276 WP_000758418.1.43290 WP_000758418.1.43292 WP_000758418.1.43307 WP_000758418.1.43312 WP_000758418.1.4332 WP_000758418.1.43334 WP_000758418.1.43339 WP_000758418.1.43351 WP_000758418.1.43371 WP_000758418.1.43437 WP_000758418.1.43438 WP_000758418.1.4344 WP_000758418.1.43441 WP_000758418.1.43513 WP_000758418.1.43520 WP_000758418.1.43522 WP_000758418.1.43528 WP_000758418.1.43613 WP_000758418.1.43633 WP_000758418.1.43637 WP_000758418.1.43651 WP_000758418.1.43654 WP_000758418.1.43668 WP_000758418.1.43710 WP_000758418.1.43711 WP_000758418.1.43722 WP_000758418.1.4373 WP_000758418.1.43778 WP_000758418.1.43782 WP_000758418.1.43785 WP_000758418.1.43801 WP_000758418.1.43812 WP_000758418.1.43839 WP_000758418.1.43875 WP_000758418.1.43878 WP_000758418.1.43886 WP_000758418.1.43888 WP_000758418.1.43919 WP_000758418.1.43951 WP_000758418.1.43954 WP_000758418.1.43974 WP_000758418.1.44010 WP_000758418.1.44043 WP_000758418.1.44049 WP_000758418.1.4405 WP_000758418.1.44063 WP_000758418.1.44099 WP_000758418.1.44101 WP_000758418.1.44113 WP_000758418.1.44121 WP_000758418.1.44132 WP_000758418.1.44160 WP_000758418.1.44180 WP_000758418.1.44191 WP_000758418.1.44196 WP_000758418.1.4422 WP_000758418.1.4423 WP_000758418.1.44248 WP_000758418.1.44250 WP_000758418.1.44262 WP_000758418.1.44268 WP_000758418.1.4427 WP_000758418.1.44296 WP_000758418.1.44300 WP_000758418.1.44310 WP_000758418.1.44337 WP_000758418.1.44339 WP_000758418.1.44343 WP_000758418.1.44351 WP_000758418.1.44360 WP_000758418.1.44386 WP_000758418.1.44397 WP_000758418.1.4440 WP_000758418.1.44416 WP_000758418.1.44431 WP_000758418.1.44433 WP_000758418.1.44437 WP_000758418.1.44438 WP_000758418.1.44440 WP_000758418.1.44474 WP_000758418.1.44479 WP_000758418.1.44546 WP_000758418.1.44578 WP_000758418.1.44593 WP_000758418.1.44607 WP_000758418.1.44640 WP_000758418.1.4467 WP_000758418.1.4468 WP_000758418.1.44702 WP_000758418.1.44705 WP_000758418.1.44747 WP_000758418.1.44762 WP_000758418.1.44815 WP_000758418.1.44828 WP_000758418.1.44831 WP_000758418.1.4485 WP_000758418.1.44877 WP_000758418.1.44879 WP_000758418.1.44887 WP_000758418.1.449 WP_000758418.1.44917 WP_000758418.1.44927 WP_000758418.1.44933 WP_000758418.1.44966 WP_000758418.1.44971 WP_000758418.1.44978 WP_000758418.1.44985 WP_000758418.1.44996 WP_000758418.1.44997 WP_000758418.1.44998 WP_000758418.1.4500 WP_000758418.1.4501 WP_000758418.1.45027 WP_000758418.1.45038 WP_000758418.1.45045 WP_000758418.1.45067 WP_000758418.1.45072 WP_000758418.1.45074 WP_000758418.1.45079 WP_000758418.1.45093 WP_000758418.1.45098 WP_000758418.1.45123 WP_000758418.1.45136 WP_000758418.1.45145 WP_000758418.1.45154 WP_000758418.1.45173 WP_000758418.1.45177 WP_000758418.1.45184 WP_000758418.1.45229 WP_000758418.1.45238 WP_000758418.1.45241 WP_000758418.1.45251 WP_000758418.1.45259 WP_000758418.1.45268 WP_000758418.1.45302 WP_000758418.1.4531 WP_000758418.1.45322 WP_000758418.1.45344 WP_000758418.1.45349 WP_000758418.1.45365 WP_000758418.1.4540 WP_000758418.1.45432 WP_000758418.1.45434 WP_000758418.1.45435 WP_000758418.1.45468 WP_000758418.1.45522 WP_000758418.1.45523 WP_000758418.1.45535 WP_000758418.1.45549 WP_000758418.1.45550 WP_000758418.1.45566 WP_000758418.1.45569 WP_000758418.1.45571 WP_000758418.1.45582 WP_000758418.1.45583 WP_000758418.1.45585 WP_000758418.1.45596 WP_000758418.1.45622 WP_000758418.1.45648 WP_000758418.1.45660 WP_000758418.1.45690 WP_000758418.1.45781 WP_000758418.1.45797 WP_000758418.1.458 WP_000758418.1.45829 WP_000758418.1.45844 WP_000758418.1.45848 WP_000758418.1.45871 WP_000758418.1.45906 WP_000758418.1.45918 WP_000758418.1.4592 WP_000758418.1.45984 WP_000758418.1.46011 WP_000758418.1.46028 WP_000758418.1.46030 WP_000758418.1.46069 WP_000758418.1.46077 WP_000758418.1.46112 WP_000758418.1.46124 WP_000758418.1.46169 WP_000758418.1.46173 WP_000758418.1.46174 WP_000758418.1.46187 WP_000758418.1.46203 WP_000758418.1.46205 WP_000758418.1.46215 WP_000758418.1.46225 WP_000758418.1.46232 WP_000758418.1.46241 WP_000758418.1.46250 WP_000758418.1.46278 WP_000758418.1.46286 WP_000758418.1.46303 WP_000758418.1.46307 WP_000758418.1.46322 WP_000758418.1.46323 WP_000758418.1.46355 WP_000758418.1.464 WP_000758418.1.46434 WP_000758418.1.46454 WP_000758418.1.46461 WP_000758418.1.46499 WP_000758418.1.46504 WP_000758418.1.46505 WP_000758418.1.46551 WP_000758418.1.46559 WP_000758418.1.46572 WP_000758418.1.46574 WP_000758418.1.46578 WP_000758418.1.46595 WP_000758418.1.46620 WP_000758418.1.46666 WP_000758418.1.46675 WP_000758418.1.46693 WP_000758418.1.46701 WP_000758418.1.46726 WP_000758418.1.46730 WP_000758418.1.46732 WP_000758418.1.4674 WP_000758418.1.46749 WP_000758418.1.46781 WP_000758418.1.46804 WP_000758418.1.46816 WP_000758418.1.46842 WP_000758418.1.4686 WP_000758418.1.4690 WP_000758418.1.46920 WP_000758418.1.46930 WP_000758418.1.46945 WP_000758418.1.46961 WP_000758418.1.46967 WP_000758418.1.46976 WP_000758418.1.47005 WP_000758418.1.47008 WP_000758418.1.47014 WP_000758418.1.47036 WP_000758418.1.47037 WP_000758418.1.47042 WP_000758418.1.47057 WP_000758418.1.47059 WP_000758418.1.47067 WP_000758418.1.47085 WP_000758418.1.47123 WP_000758418.1.47214 WP_000758418.1.47215 WP_000758418.1.47245 WP_000758418.1.47257 WP_000758418.1.47429 WP_000758418.1.47442 WP_000758418.1.47448 WP_000758418.1.4747 WP_000758418.1.47472 WP_000758418.1.47478 WP_000758418.1.47506 WP_000758418.1.47507 WP_000758418.1.47523 WP_000758418.1.47531 WP_000758418.1.47532 WP_000758418.1.47567 WP_000758418.1.47576 WP_000758418.1.47579 WP_000758418.1.4758 WP_000758418.1.47605 WP_000758418.1.47621 WP_000758418.1.47630 WP_000758418.1.47649 WP_000758418.1.4770 WP_000758418.1.47714 WP_000758418.1.4774 WP_000758418.1.4775 WP_000758418.1.47756 WP_000758418.1.47799 WP_000758418.1.4781 WP_000758418.1.47814 WP_000758418.1.47829 WP_000758418.1.47849 WP_000758418.1.47850 WP_000758418.1.47875 WP_000758418.1.47886 WP_000758418.1.47898 WP_000758418.1.47902 WP_000758418.1.47911 WP_000758418.1.4795 WP_000758418.1.47988 WP_000758418.1.47992 WP_000758418.1.48019 WP_000758418.1.48100 WP_000758418.1.48114 WP_000758418.1.48124 WP_000758418.1.48139 WP_000758418.1.48190 WP_000758418.1.48209 WP_000758418.1.48215 WP_000758418.1.48218 WP_000758418.1.48242 WP_000758418.1.48247 WP_000758418.1.48253 WP_000758418.1.48262 WP_000758418.1.48268 WP_000758418.1.48292 WP_000758418.1.483 WP_000758418.1.48324 WP_000758418.1.48367 WP_000758418.1.48377 WP_000758418.1.4839 WP_000758418.1.48426 WP_000758418.1.48430 WP_000758418.1.48436 WP_000758418.1.48455 WP_000758418.1.4853 WP_000758418.1.48570 WP_000758418.1.48586 WP_000758418.1.4859 WP_000758418.1.48591 WP_000758418.1.48610 WP_000758418.1.48631 WP_000758418.1.48651 WP_000758418.1.48663 WP_000758418.1.48690 WP_000758418.1.48734 WP_000758418.1.48755 WP_000758418.1.48756 WP_000758418.1.48774 WP_000758418.1.48778 WP_000758418.1.48788 WP_000758418.1.48797 WP_000758418.1.48849 WP_000758418.1.4885 WP_000758418.1.48855 WP_000758418.1.48876 WP_000758418.1.48886 WP_000758418.1.48894 WP_000758418.1.48908 WP_000758418.1.48918 WP_000758418.1.48919 WP_000758418.1.48931 WP_000758418.1.48955 WP_000758418.1.48963 WP_000758418.1.48973 WP_000758418.1.48985 WP_000758418.1.49004 WP_000758418.1.49012 WP_000758418.1.49084 WP_000758418.1.49090 WP_000758418.1.49102 WP_000758418.1.49106 WP_000758418.1.49113 WP_000758418.1.49117 WP_000758418.1.49121 WP_000758418.1.4914 WP_000758418.1.49140 WP_000758418.1.49153 WP_000758418.1.49155 WP_000758418.1.49162 WP_000758418.1.49166 WP_000758418.1.49204 WP_000758418.1.49226 WP_000758418.1.49239 WP_000758418.1.49256 WP_000758418.1.49262 WP_000758418.1.49274 WP_000758418.1.49290 WP_000758418.1.49302 WP_000758418.1.49304 WP_000758418.1.49309 WP_000758418.1.49334 WP_000758418.1.49340 WP_000758418.1.49355 WP_000758418.1.49366 WP_000758418.1.49375 WP_000758418.1.49429 WP_000758418.1.49434 WP_000758418.1.49450 WP_000758418.1.49472 WP_000758418.1.49490 WP_000758418.1.495 WP_000758418.1.49515 WP_000758418.1.49545 WP_000758418.1.49572 WP_000758418.1.49574 WP_000758418.1.49602 WP_000758418.1.49626 WP_000758418.1.49647 WP_000758418.1.49650 WP_000758418.1.49686 WP_000758418.1.49703 WP_000758418.1.49769 WP_000758418.1.49770 WP_000758418.1.49778 WP_000758418.1.49780 WP_000758418.1.4979 WP_000758418.1.49803 WP_000758418.1.49805 WP_000758418.1.49827 WP_000758418.1.49846 WP_000758418.1.4991 WP_000758418.1.49929 WP_000758418.1.49931 WP_000758418.1.49947 WP_000758418.1.49959 WP_000758418.1.49997 WP_000758418.1.50 WP_000758418.1.50007 WP_000758418.1.50014 WP_000758418.1.50030 WP_000758418.1.50043 WP_000758418.1.50080 WP_000758418.1.5009 WP_000758418.1.50103 WP_000758418.1.50128 WP_000758418.1.50158 WP_000758418.1.50161 WP_000758418.1.50211 WP_000758418.1.50239 WP_000758418.1.50247 WP_000758418.1.50251 WP_000758418.1.50285 WP_000758418.1.50308 WP_000758418.1.50309 WP_000758418.1.50332 WP_000758418.1.50349 WP_000758418.1.50374 WP_000758418.1.50376 WP_000758418.1.50386 WP_000758418.1.50387 WP_000758418.1.50389 WP_000758418.1.50404 WP_000758418.1.50406 WP_000758418.1.50413 WP_000758418.1.50449 WP_000758418.1.50468 WP_000758418.1.50469 WP_000758418.1.50478 WP_000758418.1.50480 WP_000758418.1.5051 WP_000758418.1.50563 WP_000758418.1.50565 WP_000758418.1.50566 WP_000758418.1.50570 WP_000758418.1.50576 WP_000758418.1.5058 WP_000758418.1.50626 WP_000758418.1.50652 WP_000758418.1.50676 WP_000758418.1.50684 WP_000758418.1.50726 WP_000758418.1.50769 WP_000758418.1.50771 WP_000758418.1.50774 WP_000758418.1.50782 WP_000758418.1.50800 WP_000758418.1.50804 WP_000758418.1.50808 WP_000758418.1.50875 WP_000758418.1.5088 WP_000758418.1.50882 WP_000758418.1.50885 WP_000758418.1.509 WP_000758418.1.50905 WP_000758418.1.50908 WP_000758418.1.50918 WP_000758418.1.50929 WP_000758418.1.50941 WP_000758418.1.50954 WP_000758418.1.50960 WP_000758418.1.50970 WP_000758418.1.50999 WP_000758418.1.51014 WP_000758418.1.51022 WP_000758418.1.51025 WP_000758418.1.51040 WP_000758418.1.51048 WP_000758418.1.51066 WP_000758418.1.51100 WP_000758418.1.51117 WP_000758418.1.51131 WP_000758418.1.51134 WP_000758418.1.51139 WP_000758418.1.51162 WP_000758418.1.51179 WP_000758418.1.51182 WP_000758418.1.51186 WP_000758418.1.51224 WP_000758418.1.51227 WP_000758418.1.5127 WP_000758418.1.51305 WP_000758418.1.51315 WP_000758418.1.51338 WP_000758418.1.51356 WP_000758418.1.5136 WP_000758418.1.51394 WP_000758418.1.51412 WP_000758418.1.51419 WP_000758418.1.51451 WP_000758418.1.51458 WP_000758418.1.51474 WP_000758418.1.51487 WP_000758418.1.51488 WP_000758418.1.51502 WP_000758418.1.51506 WP_000758418.1.51519 WP_000758418.1.51598 WP_000758418.1.51611 WP_000758418.1.51613 WP_000758418.1.51615 WP_000758418.1.51634 WP_000758418.1.51642 WP_000758418.1.51644 WP_000758418.1.51649 WP_000758418.1.51686 WP_000758418.1.51700 WP_000758418.1.51724 WP_000758418.1.51734 WP_000758418.1.51756 WP_000758418.1.51764 WP_000758418.1.51810 WP_000758418.1.51831 WP_000758418.1.51838 WP_000758418.1.51863 WP_000758418.1.51868 WP_000758418.1.51911 WP_000758418.1.51930 WP_000758418.1.51932 WP_000758418.1.51935 WP_000758418.1.51989 WP_000758418.1.51994 WP_000758418.1.520 WP_000758418.1.52047 WP_000758418.1.52057 WP_000758418.1.5211 WP_000758418.1.52114 WP_000758418.1.52121 WP_000758418.1.52129 WP_000758418.1.52148 WP_000758418.1.52156 WP_000758418.1.5216 WP_000758418.1.52170 WP_000758418.1.52191 WP_000758418.1.52202 WP_000758418.1.52209 WP_000758418.1.52255 WP_000758418.1.52301 WP_000758418.1.52321 WP_000758418.1.52336 WP_000758418.1.52339 WP_000758418.1.52346 WP_000758418.1.52353 WP_000758418.1.52361 WP_000758418.1.52438 WP_000758418.1.52456 WP_000758418.1.52469 WP_000758418.1.52527 WP_000758418.1.52571 WP_000758418.1.52582 WP_000758418.1.52586 WP_000758418.1.526 WP_000758418.1.52647 WP_000758418.1.52653 WP_000758418.1.52656 WP_000758418.1.52675 WP_000758418.1.52692 WP_000758418.1.5273 WP_000758418.1.52742 WP_000758418.1.52743 WP_000758418.1.52744 WP_000758418.1.52748 WP_000758418.1.52773 WP_000758418.1.52795 WP_000758418.1.52807 WP_000758418.1.52824 WP_000758418.1.52833 WP_000758418.1.52857 WP_000758418.1.52866 WP_000758418.1.52887 WP_000758418.1.52898 WP_000758418.1.52924 WP_000758418.1.52949 WP_000758418.1.52985 WP_000758418.1.5301 WP_000758418.1.53016 WP_000758418.1.53092 WP_000758418.1.53100 WP_000758418.1.53107 WP_000758418.1.53119 WP_000758418.1.5313 WP_000758418.1.53141 WP_000758418.1.53151 WP_000758418.1.53154 WP_000758418.1.53158 WP_000758418.1.53159 WP_000758418.1.5316 WP_000758418.1.53179 WP_000758418.1.53190 WP_000758418.1.53198 WP_000758418.1.53203 WP_000758418.1.53210 WP_000758418.1.53233 WP_000758418.1.53234 WP_000758418.1.53272 WP_000758418.1.53274 WP_000758418.1.53286 WP_000758418.1.53307 WP_000758418.1.53316 WP_000758418.1.53321 WP_000758418.1.5333 WP_000758418.1.53362 WP_000758418.1.53368 WP_000758418.1.53375 WP_000758418.1.53385 WP_000758418.1.53406 WP_000758418.1.53436 WP_000758418.1.53450 WP_000758418.1.53454 WP_000758418.1.53466 WP_000758418.1.5349 WP_000758418.1.53529 WP_000758418.1.53540 WP_000758418.1.53543 WP_000758418.1.53555 WP_000758418.1.53559 WP_000758418.1.5356 WP_000758418.1.53567 WP_000758418.1.53571 WP_000758418.1.5358 WP_000758418.1.53664 WP_000758418.1.53675 WP_000758418.1.53692 WP_000758418.1.53694 WP_000758418.1.53696 WP_000758418.1.53723 WP_000758418.1.5374 WP_000758418.1.53750 WP_000758418.1.53757 WP_000758418.1.53772 WP_000758418.1.53778 WP_000758418.1.53781 WP_000758418.1.53800 WP_000758418.1.53815 WP_000758418.1.53839 WP_000758418.1.53892 WP_000758418.1.53896 WP_000758418.1.53898 WP_000758418.1.53902 WP_000758418.1.53905 WP_000758418.1.53935 WP_000758418.1.53958 WP_000758418.1.53961 WP_000758418.1.53981 WP_000758418.1.53984 WP_000758418.1.54033 WP_000758418.1.54061 WP_000758418.1.54075 WP_000758418.1.54082 WP_000758418.1.54132 WP_000758418.1.54136 WP_000758418.1.54170 WP_000758418.1.54175 WP_000758418.1.54196 WP_000758418.1.542 WP_000758418.1.54203 WP_000758418.1.54209 WP_000758418.1.54259 WP_000758418.1.54271 WP_000758418.1.54273 WP_000758418.1.54274 WP_000758418.1.54283 WP_000758418.1.5430 WP_000758418.1.54319 WP_000758418.1.54364 WP_000758418.1.54366 WP_000758418.1.54371 WP_000758418.1.54400 WP_000758418.1.54431 WP_000758418.1.54442 WP_000758418.1.54469 WP_000758418.1.54482 WP_000758418.1.54522 WP_000758418.1.54526 WP_000758418.1.5456 WP_000758418.1.54569 WP_000758418.1.54589 WP_000758418.1.54644 WP_000758418.1.54662 WP_000758418.1.54667 WP_000758418.1.54678 WP_000758418.1.54681 WP_000758418.1.54694 WP_000758418.1.54722 WP_000758418.1.54748 WP_000758418.1.54749 WP_000758418.1.54764 WP_000758418.1.54774 WP_000758418.1.5481 WP_000758418.1.54814 WP_000758418.1.54833 WP_000758418.1.54845 WP_000758418.1.5485 WP_000758418.1.54865 WP_000758418.1.54877 WP_000758418.1.5493 WP_000758418.1.54935 WP_000758418.1.54936 WP_000758418.1.54979 WP_000758418.1.54984 WP_000758418.1.54992 WP_000758418.1.55008 WP_000758418.1.55010 WP_000758418.1.55034 WP_000758418.1.55073 WP_000758418.1.55152 WP_000758418.1.55156 WP_000758418.1.55163 WP_000758418.1.55165 WP_000758418.1.5517 WP_000758418.1.55178 WP_000758418.1.55215 WP_000758418.1.55223 WP_000758418.1.55224 WP_000758418.1.5523 WP_000758418.1.5525 WP_000758418.1.55285 WP_000758418.1.55290 WP_000758418.1.55294 WP_000758418.1.55310 WP_000758418.1.55317 WP_000758418.1.55325 WP_000758418.1.55379 WP_000758418.1.5539 WP_000758418.1.55418 WP_000758418.1.55430 WP_000758418.1.55461 WP_000758418.1.55468 WP_000758418.1.55475 WP_000758418.1.55477 WP_000758418.1.55496 WP_000758418.1.55506 WP_000758418.1.5555 WP_000758418.1.55557 WP_000758418.1.55559 WP_000758418.1.5560 WP_000758418.1.55604 WP_000758418.1.55623 WP_000758418.1.55639 WP_000758418.1.55640 WP_000758418.1.55647 WP_000758418.1.55672 WP_000758418.1.55680 WP_000758418.1.55699 WP_000758418.1.55718 WP_000758418.1.5572 WP_000758418.1.55725 WP_000758418.1.55743 WP_000758418.1.55768 WP_000758418.1.5577 WP_000758418.1.55780 WP_000758418.1.55782 WP_000758418.1.55796 WP_000758418.1.55853 WP_000758418.1.55923 WP_000758418.1.55948 WP_000758418.1.55967 WP_000758418.1.55973 WP_000758418.1.55993 WP_000758418.1.56002 WP_000758418.1.56012 WP_000758418.1.56026 WP_000758418.1.56059 WP_000758418.1.56097 WP_000758418.1.56105 WP_000758418.1.56144 WP_000758418.1.56172 WP_000758418.1.5621 WP_000758418.1.56222 WP_000758418.1.56226 WP_000758418.1.56235 WP_000758418.1.56238 WP_000758418.1.56244 WP_000758418.1.56247 WP_000758418.1.56261 WP_000758418.1.56263 WP_000758418.1.56286 WP_000758418.1.56303 WP_000758418.1.56304 WP_000758418.1.56305 WP_000758418.1.56311 WP_000758418.1.56354 WP_000758418.1.56370 WP_000758418.1.56385 WP_000758418.1.56393 WP_000758418.1.56413 WP_000758418.1.56414 WP_000758418.1.56419 WP_000758418.1.56420 WP_000758418.1.56423 WP_000758418.1.56438 WP_000758418.1.56459 WP_000758418.1.56512 WP_000758418.1.56514 WP_000758418.1.56535 WP_000758418.1.56559 WP_000758418.1.56560 WP_000758418.1.56585 WP_000758418.1.56597 WP_000758418.1.56601 WP_000758418.1.56614 WP_000758418.1.56615 WP_000758418.1.56640 WP_000758418.1.56642 WP_000758418.1.56647 WP_000758418.1.56651 WP_000758418.1.56660 WP_000758418.1.56671 WP_000758418.1.5668 WP_000758418.1.56682 WP_000758418.1.56724 WP_000758418.1.56825 WP_000758418.1.56851 WP_000758418.1.56853 WP_000758418.1.56861 WP_000758418.1.56877 WP_000758418.1.56887 WP_000758418.1.56889 WP_000758418.1.56893 WP_000758418.1.56898 WP_000758418.1.56950 WP_000758418.1.56981 WP_000758418.1.57000 WP_000758418.1.57026 WP_000758418.1.57039 WP_000758418.1.57056 WP_000758418.1.57084 WP_000758418.1.57101 WP_000758418.1.5711 WP_000758418.1.57137 WP_000758418.1.57143 WP_000758418.1.57147 WP_000758418.1.57149 WP_000758418.1.57168 WP_000758418.1.57179 WP_000758418.1.57186 WP_000758418.1.57187 WP_000758418.1.57232 WP_000758418.1.57246 WP_000758418.1.57296 WP_000758418.1.57307 WP_000758418.1.57342 WP_000758418.1.57356 WP_000758418.1.57357 WP_000758418.1.57362 WP_000758418.1.57377 WP_000758418.1.57399 WP_000758418.1.57418 WP_000758418.1.57433 WP_000758418.1.57494 WP_000758418.1.57495 WP_000758418.1.57529 WP_000758418.1.57534 WP_000758418.1.57555 WP_000758418.1.57559 WP_000758418.1.57576 WP_000758418.1.57601 WP_000758418.1.57607 WP_000758418.1.57631 WP_000758418.1.57684 WP_000758418.1.57699 WP_000758418.1.57709 WP_000758418.1.57710 WP_000758418.1.57735 WP_000758418.1.5774 WP_000758418.1.57763 WP_000758418.1.57778 WP_000758418.1.57785 WP_000758418.1.57797 WP_000758418.1.57800 WP_000758418.1.5781 WP_000758418.1.57835 WP_000758418.1.57857 WP_000758418.1.57862 WP_000758418.1.57873 WP_000758418.1.57890 WP_000758418.1.57891 WP_000758418.1.57893 WP_000758418.1.57965 WP_000758418.1.57972 WP_000758418.1.57978 WP_000758418.1.58008 WP_000758418.1.5801 WP_000758418.1.58040 WP_000758418.1.58041 WP_000758418.1.58044 WP_000758418.1.58053 WP_000758418.1.58081 WP_000758418.1.5809 WP_000758418.1.58090 WP_000758418.1.58132 WP_000758418.1.58153 WP_000758418.1.58173 WP_000758418.1.58191 WP_000758418.1.58194 WP_000758418.1.58249 WP_000758418.1.58251 WP_000758418.1.58252 WP_000758418.1.58261 WP_000758418.1.58274 WP_000758418.1.5828 WP_000758418.1.58282 WP_000758418.1.58290 WP_000758418.1.58301 WP_000758418.1.58324 WP_000758418.1.58326 WP_000758418.1.58357 WP_000758418.1.58358 WP_000758418.1.5836 WP_000758418.1.58407 WP_000758418.1.58418 WP_000758418.1.58442 WP_000758418.1.58443 WP_000758418.1.5846 WP_000758418.1.58485 WP_000758418.1.58486 WP_000758418.1.58489 WP_000758418.1.58537 WP_000758418.1.5854 WP_000758418.1.58548 WP_000758418.1.58568 WP_000758418.1.5858 WP_000758418.1.58583 WP_000758418.1.58604 WP_000758418.1.58633 WP_000758418.1.58652 WP_000758418.1.58662 WP_000758418.1.58663 WP_000758418.1.58669 WP_000758418.1.58675 WP_000758418.1.587 WP_000758418.1.58724 WP_000758418.1.58729 WP_000758418.1.58745 WP_000758418.1.58749 WP_000758418.1.5875 WP_000758418.1.58770 WP_000758418.1.5878 WP_000758418.1.58796 WP_000758418.1.58803 WP_000758418.1.58807 WP_000758418.1.58831 WP_000758418.1.58836 WP_000758418.1.58847 WP_000758418.1.5886 WP_000758418.1.58861 WP_000758418.1.58883 WP_000758418.1.58884 WP_000758418.1.58898 WP_000758418.1.58926 WP_000758418.1.58949 WP_000758418.1.58963 WP_000758418.1.58970 WP_000758418.1.58974 WP_000758418.1.59012 WP_000758418.1.59020 WP_000758418.1.59043 WP_000758418.1.59056 WP_000758418.1.59061 WP_000758418.1.59064 WP_000758418.1.59084 WP_000758418.1.59094 WP_000758418.1.59125 WP_000758418.1.59136 WP_000758418.1.59142 WP_000758418.1.59148 WP_000758418.1.59163 WP_000758418.1.59224 WP_000758418.1.59282 WP_000758418.1.59295 WP_000758418.1.59299 WP_000758418.1.59313 WP_000758418.1.59335 WP_000758418.1.59336 WP_000758418.1.59375 WP_000758418.1.59381 WP_000758418.1.59412 WP_000758418.1.59420 WP_000758418.1.59427 WP_000758418.1.59458 WP_000758418.1.59486 WP_000758418.1.5949 WP_000758418.1.59490 WP_000758418.1.59501 WP_000758418.1.59508 WP_000758418.1.59510 WP_000758418.1.59521 WP_000758418.1.5953 WP_000758418.1.59538 WP_000758418.1.59548 WP_000758418.1.59562 WP_000758418.1.59587 WP_000758418.1.59604 WP_000758418.1.59641 WP_000758418.1.59646 WP_000758418.1.59648 WP_000758418.1.59684 WP_000758418.1.5969 WP_000758418.1.59694 WP_000758418.1.59710 WP_000758418.1.59751 WP_000758418.1.59755 WP_000758418.1.59771 WP_000758418.1.5979 WP_000758418.1.59827 WP_000758418.1.59829 WP_000758418.1.59830 WP_000758418.1.59847 WP_000758418.1.59848 WP_000758418.1.59863 WP_000758418.1.59928 WP_000758418.1.5993 WP_000758418.1.59953 WP_000758418.1.59969 WP_000758418.1.59994 WP_000758418.1.60008 WP_000758418.1.60021 WP_000758418.1.60045 WP_000758418.1.60069 WP_000758418.1.60076 WP_000758418.1.60114 WP_000758418.1.60126 WP_000758418.1.60137 WP_000758418.1.60140 WP_000758418.1.60154 WP_000758418.1.60155 WP_000758418.1.60168 WP_000758418.1.60192 WP_000758418.1.60199 WP_000758418.1.60209 WP_000758418.1.60212 WP_000758418.1.60226 WP_000758418.1.60231 WP_000758418.1.60253 WP_000758418.1.60285 WP_000758418.1.60320 WP_000758418.1.60322 WP_000758418.1.60324 WP_000758418.1.6033 WP_000758418.1.60356 WP_000758418.1.60370 WP_000758418.1.60379 WP_000758418.1.6038 WP_000758418.1.60380 WP_000758418.1.6041 WP_000758418.1.60424 WP_000758418.1.60425 WP_000758418.1.60464 WP_000758418.1.60469 WP_000758418.1.60481 WP_000758418.1.605 WP_000758418.1.60545 WP_000758418.1.60560 WP_000758418.1.60561 WP_000758418.1.6058 WP_000758418.1.60584 WP_000758418.1.60597 WP_000758418.1.6060 WP_000758418.1.60643 WP_000758418.1.60661 WP_000758418.1.60676 WP_000758418.1.60708 WP_000758418.1.60713 WP_000758418.1.60725 WP_000758418.1.60746 WP_000758418.1.60772 WP_000758418.1.60783 WP_000758418.1.60792 WP_000758418.1.60794 WP_000758418.1.608 WP_000758418.1.60807 WP_000758418.1.60838 WP_000758418.1.60851 WP_000758418.1.60857 WP_000758418.1.6086 WP_000758418.1.60866 WP_000758418.1.60874 WP_000758418.1.60882 WP_000758418.1.60889 WP_000758418.1.60897 WP_000758418.1.6090 WP_000758418.1.60919 WP_000758418.1.60926 WP_000758418.1.60941 WP_000758418.1.60950 WP_000758418.1.60976 WP_000758418.1.60988 WP_000758418.1.6104 WP_000758418.1.61044 WP_000758418.1.61045 WP_000758418.1.61076 WP_000758418.1.61078 WP_000758418.1.61114 WP_000758418.1.61123 WP_000758418.1.6114 WP_000758418.1.61146 WP_000758418.1.61147 WP_000758418.1.61168 WP_000758418.1.61200 WP_000758418.1.61201 WP_000758418.1.61210 WP_000758418.1.61218 WP_000758418.1.61232 WP_000758418.1.61233 WP_000758418.1.6126 WP_000758418.1.6129 WP_000758418.1.61296 WP_000758418.1.61345 WP_000758418.1.61356 WP_000758418.1.61357 WP_000758418.1.61381 WP_000758418.1.61417 WP_000758418.1.61497 WP_000758418.1.61501 WP_000758418.1.61511 WP_000758418.1.61539 WP_000758418.1.61542 WP_000758418.1.61553 WP_000758418.1.61574 WP_000758418.1.61582 WP_000758418.1.61594 WP_000758418.1.61595 WP_000758418.1.61609 WP_000758418.1.6164 WP_000758418.1.61649 WP_000758418.1.61652 WP_000758418.1.61662 WP_000758418.1.61667 WP_000758418.1.61671 WP_000758418.1.61697 WP_000758418.1.61712 WP_000758418.1.61714 WP_000758418.1.61743 WP_000758418.1.61809 WP_000758418.1.61857 WP_000758418.1.61877 WP_000758418.1.6190 WP_000758418.1.61908 WP_000758418.1.61918 WP_000758418.1.61920 WP_000758418.1.61922 WP_000758418.1.61924 WP_000758418.1.61952 WP_000758418.1.61968 WP_000758418.1.62007 WP_000758418.1.62020 WP_000758418.1.62025 WP_000758418.1.62076 WP_000758418.1.6209 WP_000758418.1.6210 WP_000758418.1.62108 WP_000758418.1.62120 WP_000758418.1.62122 WP_000758418.1.62124 WP_000758418.1.62142 WP_000758418.1.62158 WP_000758418.1.62199 WP_000758418.1.62201 WP_000758418.1.62204 WP_000758418.1.62210 WP_000758418.1.62219 WP_000758418.1.62223 WP_000758418.1.62241 WP_000758418.1.62245 WP_000758418.1.62257 WP_000758418.1.62271 WP_000758418.1.62302 WP_000758418.1.62304 WP_000758418.1.62314 WP_000758418.1.62323 WP_000758418.1.62338 WP_000758418.1.62339 WP_000758418.1.62364 WP_000758418.1.62374 WP_000758418.1.62380 WP_000758418.1.62403 WP_000758418.1.62404 WP_000758418.1.62407 WP_000758418.1.62411 WP_000758418.1.62412 WP_000758418.1.62436 WP_000758418.1.62475 WP_000758418.1.62488 WP_000758418.1.62504 WP_000758418.1.62522 WP_000758418.1.6253 WP_000758418.1.62536 WP_000758418.1.62564 WP_000758418.1.62570 WP_000758418.1.62619 WP_000758418.1.62640 WP_000758418.1.62669 WP_000758418.1.62686 WP_000758418.1.627 WP_000758418.1.62745 WP_000758418.1.62751 WP_000758418.1.62757 WP_000758418.1.62798 WP_000758418.1.62825 WP_000758418.1.62853 WP_000758418.1.62903 WP_000758418.1.62910 WP_000758418.1.62913 WP_000758418.1.6292 WP_000758418.1.62932 WP_000758418.1.62955 WP_000758418.1.62960 WP_000758418.1.62976 WP_000758418.1.62983 WP_000758418.1.62988 WP_000758418.1.63016 WP_000758418.1.63025 WP_000758418.1.63043 WP_000758418.1.63045 WP_000758418.1.63063 WP_000758418.1.63069 WP_000758418.1.63087 WP_000758418.1.63102 WP_000758418.1.63118 WP_000758418.1.63135 WP_000758418.1.63150 WP_000758418.1.63155 WP_000758418.1.63169 WP_000758418.1.63181 WP_000758418.1.63186 WP_000758418.1.63203 WP_000758418.1.63229 WP_000758418.1.63234 WP_000758418.1.63243 WP_000758418.1.63256 WP_000758418.1.63290 WP_000758418.1.63297 WP_000758418.1.63358 WP_000758418.1.63362 WP_000758418.1.63382 WP_000758418.1.63422 WP_000758418.1.63448 WP_000758418.1.63455 WP_000758418.1.63461 WP_000758418.1.63479 WP_000758418.1.63497 WP_000758418.1.63499 WP_000758418.1.63509 WP_000758418.1.63513 WP_000758418.1.63514 WP_000758418.1.63525 WP_000758418.1.63529 WP_000758418.1.63532 WP_000758418.1.63568 WP_000758418.1.6357 WP_000758418.1.63577 WP_000758418.1.63583 WP_000758418.1.63585 WP_000758418.1.63592 WP_000758418.1.63603 WP_000758418.1.63633 WP_000758418.1.63663 WP_000758418.1.63664 WP_000758418.1.63677 WP_000758418.1.6370 WP_000758418.1.63718 WP_000758418.1.63736 WP_000758418.1.63748 WP_000758418.1.6375 WP_000758418.1.63757 WP_000758418.1.63766 WP_000758418.1.63781 WP_000758418.1.63782 WP_000758418.1.63797 WP_000758418.1.63816 WP_000758418.1.63824 WP_000758418.1.63834 WP_000758418.1.63851 WP_000758418.1.63863 WP_000758418.1.63876 WP_000758418.1.6389 WP_000758418.1.63901 WP_000758418.1.63903 WP_000758418.1.63934 WP_000758418.1.63955 WP_000758418.1.63963 WP_000758418.1.63977 WP_000758418.1.63992 WP_000758418.1.64007 WP_000758418.1.64010 WP_000758418.1.64018 WP_000758418.1.64032 WP_000758418.1.64046 WP_000758418.1.64085 WP_000758418.1.64087 WP_000758418.1.64103 WP_000758418.1.64121 WP_000758418.1.6415 WP_000758418.1.64157 WP_000758418.1.64208 WP_000758418.1.64229 WP_000758418.1.6423 WP_000758418.1.64242 WP_000758418.1.64244 WP_000758418.1.64293 WP_000758418.1.64294 WP_000758418.1.64332 WP_000758418.1.64350 WP_000758418.1.64374 WP_000758418.1.64376 WP_000758418.1.64385 WP_000758418.1.64387 WP_000758418.1.64389 WP_000758418.1.644 WP_000758418.1.64403 WP_000758418.1.64462 WP_000758418.1.64471 WP_000758418.1.64500 WP_000758418.1.64501 WP_000758418.1.64538 WP_000758418.1.64597 WP_000758418.1.64632 WP_000758418.1.64645 WP_000758418.1.64648 WP_000758418.1.64649 WP_000758418.1.64654 WP_000758418.1.64662 WP_000758418.1.64663 WP_000758418.1.64667 WP_000758418.1.64674 WP_000758418.1.64690 WP_000758418.1.64702 WP_000758418.1.64709 WP_000758418.1.64710 WP_000758418.1.64711 WP_000758418.1.64744 WP_000758418.1.64757 WP_000758418.1.64763 WP_000758418.1.64771 WP_000758418.1.64781 WP_000758418.1.64817 WP_000758418.1.64831 WP_000758418.1.6484 WP_000758418.1.64847 WP_000758418.1.6487 WP_000758418.1.6489 WP_000758418.1.64891 WP_000758418.1.64894 WP_000758418.1.64919 WP_000758418.1.64920 WP_000758418.1.64944 WP_000758418.1.64972 WP_000758418.1.64974 WP_000758418.1.64977 WP_000758418.1.65011 WP_000758418.1.65016 WP_000758418.1.65018 WP_000758418.1.65027 WP_000758418.1.65028 WP_000758418.1.65052 WP_000758418.1.65054 WP_000758418.1.65075 WP_000758418.1.6514 WP_000758418.1.65163 WP_000758418.1.65168 WP_000758418.1.65171 WP_000758418.1.65172 WP_000758418.1.65185 WP_000758418.1.65191 WP_000758418.1.65200 WP_000758418.1.65211 WP_000758418.1.65218 WP_000758418.1.65226 WP_000758418.1.65238 WP_000758418.1.65248 WP_000758418.1.65249 WP_000758418.1.6525 WP_000758418.1.65266 WP_000758418.1.65269 WP_000758418.1.65348 WP_000758418.1.6535 WP_000758418.1.65357 WP_000758418.1.65363 WP_000758418.1.65394 WP_000758418.1.65395 WP_000758418.1.65437 WP_000758418.1.65459 WP_000758418.1.65463 WP_000758418.1.65474 WP_000758418.1.65487 WP_000758418.1.6549 WP_000758418.1.65499 WP_000758418.1.6550 WP_000758418.1.65538 WP_000758418.1.6554 WP_000758418.1.65572 WP_000758418.1.65601 WP_000758418.1.65633 WP_000758418.1.6565 WP_000758418.1.65650 WP_000758418.1.65687 WP_000758418.1.65696 WP_000758418.1.65697 WP_000758418.1.65698 WP_000758418.1.65699 WP_000758418.1.65737 WP_000758418.1.6575 WP_000758418.1.65755 WP_000758418.1.65771 WP_000758418.1.65782 WP_000758418.1.65812 WP_000758418.1.65838 WP_000758418.1.65846 WP_000758418.1.65863 WP_000758418.1.65876 WP_000758418.1.65881 WP_000758418.1.65883 WP_000758418.1.65901 WP_000758418.1.6594 WP_000758418.1.65940 WP_000758418.1.6595 WP_000758418.1.65956 WP_000758418.1.65968 WP_000758418.1.65985 WP_000758418.1.66021 WP_000758418.1.66031 WP_000758418.1.66049 WP_000758418.1.66052 WP_000758418.1.66064 WP_000758418.1.66074 WP_000758418.1.66082 WP_000758418.1.66085 WP_000758418.1.66109 WP_000758418.1.66122 WP_000758418.1.66129 WP_000758418.1.66145 WP_000758418.1.66167 WP_000758418.1.66171 WP_000758418.1.66183 WP_000758418.1.6620 WP_000758418.1.66216 WP_000758418.1.66234 WP_000758418.1.66250 WP_000758418.1.66270 WP_000758418.1.66272 WP_000758418.1.66273 WP_000758418.1.66289 WP_000758418.1.6630 WP_000758418.1.66314 WP_000758418.1.66315 WP_000758418.1.66324 WP_000758418.1.66330 WP_000758418.1.6634 WP_000758418.1.66358 WP_000758418.1.66361 WP_000758418.1.66362 WP_000758418.1.66365 WP_000758418.1.66368 WP_000758418.1.6638 WP_000758418.1.66385 WP_000758418.1.6640 WP_000758418.1.66400 WP_000758418.1.66428 WP_000758418.1.66446 WP_000758418.1.6647 WP_000758418.1.66480 WP_000758418.1.66492 WP_000758418.1.66506 WP_000758418.1.66534 WP_000758418.1.66539 WP_000758418.1.66600 WP_000758418.1.66665 WP_000758418.1.66678 WP_000758418.1.66681 WP_000758418.1.66684 WP_000758418.1.66698 WP_000758418.1.66702 WP_000758418.1.66733 WP_000758418.1.66755 WP_000758418.1.66759 WP_000758418.1.66779 WP_000758418.1.6680 WP_000758418.1.66801 WP_000758418.1.66807 WP_000758418.1.66820 WP_000758418.1.66825 WP_000758418.1.66834 WP_000758418.1.66860 WP_000758418.1.66876 WP_000758418.1.66901 WP_000758418.1.66937 WP_000758418.1.66953 WP_000758418.1.66955 WP_000758418.1.66959 WP_000758418.1.66962 WP_000758418.1.66981 WP_000758418.1.67 WP_000758418.1.67024 WP_000758418.1.67037 WP_000758418.1.67042 WP_000758418.1.67045 WP_000758418.1.67075 WP_000758418.1.6710 WP_000758418.1.67100 WP_000758418.1.67101 WP_000758418.1.67143 WP_000758418.1.67173 WP_000758418.1.67175 WP_000758418.1.67181 WP_000758418.1.67184 WP_000758418.1.67201 WP_000758418.1.67211 WP_000758418.1.67235 WP_000758418.1.67237 WP_000758418.1.67268 WP_000758418.1.67279 WP_000758418.1.67288 WP_000758418.1.67336 WP_000758418.1.67339 WP_000758418.1.67347 WP_000758418.1.67374 WP_000758418.1.67387 WP_000758418.1.6739 WP_000758418.1.67394 WP_000758418.1.67397 WP_000758418.1.67403 WP_000758418.1.67405 WP_000758418.1.67424 WP_000758418.1.67430 WP_000758418.1.67442 WP_000758418.1.67465 WP_000758418.1.67539 WP_000758418.1.67552 WP_000758418.1.67556 WP_000758418.1.67576 WP_000758418.1.6760 WP_000758418.1.67603 WP_000758418.1.67604 WP_000758418.1.67617 WP_000758418.1.67619 WP_000758418.1.67625 WP_000758418.1.67627 WP_000758418.1.67633 WP_000758418.1.67637 WP_000758418.1.67641 WP_000758418.1.67657 WP_000758418.1.67673 WP_000758418.1.67682 WP_000758418.1.67700 WP_000758418.1.67707 WP_000758418.1.67718 WP_000758418.1.67729 WP_000758418.1.67731 WP_000758418.1.67774 WP_000758418.1.67803 WP_000758418.1.6782 WP_000758418.1.67820 WP_000758418.1.67827 WP_000758418.1.67887 WP_000758418.1.67910 WP_000758418.1.67932 WP_000758418.1.67954 WP_000758418.1.67970 WP_000758418.1.67977 WP_000758418.1.67988 WP_000758418.1.68 WP_000758418.1.68036 WP_000758418.1.68043 WP_000758418.1.68073 WP_000758418.1.68075 WP_000758418.1.6809 WP_000758418.1.68105 WP_000758418.1.68113 WP_000758418.1.68115 WP_000758418.1.68131 WP_000758418.1.68140 WP_000758418.1.68159 WP_000758418.1.68182 WP_000758418.1.6819 WP_000758418.1.68201 WP_000758418.1.68206 WP_000758418.1.68210 WP_000758418.1.6827 WP_000758418.1.68275 WP_000758418.1.68285 WP_000758418.1.68359 WP_000758418.1.68401 WP_000758418.1.68420 WP_000758418.1.68477 WP_000758418.1.68478 WP_000758418.1.6849 WP_000758418.1.68514 WP_000758418.1.68532 WP_000758418.1.68547 WP_000758418.1.68564 WP_000758418.1.6858 WP_000758418.1.68589 WP_000758418.1.68591 WP_000758418.1.68652 WP_000758418.1.68655 WP_000758418.1.68656 WP_000758418.1.68677 WP_000758418.1.68688 WP_000758418.1.68742 WP_000758418.1.6875 WP_000758418.1.68770 WP_000758418.1.68778 WP_000758418.1.68787 WP_000758418.1.68809 WP_000758418.1.68816 WP_000758418.1.6883 WP_000758418.1.68893 WP_000758418.1.68895 WP_000758418.1.68914 WP_000758418.1.68928 WP_000758418.1.68975 WP_000758418.1.68999 WP_000758418.1.69001 WP_000758418.1.69006 WP_000758418.1.6904 WP_000758418.1.6905 WP_000758418.1.69053 WP_000758418.1.69058 WP_000758418.1.6907 WP_000758418.1.69080 WP_000758418.1.69086 WP_000758418.1.6913 WP_000758418.1.69131 WP_000758418.1.69146 WP_000758418.1.69151 WP_000758418.1.69170 WP_000758418.1.69210 WP_000758418.1.69236 WP_000758418.1.69255 WP_000758418.1.69270 WP_000758418.1.69273 WP_000758418.1.69282 WP_000758418.1.69288 WP_000758418.1.69296 WP_000758418.1.69320 WP_000758418.1.69357 WP_000758418.1.69359 WP_000758418.1.69371 WP_000758418.1.69376 WP_000758418.1.69385 WP_000758418.1.69396 WP_000758418.1.69397 WP_000758418.1.69465 WP_000758418.1.69466 WP_000758418.1.69485 WP_000758418.1.69515 WP_000758418.1.6954 WP_000758418.1.69564 WP_000758418.1.69575 WP_000758418.1.69592 WP_000758418.1.69597 WP_000758418.1.69611 WP_000758418.1.69616 WP_000758418.1.69636 WP_000758418.1.69642 WP_000758418.1.69644 WP_000758418.1.69656 WP_000758418.1.69657 WP_000758418.1.69690 WP_000758418.1.69696 WP_000758418.1.69704 WP_000758418.1.69710 WP_000758418.1.69758 WP_000758418.1.69760 WP_000758418.1.69767 WP_000758418.1.69790 WP_000758418.1.69807 WP_000758418.1.69808 WP_000758418.1.69817 WP_000758418.1.69848 WP_000758418.1.69923 WP_000758418.1.69948 WP_000758418.1.69953 WP_000758418.1.69965 WP_000758418.1.69975 WP_000758418.1.69982 WP_000758418.1.70010 WP_000758418.1.70047 WP_000758418.1.70049 WP_000758418.1.70058 WP_000758418.1.70061 WP_000758418.1.70087 WP_000758418.1.70088 WP_000758418.1.7014 WP_000758418.1.70183 WP_000758418.1.70205 WP_000758418.1.7021 WP_000758418.1.70240 WP_000758418.1.70241 WP_000758418.1.70248 WP_000758418.1.70249 WP_000758418.1.70261 WP_000758418.1.70269 WP_000758418.1.70272 WP_000758418.1.70281 WP_000758418.1.70289 WP_000758418.1.70290 WP_000758418.1.70303 WP_000758418.1.70314 WP_000758418.1.70321 WP_000758418.1.70326 WP_000758418.1.7033 WP_000758418.1.70355 WP_000758418.1.70394 WP_000758418.1.70427 WP_000758418.1.70433 WP_000758418.1.7044 WP_000758418.1.70440 WP_000758418.1.70447 WP_000758418.1.70485 WP_000758418.1.70488 WP_000758418.1.70491 WP_000758418.1.70523 WP_000758418.1.70531 WP_000758418.1.70545 WP_000758418.1.70547 WP_000758418.1.7055 WP_000758418.1.70580 WP_000758418.1.70596 WP_000758418.1.70623 WP_000758418.1.70643 WP_000758418.1.70644 WP_000758418.1.70671 WP_000758418.1.70678 WP_000758418.1.70679 WP_000758418.1.70683 WP_000758418.1.70685 WP_000758418.1.70708 WP_000758418.1.70712 WP_000758418.1.70717 WP_000758418.1.70731 WP_000758418.1.70732 WP_000758418.1.70772 WP_000758418.1.70785 WP_000758418.1.70797 WP_000758418.1.70837 WP_000758418.1.70845 WP_000758418.1.70846 WP_000758418.1.70883 WP_000758418.1.70914 WP_000758418.1.70922 WP_000758418.1.70929 WP_000758418.1.7093 WP_000758418.1.70948 WP_000758418.1.70959 WP_000758418.1.70969 WP_000758418.1.70977 WP_000758418.1.70981 WP_000758418.1.70986 WP_000758418.1.70995 WP_000758418.1.71010 WP_000758418.1.71023 WP_000758418.1.71039 WP_000758418.1.71057 WP_000758418.1.71081 WP_000758418.1.7110 WP_000758418.1.71116 WP_000758418.1.71117 WP_000758418.1.71146 WP_000758418.1.71150 WP_000758418.1.71165 WP_000758418.1.71171 WP_000758418.1.71172 WP_000758418.1.71184 WP_000758418.1.71186 WP_000758418.1.71188 WP_000758418.1.71201 WP_000758418.1.71202 WP_000758418.1.71243 WP_000758418.1.71248 WP_000758418.1.71268 WP_000758418.1.71299 WP_000758418.1.71306 WP_000758418.1.71337 WP_000758418.1.7134 WP_000758418.1.71363 WP_000758418.1.71368 WP_000758418.1.71378 WP_000758418.1.71401 WP_000758418.1.71407 WP_000758418.1.71446 WP_000758418.1.71450 WP_000758418.1.71452 WP_000758418.1.71455 WP_000758418.1.71456 WP_000758418.1.71481 WP_000758418.1.71487 WP_000758418.1.71500 WP_000758418.1.71523 WP_000758418.1.71542 WP_000758418.1.71566 WP_000758418.1.71583 WP_000758418.1.71600 WP_000758418.1.71626 WP_000758418.1.71636 WP_000758418.1.71640 WP_000758418.1.71649 WP_000758418.1.71651 WP_000758418.1.71653 WP_000758418.1.71691 WP_000758418.1.71702 WP_000758418.1.71716 WP_000758418.1.7174 WP_000758418.1.71750 WP_000758418.1.71756 WP_000758418.1.71798 WP_000758418.1.71845 WP_000758418.1.71872 WP_000758418.1.71881 WP_000758418.1.71908 WP_000758418.1.71923 WP_000758418.1.71929 WP_000758418.1.71950 WP_000758418.1.71952 WP_000758418.1.71954 WP_000758418.1.71973 WP_000758418.1.71979 WP_000758418.1.71984 WP_000758418.1.71985 WP_000758418.1.720 WP_000758418.1.72003 WP_000758418.1.72068 WP_000758418.1.72073 WP_000758418.1.72100 WP_000758418.1.72105 WP_000758418.1.72182 WP_000758418.1.72188 WP_000758418.1.72190 WP_000758418.1.72220 WP_000758418.1.72221 WP_000758418.1.72226 WP_000758418.1.72269 WP_000758418.1.72277 WP_000758418.1.72281 WP_000758418.1.72283 WP_000758418.1.72300 WP_000758418.1.72307 WP_000758418.1.72325 WP_000758418.1.72339 WP_000758418.1.72350 WP_000758418.1.72372 WP_000758418.1.72376 WP_000758418.1.72383 WP_000758418.1.72403 WP_000758418.1.7243 WP_000758418.1.72461 WP_000758418.1.72470 WP_000758418.1.72527 WP_000758418.1.72532 WP_000758418.1.7255 WP_000758418.1.72594 WP_000758418.1.72602 WP_000758418.1.72625 WP_000758418.1.72631 WP_000758418.1.72638 WP_000758418.1.72642 WP_000758418.1.72667 WP_000758418.1.72671 WP_000758418.1.72674 WP_000758418.1.72689 WP_000758418.1.72716 WP_000758418.1.72718 WP_000758418.1.72724 WP_000758418.1.72728 WP_000758418.1.72789 WP_000758418.1.72828 WP_000758418.1.72843 WP_000758418.1.72865 WP_000758418.1.72871 WP_000758418.1.72872 WP_000758418.1.72887 WP_000758418.1.72892 WP_000758418.1.72894 WP_000758418.1.72896 WP_000758418.1.72944 WP_000758418.1.7295 WP_000758418.1.72968 WP_000758418.1.72969 WP_000758418.1.72975 WP_000758418.1.72987 WP_000758418.1.73052 WP_000758418.1.73062 WP_000758418.1.73068 WP_000758418.1.7311 WP_000758418.1.73114 WP_000758418.1.73125 WP_000758418.1.73144 WP_000758418.1.7315 WP_000758418.1.7316 WP_000758418.1.73164 WP_000758418.1.73177 WP_000758418.1.73180 WP_000758418.1.73200 WP_000758418.1.73258 WP_000758418.1.73270 WP_000758418.1.73285 WP_000758418.1.7332 WP_000758418.1.73328 WP_000758418.1.7333 WP_000758418.1.7334 WP_000758418.1.73352 WP_000758418.1.73377 WP_000758418.1.73389 WP_000758418.1.7341 WP_000758418.1.73425 WP_000758418.1.73461 WP_000758418.1.73481 WP_000758418.1.73488 WP_000758418.1.73504 WP_000758418.1.73512 WP_000758418.1.7353 WP_000758418.1.73535 WP_000758418.1.73544 WP_000758418.1.7356 WP_000758418.1.73561 WP_000758418.1.73581 WP_000758418.1.73596 WP_000758418.1.73598 WP_000758418.1.7361 WP_000758418.1.73617 WP_000758418.1.73648 WP_000758418.1.73667 WP_000758418.1.73669 WP_000758418.1.73708 WP_000758418.1.7374 WP_000758418.1.73753 WP_000758418.1.73758 WP_000758418.1.73764 WP_000758418.1.73768 WP_000758418.1.73794 WP_000758418.1.73831 WP_000758418.1.73847 WP_000758418.1.73849 WP_000758418.1.7386 WP_000758418.1.7387 WP_000758418.1.73901 WP_000758418.1.73924 WP_000758418.1.73926 WP_000758418.1.7394 WP_000758418.1.73945 WP_000758418.1.73948 WP_000758418.1.73956 WP_000758418.1.73999 WP_000758418.1.74024 WP_000758418.1.74028 WP_000758418.1.74029 WP_000758418.1.74030 WP_000758418.1.74038 WP_000758418.1.74043 WP_000758418.1.7405 WP_000758418.1.74058 WP_000758418.1.74070 WP_000758418.1.74077 WP_000758418.1.74135 WP_000758418.1.74174 WP_000758418.1.74181 WP_000758418.1.74191 WP_000758418.1.74207 WP_000758418.1.74214 WP_000758418.1.74228 WP_000758418.1.74241 WP_000758418.1.74285 WP_000758418.1.743 WP_000758418.1.7430 WP_000758418.1.74300 WP_000758418.1.74317 WP_000758418.1.7433 WP_000758418.1.74379 WP_000758418.1.74410 WP_000758418.1.74415 WP_000758418.1.74418 WP_000758418.1.74422 WP_000758418.1.74428 WP_000758418.1.7444 WP_000758418.1.74466 WP_000758418.1.74469 WP_000758418.1.745 WP_000758418.1.74529 WP_000758418.1.74545 WP_000758418.1.74570 WP_000758418.1.74578 WP_000758418.1.74616 WP_000758418.1.74621 WP_000758418.1.74644 WP_000758418.1.74647 WP_000758418.1.74661 WP_000758418.1.74677 WP_000758418.1.74699 WP_000758418.1.74702 WP_000758418.1.74745 WP_000758418.1.74807 WP_000758418.1.74826 WP_000758418.1.74831 WP_000758418.1.74876 WP_000758418.1.74884 WP_000758418.1.74894 WP_000758418.1.7491 WP_000758418.1.74929 WP_000758418.1.74939 WP_000758418.1.74946 WP_000758418.1.74972 WP_000758418.1.74973 WP_000758418.1.75009 WP_000758418.1.75051 WP_000758418.1.75056 WP_000758418.1.7507 WP_000758418.1.75089 WP_000758418.1.75116 WP_000758418.1.75129 WP_000758418.1.75134 WP_000758418.1.75148 WP_000758418.1.75159 WP_000758418.1.75187 WP_000758418.1.75237 WP_000758418.1.75273 WP_000758418.1.75288 WP_000758418.1.75296 WP_000758418.1.7531 WP_000758418.1.75334 WP_000758418.1.75362 WP_000758418.1.75385 WP_000758418.1.75392 WP_000758418.1.75400 WP_000758418.1.75402 WP_000758418.1.75413 WP_000758418.1.7543 WP_000758418.1.75433 WP_000758418.1.75450 WP_000758418.1.75494 WP_000758418.1.75532 WP_000758418.1.75565 WP_000758418.1.7558 WP_000758418.1.75585 WP_000758418.1.75593 WP_000758418.1.75607 WP_000758418.1.75609 WP_000758418.1.75610 WP_000758418.1.75626 WP_000758418.1.7563 WP_000758418.1.75633 WP_000758418.1.75664 WP_000758418.1.75703 WP_000758418.1.75716 WP_000758418.1.75718 WP_000758418.1.75745 WP_000758418.1.75751 WP_000758418.1.75760 WP_000758418.1.75764 WP_000758418.1.75793 WP_000758418.1.75794 WP_000758418.1.75810 WP_000758418.1.75828 WP_000758418.1.75835 WP_000758418.1.75837 WP_000758418.1.75844 WP_000758418.1.75863 WP_000758418.1.75873 WP_000758418.1.75874 WP_000758418.1.75884 WP_000758418.1.75886 WP_000758418.1.75898 WP_000758418.1.75902 WP_000758418.1.75932 WP_000758418.1.75945 WP_000758418.1.75957 WP_000758418.1.76 WP_000758418.1.76020 WP_000758418.1.76024 WP_000758418.1.76055 WP_000758418.1.76081 WP_000758418.1.76097 WP_000758418.1.76102 WP_000758418.1.76108 WP_000758418.1.76116 WP_000758418.1.76122 WP_000758418.1.76137 WP_000758418.1.76170 WP_000758418.1.76186 WP_000758418.1.76208 WP_000758418.1.76252 WP_000758418.1.76256 WP_000758418.1.7629 WP_000758418.1.76327 WP_000758418.1.76339 WP_000758418.1.7634 WP_000758418.1.76345 WP_000758418.1.76346 WP_000758418.1.76364 WP_000758418.1.76366 WP_000758418.1.76417 WP_000758418.1.76434 WP_000758418.1.76445 WP_000758418.1.76451 WP_000758418.1.7646 WP_000758418.1.76495 WP_000758418.1.76510 WP_000758418.1.76548 WP_000758418.1.76558 WP_000758418.1.7657 WP_000758418.1.76572 WP_000758418.1.76576 WP_000758418.1.7660 WP_000758418.1.76611 WP_000758418.1.76641 WP_000758418.1.76651 WP_000758418.1.76653 WP_000758418.1.76673 WP_000758418.1.76706 WP_000758418.1.7672 WP_000758418.1.76721 WP_000758418.1.76724 WP_000758418.1.76738 WP_000758418.1.76756 WP_000758418.1.76760 WP_000758418.1.76776 WP_000758418.1.76788 WP_000758418.1.76806 WP_000758418.1.76854 WP_000758418.1.76875 WP_000758418.1.76880 WP_000758418.1.76899 WP_000758418.1.76913 WP_000758418.1.76916 WP_000758418.1.76932 WP_000758418.1.76968 WP_000758418.1.76973 WP_000758418.1.76988 WP_000758418.1.77016 WP_000758418.1.77033 WP_000758418.1.77038 WP_000758418.1.77047 WP_000758418.1.77067 WP_000758418.1.77080 WP_000758418.1.77087 WP_000758418.1.77090 WP_000758418.1.77111 WP_000758418.1.7712 WP_000758418.1.77177 WP_000758418.1.77180 WP_000758418.1.77184 WP_000758418.1.77193 WP_000758418.1.77244 WP_000758418.1.77267 WP_000758418.1.77292 WP_000758418.1.77299 WP_000758418.1.77306 WP_000758418.1.77313 WP_000758418.1.77349 WP_000758418.1.77356 WP_000758418.1.77384 WP_000758418.1.77390 WP_000758418.1.77414 WP_000758418.1.77431 WP_000758418.1.77440 WP_000758418.1.77475 WP_000758418.1.77496 WP_000758418.1.77501 WP_000758418.1.77512 WP_000758418.1.77513 WP_000758418.1.77514 WP_000758418.1.77529 WP_000758418.1.77543 WP_000758418.1.77549 WP_000758418.1.77555 WP_000758418.1.77563 WP_000758418.1.77622 WP_000758418.1.77629 WP_000758418.1.77646 WP_000758418.1.77653 WP_000758418.1.77692 WP_000758418.1.77702 WP_000758418.1.77710 WP_000758418.1.77713 WP_000758418.1.7772 WP_000758418.1.77729 WP_000758418.1.77761 WP_000758418.1.7782 WP_000758418.1.77825 WP_000758418.1.77837 WP_000758418.1.77846 WP_000758418.1.77851 WP_000758418.1.77898 WP_000758418.1.77900 WP_000758418.1.77918 WP_000758418.1.7792 WP_000758418.1.77923 WP_000758418.1.7793 WP_000758418.1.77951 WP_000758418.1.77960 WP_000758418.1.77975 WP_000758418.1.77983 WP_000758418.1.77987 WP_000758418.1.77989 WP_000758418.1.78016 WP_000758418.1.7802 WP_000758418.1.78026 WP_000758418.1.78033 WP_000758418.1.78035 WP_000758418.1.78048 WP_000758418.1.78051 WP_000758418.1.78053 WP_000758418.1.78076 WP_000758418.1.78096 WP_000758418.1.78100 WP_000758418.1.78107 WP_000758418.1.78110 WP_000758418.1.78120 WP_000758418.1.78166 WP_000758418.1.78168 WP_000758418.1.78170 WP_000758418.1.78180 WP_000758418.1.78192 WP_000758418.1.78195 WP_000758418.1.78201 WP_000758418.1.78259 WP_000758418.1.78291 WP_000758418.1.78301 WP_000758418.1.78309 WP_000758418.1.78320 WP_000758418.1.78339 WP_000758418.1.78366 WP_000758418.1.78372 WP_000758418.1.78382 WP_000758418.1.78383 WP_000758418.1.78388 WP_000758418.1.78407 WP_000758418.1.78410 WP_000758418.1.78443 WP_000758418.1.78495 WP_000758418.1.78496 WP_000758418.1.78501 WP_000758418.1.78568 WP_000758418.1.78602 WP_000758418.1.78603 WP_000758418.1.7861 WP_000758418.1.78618 WP_000758418.1.7862 WP_000758418.1.78626 WP_000758418.1.78632 WP_000758418.1.78658 WP_000758418.1.78661 WP_000758418.1.78673 WP_000758418.1.78674 WP_000758418.1.78676 WP_000758418.1.78697 WP_000758418.1.78734 WP_000758418.1.78735 WP_000758418.1.78738 WP_000758418.1.78761 WP_000758418.1.7877 WP_000758418.1.78789 WP_000758418.1.78802 WP_000758418.1.78815 WP_000758418.1.78830 WP_000758418.1.78835 WP_000758418.1.78838 WP_000758418.1.78862 WP_000758418.1.78871 WP_000758418.1.78874 WP_000758418.1.78877 WP_000758418.1.78896 WP_000758418.1.789 WP_000758418.1.7891 WP_000758418.1.78913 WP_000758418.1.78918 WP_000758418.1.78928 WP_000758418.1.7893 WP_000758418.1.78930 WP_000758418.1.78951 WP_000758418.1.78993 WP_000758418.1.79012 WP_000758418.1.79069 WP_000758418.1.79074 WP_000758418.1.79081 WP_000758418.1.79098 WP_000758418.1.79099 WP_000758418.1.79151 WP_000758418.1.79155 WP_000758418.1.79164 WP_000758418.1.79167 WP_000758418.1.79189 WP_000758418.1.79204 WP_000758418.1.79235 WP_000758418.1.79280 WP_000758418.1.79289 WP_000758418.1.79297 WP_000758418.1.79335 WP_000758418.1.79370 WP_000758418.1.79397 WP_000758418.1.79456 WP_000758418.1.79462 WP_000758418.1.79468 WP_000758418.1.79472 WP_000758418.1.79490 WP_000758418.1.79495 WP_000758418.1.79529 WP_000758418.1.79532 WP_000758418.1.79547 WP_000758418.1.7956 WP_000758418.1.79570 WP_000758418.1.79580 WP_000758418.1.79586 WP_000758418.1.79635 WP_000758418.1.7964 WP_000758418.1.79642 WP_000758418.1.79645 WP_000758418.1.79654 WP_000758418.1.79659 WP_000758418.1.79668 WP_000758418.1.7970 WP_000758418.1.79708 WP_000758418.1.7972 WP_000758418.1.79722 WP_000758418.1.79734 WP_000758418.1.79757 WP_000758418.1.79772 WP_000758418.1.79778 WP_000758418.1.7979 WP_000758418.1.7982 WP_000758418.1.79832 WP_000758418.1.79842 WP_000758418.1.79845 WP_000758418.1.79880 WP_000758418.1.7991 WP_000758418.1.79916 WP_000758418.1.79929 WP_000758418.1.79945 WP_000758418.1.79951 WP_000758418.1.80065 WP_000758418.1.80077 WP_000758418.1.80103 WP_000758418.1.80137 WP_000758418.1.80149 WP_000758418.1.80157 WP_000758418.1.80182 WP_000758418.1.80229 WP_000758418.1.8024 WP_000758418.1.80249 WP_000758418.1.80250 WP_000758418.1.80254 WP_000758418.1.80273 WP_000758418.1.80282 WP_000758418.1.80293 WP_000758418.1.80296 WP_000758418.1.80354 WP_000758418.1.80366 WP_000758418.1.80368 WP_000758418.1.80380 WP_000758418.1.80386 WP_000758418.1.80400 WP_000758418.1.80441 WP_000758418.1.80443 WP_000758418.1.80462 WP_000758418.1.80480 WP_000758418.1.8049 WP_000758418.1.80492 WP_000758418.1.80496 WP_000758418.1.80529 WP_000758418.1.80542 WP_000758418.1.80569 WP_000758418.1.80586 WP_000758418.1.80609 WP_000758418.1.80629 WP_000758418.1.80638 WP_000758418.1.80651 WP_000758418.1.80664 WP_000758418.1.80696 WP_000758418.1.80705 WP_000758418.1.80707 WP_000758418.1.80723 WP_000758418.1.80741 WP_000758418.1.80760 WP_000758418.1.80780 WP_000758418.1.80819 WP_000758418.1.80827 WP_000758418.1.80831 WP_000758418.1.80840 WP_000758418.1.80850 WP_000758418.1.80857 WP_000758418.1.80874 WP_000758418.1.80876 WP_000758418.1.80881 WP_000758418.1.80927 WP_000758418.1.80939 WP_000758418.1.80959 WP_000758418.1.8096 WP_000758418.1.80973 WP_000758418.1.80984 WP_000758418.1.81037 WP_000758418.1.8106 WP_000758418.1.81067 WP_000758418.1.81069 WP_000758418.1.81110 WP_000758418.1.81118 WP_000758418.1.81131 WP_000758418.1.81149 WP_000758418.1.81175 WP_000758418.1.81187 WP_000758418.1.8119 WP_000758418.1.81193 WP_000758418.1.81197 WP_000758418.1.81225 WP_000758418.1.81231 WP_000758418.1.81262 WP_000758418.1.81268 WP_000758418.1.81269 WP_000758418.1.8127 WP_000758418.1.81271 WP_000758418.1.81275 WP_000758418.1.8130 WP_000758418.1.81302 WP_000758418.1.81305 WP_000758418.1.8131 WP_000758418.1.81320 WP_000758418.1.81328 WP_000758418.1.81333 WP_000758418.1.8134 WP_000758418.1.81342 WP_000758418.1.81354 WP_000758418.1.81364 WP_000758418.1.81388 WP_000758418.1.81409 WP_000758418.1.81410 WP_000758418.1.81425 WP_000758418.1.81455 WP_000758418.1.81472 WP_000758418.1.81494 WP_000758418.1.81504 WP_000758418.1.81528 WP_000758418.1.81548 WP_000758418.1.81557 WP_000758418.1.81667 WP_000758418.1.81668 WP_000758418.1.81676 WP_000758418.1.8168 WP_000758418.1.81681 WP_000758418.1.8170 WP_000758418.1.81727 WP_000758418.1.81735 WP_000758418.1.81746 WP_000758418.1.81750 WP_000758418.1.81760 WP_000758418.1.81763 WP_000758418.1.81768 WP_000758418.1.81785 WP_000758418.1.81795 WP_000758418.1.81855 WP_000758418.1.81902 WP_000758418.1.81921 WP_000758418.1.81931 WP_000758418.1.81936 WP_000758418.1.81949 WP_000758418.1.8196 WP_000758418.1.81974 WP_000758418.1.81977 WP_000758418.1.81995 WP_000758418.1.82070 WP_000758418.1.82076 WP_000758418.1.82099 WP_000758418.1.82131 WP_000758418.1.82132 WP_000758418.1.82141 WP_000758418.1.82144 WP_000758418.1.82149 WP_000758418.1.82156 WP_000758418.1.8218 WP_000758418.1.82180 WP_000758418.1.82192 WP_000758418.1.82201 WP_000758418.1.82214 WP_000758418.1.82225 WP_000758418.1.82232 WP_000758418.1.82258 WP_000758418.1.82269 WP_000758418.1.82337 WP_000758418.1.82347 WP_000758418.1.82352 WP_000758418.1.8236 WP_000758418.1.82369 WP_000758418.1.82395 WP_000758418.1.8240 WP_000758418.1.82401 WP_000758418.1.82408 WP_000758418.1.82416 WP_000758418.1.8242 WP_000758418.1.82420 WP_000758418.1.82434 WP_000758418.1.82456 WP_000758418.1.82464 WP_000758418.1.82465 WP_000758418.1.8247 WP_000758418.1.82473 WP_000758418.1.82474 WP_000758418.1.82479 WP_000758418.1.82503 WP_000758418.1.82515 WP_000758418.1.82530 WP_000758418.1.82553 WP_000758418.1.82569 WP_000758418.1.82570 WP_000758418.1.82636 WP_000758418.1.82637 WP_000758418.1.82646 WP_000758418.1.82648 WP_000758418.1.82670 WP_000758418.1.82676 WP_000758418.1.82731 WP_000758418.1.82761 WP_000758418.1.82812 WP_000758418.1.8282 WP_000758418.1.82841 WP_000758418.1.82850 WP_000758418.1.82872 WP_000758418.1.82886 WP_000758418.1.82895 WP_000758418.1.82899 WP_000758418.1.82908 WP_000758418.1.8294 WP_000758418.1.82944 WP_000758418.1.82946 WP_000758418.1.82956 WP_000758418.1.82959 WP_000758418.1.83005 WP_000758418.1.83006 WP_000758418.1.83007 WP_000758418.1.8304 WP_000758418.1.83061 WP_000758418.1.83092 WP_000758418.1.83139 WP_000758418.1.83163 WP_000758418.1.83180 WP_000758418.1.83204 WP_000758418.1.8322 WP_000758418.1.83221 WP_000758418.1.83229 WP_000758418.1.83235 WP_000758418.1.83247 WP_000758418.1.83252 WP_000758418.1.83290 WP_000758418.1.83305 WP_000758418.1.83331 WP_000758418.1.83333 WP_000758418.1.83354 WP_000758418.1.83356 WP_000758418.1.83360 WP_000758418.1.83365 WP_000758418.1.83378 WP_000758418.1.83382 WP_000758418.1.83388 WP_000758418.1.83407 WP_000758418.1.83413 WP_000758418.1.83491 WP_000758418.1.83523 WP_000758418.1.8354 WP_000758418.1.83558 WP_000758418.1.83572 WP_000758418.1.83598 WP_000758418.1.83632 WP_000758418.1.83650 WP_000758418.1.83651 WP_000758418.1.83657 WP_000758418.1.83677 WP_000758418.1.83721 WP_000758418.1.83739 WP_000758418.1.8375 WP_000758418.1.83759 WP_000758418.1.83760 WP_000758418.1.83854 WP_000758418.1.83923 WP_000758418.1.83979 WP_000758418.1.8399 WP_000758418.1.83994 WP_000758418.1.83995 WP_000758418.1.84 WP_000758418.1.84000 WP_000758418.1.84001 WP_000758418.1.84011 WP_000758418.1.84031 WP_000758418.1.8406 WP_000758418.1.84075 WP_000758418.1.84076 WP_000758418.1.84077 WP_000758418.1.84083 WP_000758418.1.84086 WP_000758418.1.84100 WP_000758418.1.84103 WP_000758418.1.84106 WP_000758418.1.84110 WP_000758418.1.84115 WP_000758418.1.84127 WP_000758418.1.84150 WP_000758418.1.84154 WP_000758418.1.84168 WP_000758418.1.84179 WP_000758418.1.84198 WP_000758418.1.84229 WP_000758418.1.84230 WP_000758418.1.8425 WP_000758418.1.84252 WP_000758418.1.84283 WP_000758418.1.84291 WP_000758418.1.84300 WP_000758418.1.8431 WP_000758418.1.84345 WP_000758418.1.84355 WP_000758418.1.84359 WP_000758418.1.84369 WP_000758418.1.84392 WP_000758418.1.84397 WP_000758418.1.84401 WP_000758418.1.84403 WP_000758418.1.8441 WP_000758418.1.84435 WP_000758418.1.84461 WP_000758418.1.84497 WP_000758418.1.84515 WP_000758418.1.84532 WP_000758418.1.84551 WP_000758418.1.84554 WP_000758418.1.84567 WP_000758418.1.84572 WP_000758418.1.84598 WP_000758418.1.84631 WP_000758418.1.84659 WP_000758418.1.84693 WP_000758418.1.84721 WP_000758418.1.84727 WP_000758418.1.84744 WP_000758418.1.84773 WP_000758418.1.84876 WP_000758418.1.84885 WP_000758418.1.84899 WP_000758418.1.849 WP_000758418.1.84945 WP_000758418.1.84967 WP_000758418.1.8497 WP_000758418.1.84983 WP_000758418.1.850 WP_000758418.1.85004 WP_000758418.1.8502 WP_000758418.1.85031 WP_000758418.1.85039 WP_000758418.1.85040 WP_000758418.1.85079 WP_000758418.1.85094 WP_000758418.1.85120 WP_000758418.1.85134 WP_000758418.1.85153 WP_000758418.1.85178 WP_000758418.1.85180 WP_000758418.1.85190 WP_000758418.1.85192 WP_000758418.1.8526 WP_000758418.1.85271 WP_000758418.1.85273 WP_000758418.1.85301 WP_000758418.1.8533 WP_000758418.1.85338 WP_000758418.1.85339 WP_000758418.1.85433 WP_000758418.1.8545 WP_000758418.1.85469 WP_000758418.1.85481 WP_000758418.1.85483 WP_000758418.1.85511 WP_000758418.1.85512 WP_000758418.1.8552 WP_000758418.1.85541 WP_000758418.1.8556 WP_000758418.1.85568 WP_000758418.1.8557 WP_000758418.1.85606 WP_000758418.1.85615 WP_000758418.1.85617 WP_000758418.1.85635 WP_000758418.1.85646 WP_000758418.1.85663 WP_000758418.1.85665 WP_000758418.1.85669 WP_000758418.1.85671 WP_000758418.1.85672 WP_000758418.1.85675 WP_000758418.1.85688 WP_000758418.1.85703 WP_000758418.1.85723 WP_000758418.1.85728 WP_000758418.1.85746 WP_000758418.1.85759 WP_000758418.1.85777 WP_000758418.1.85784 WP_000758418.1.85797 WP_000758418.1.85811 WP_000758418.1.85854 WP_000758418.1.85855 WP_000758418.1.85886 WP_000758418.1.859 WP_000758418.1.85900 WP_000758418.1.85904 WP_000758418.1.8591 WP_000758418.1.85917 WP_000758418.1.8594 WP_000758418.1.85943 WP_000758418.1.85976 WP_000758418.1.85977 WP_000758418.1.85982 WP_000758418.1.860 WP_000758418.1.86007 WP_000758418.1.86010 WP_000758418.1.86043 WP_000758418.1.8605 WP_000758418.1.86084 WP_000758418.1.86092 WP_000758418.1.8610 WP_000758418.1.86120 WP_000758418.1.86126 WP_000758418.1.86138 WP_000758418.1.8614 WP_000758418.1.86156 WP_000758418.1.86159 WP_000758418.1.8616 WP_000758418.1.86173 WP_000758418.1.86206 WP_000758418.1.86240 WP_000758418.1.86285 WP_000758418.1.86306 WP_000758418.1.86310 WP_000758418.1.86323 WP_000758418.1.86342 WP_000758418.1.86347 WP_000758418.1.86356 WP_000758418.1.86380 WP_000758418.1.8640 WP_000758418.1.8642 WP_000758418.1.86426 WP_000758418.1.86442 WP_000758418.1.86450 WP_000758418.1.86453 WP_000758418.1.86469 WP_000758418.1.8647 WP_000758418.1.86489 WP_000758418.1.86514 WP_000758418.1.86530 WP_000758418.1.86580 WP_000758418.1.86588 WP_000758418.1.86610 WP_000758418.1.86658 WP_000758418.1.86661 WP_000758418.1.86663 WP_000758418.1.86676 WP_000758418.1.86699 WP_000758418.1.8671 WP_000758418.1.8672 WP_000758418.1.86744 WP_000758418.1.86770 WP_000758418.1.8678 WP_000758418.1.86794 WP_000758418.1.86800 WP_000758418.1.86810 WP_000758418.1.86811 WP_000758418.1.86815 WP_000758418.1.8684 WP_000758418.1.86859 WP_000758418.1.86895 WP_000758418.1.86902 WP_000758418.1.86906 WP_000758418.1.86915 WP_000758418.1.86921 WP_000758418.1.86945 WP_000758418.1.86982 WP_000758418.1.86989 WP_000758418.1.87023 WP_000758418.1.87034 WP_000758418.1.87038 WP_000758418.1.87041 WP_000758418.1.87051 WP_000758418.1.87095 WP_000758418.1.87136 WP_000758418.1.87155 WP_000758418.1.87187 WP_000758418.1.87219 WP_000758418.1.87258 WP_000758418.1.87265 WP_000758418.1.87293 WP_000758418.1.87323 WP_000758418.1.87346 WP_000758418.1.8736 WP_000758418.1.87370 WP_000758418.1.87420 WP_000758418.1.87460 WP_000758418.1.87484 WP_000758418.1.87493 WP_000758418.1.87500 WP_000758418.1.87528 WP_000758418.1.87552 WP_000758418.1.87560 WP_000758418.1.87583 WP_000758418.1.87584 WP_000758418.1.8760 WP_000758418.1.87600 WP_000758418.1.87609 WP_000758418.1.87612 WP_000758418.1.87615 WP_000758418.1.87626 WP_000758418.1.87653 WP_000758418.1.87659 WP_000758418.1.8767 WP_000758418.1.87695 WP_000758418.1.87698 WP_000758418.1.87706 WP_000758418.1.87712 WP_000758418.1.87739 WP_000758418.1.87741 WP_000758418.1.87742 WP_000758418.1.87760 WP_000758418.1.87779 WP_000758418.1.87852 WP_000758418.1.87875 WP_000758418.1.87899 WP_000758418.1.87905 WP_000758418.1.8792 WP_000758418.1.87933 WP_000758418.1.87936 WP_000758418.1.87945 WP_000758418.1.87949 WP_000758418.1.87999 WP_000758418.1.8800 WP_000758418.1.88014 WP_000758418.1.88019 WP_000758418.1.88025 WP_000758418.1.88026 WP_000758418.1.8805 WP_000758418.1.88052 WP_000758418.1.8806 WP_000758418.1.88073 WP_000758418.1.8809 WP_000758418.1.88092 WP_000758418.1.881 WP_000758418.1.88136 WP_000758418.1.88145 WP_000758418.1.88174 WP_000758418.1.88185 WP_000758418.1.88199 WP_000758418.1.88222 WP_000758418.1.88244 WP_000758418.1.88275 WP_000758418.1.88291 WP_000758418.1.88293 WP_000758418.1.88299 WP_000758418.1.88303 WP_000758418.1.88313 WP_000758418.1.88356 WP_000758418.1.88359 WP_000758418.1.88393 WP_000758418.1.88407 WP_000758418.1.88414 WP_000758418.1.88423 WP_000758418.1.88444 WP_000758418.1.88446 WP_000758418.1.88458 WP_000758418.1.88474 WP_000758418.1.88501 WP_000758418.1.88508 WP_000758418.1.88538 WP_000758418.1.88547 WP_000758418.1.88597 WP_000758418.1.886 WP_000758418.1.88609 WP_000758418.1.88620 WP_000758418.1.88624 WP_000758418.1.88647 WP_000758418.1.88648 WP_000758418.1.88651 WP_000758418.1.88692 WP_000758418.1.88703 WP_000758418.1.88707 WP_000758418.1.88727 WP_000758418.1.88731 WP_000758418.1.88762 WP_000758418.1.88772 WP_000758418.1.88792 WP_000758418.1.88850 WP_000758418.1.88854 WP_000758418.1.8889 WP_000758418.1.88892 WP_000758418.1.88894 WP_000758418.1.88902 WP_000758418.1.8891 WP_000758418.1.88957 WP_000758418.1.88966 WP_000758418.1.88967 WP_000758418.1.88968 WP_000758418.1.88980 WP_000758418.1.88981 WP_000758418.1.88982 WP_000758418.1.88995 WP_000758418.1.88998 WP_000758418.1.89008 WP_000758418.1.89054 WP_000758418.1.89114 WP_000758418.1.89116 WP_000758418.1.89119 WP_000758418.1.89120 WP_000758418.1.89138 WP_000758418.1.89174 WP_000758418.1.89177 WP_000758418.1.89182 WP_000758418.1.89188 WP_000758418.1.89215 WP_000758418.1.89221 WP_000758418.1.89291 WP_000758418.1.89298 WP_000758418.1.89304 WP_000758418.1.89308 WP_000758418.1.89311 WP_000758418.1.89314 WP_000758418.1.89328 WP_000758418.1.89332 WP_000758418.1.89343 WP_000758418.1.89362 WP_000758418.1.89395 WP_000758418.1.8940 WP_000758418.1.89408 WP_000758418.1.89425 WP_000758418.1.89449 WP_000758418.1.8947 WP_000758418.1.89503 WP_000758418.1.89512 WP_000758418.1.89527 WP_000758418.1.89570 WP_000758418.1.8958 WP_000758418.1.89580 WP_000758418.1.89591 WP_000758418.1.89604 WP_000758418.1.89606 WP_000758418.1.8961 WP_000758418.1.89612 WP_000758418.1.89622 WP_000758418.1.89634 WP_000758418.1.89647 WP_000758418.1.89657 WP_000758418.1.89659 WP_000758418.1.89668 WP_000758418.1.89680 WP_000758418.1.89706 WP_000758418.1.89713 WP_000758418.1.89733 WP_000758418.1.89765 WP_000758418.1.89777 WP_000758418.1.89796 WP_000758418.1.89804 WP_000758418.1.89815 WP_000758418.1.89817 WP_000758418.1.89832 WP_000758418.1.89845 WP_000758418.1.89888 WP_000758418.1.89902 WP_000758418.1.89911 WP_000758418.1.89914 WP_000758418.1.89940 WP_000758418.1.8995 WP_000758418.1.89952 WP_000758418.1.8996 WP_000758418.1.89975 WP_000758418.1.90007 WP_000758418.1.9002 WP_000758418.1.9003 WP_000758418.1.90033 WP_000758418.1.90097 WP_000758418.1.9011 WP_000758418.1.90196 WP_000758418.1.90240 WP_000758418.1.90248 WP_000758418.1.90252 WP_000758418.1.90274 WP_000758418.1.90280 WP_000758418.1.90293 WP_000758418.1.90330 WP_000758418.1.90338 WP_000758418.1.90348 WP_000758418.1.90363 WP_000758418.1.90365 WP_000758418.1.90417 WP_000758418.1.90421 WP_000758418.1.90428 WP_000758418.1.90440 WP_000758418.1.90453 WP_000758418.1.90458 WP_000758418.1.90472 WP_000758418.1.90489 WP_000758418.1.90513 WP_000758418.1.90521 WP_000758418.1.90522 WP_000758418.1.90540 WP_000758418.1.90557 WP_000758418.1.90563 WP_000758418.1.90566 WP_000758418.1.90582 WP_000758418.1.90585 WP_000758418.1.90620 WP_000758418.1.90625 WP_000758418.1.9064 WP_000758418.1.90641 WP_000758418.1.90713 WP_000758418.1.90734 WP_000758418.1.90748 WP_000758418.1.90759 WP_000758418.1.90792 WP_000758418.1.90794 WP_000758418.1.90796 WP_000758418.1.90811 WP_000758418.1.90859 WP_000758418.1.90866 WP_000758418.1.90876 WP_000758418.1.90878 WP_000758418.1.9091 WP_000758418.1.90959 WP_000758418.1.90973 WP_000758418.1.90991 WP_000758418.1.91003 WP_000758418.1.91023 WP_000758418.1.91042 WP_000758418.1.91056 WP_000758418.1.91067 WP_000758418.1.91069 WP_000758418.1.91164 WP_000758418.1.91179 WP_000758418.1.91205 WP_000758418.1.91215 WP_000758418.1.91239 WP_000758418.1.91278 WP_000758418.1.91291 WP_000758418.1.9131 WP_000758418.1.91313 WP_000758418.1.9135 WP_000758418.1.9137 WP_000758418.1.91372 WP_000758418.1.91381 WP_000758418.1.91424 WP_000758418.1.91453 WP_000758418.1.91459 WP_000758418.1.91470 WP_000758418.1.91473 WP_000758418.1.91474 WP_000758418.1.91493 WP_000758418.1.91505 WP_000758418.1.91506 WP_000758418.1.91512 WP_000758418.1.91524 WP_000758418.1.91528 WP_000758418.1.91557 WP_000758418.1.91564 WP_000758418.1.91579 WP_000758418.1.91580 WP_000758418.1.91597 WP_000758418.1.91621 WP_000758418.1.91625 WP_000758418.1.91628 WP_000758418.1.91655 WP_000758418.1.91702 WP_000758418.1.91715 WP_000758418.1.91724 WP_000758418.1.91732 WP_000758418.1.91742 WP_000758418.1.91772 WP_000758418.1.91776 WP_000758418.1.91788 WP_000758418.1.91795 WP_000758418.1.91806 WP_000758418.1.9187 WP_000758418.1.91870 WP_000758418.1.91898 WP_000758418.1.91903 WP_000758418.1.91904 WP_000758418.1.91914 WP_000758418.1.91974 WP_000758418.1.92013 WP_000758418.1.92018 WP_000758418.1.92047 WP_000758418.1.92060 WP_000758418.1.92067 WP_000758418.1.92068 WP_000758418.1.92082 WP_000758418.1.92087 WP_000758418.1.92093 WP_000758418.1.92098 WP_000758418.1.92108 WP_000758418.1.92129 WP_000758418.1.92149 WP_000758418.1.92156 WP_000758418.1.92165 WP_000758418.1.92171 WP_000758418.1.92172 WP_000758418.1.92183 WP_000758418.1.92208 WP_000758418.1.92213 WP_000758418.1.9222 WP_000758418.1.92240 WP_000758418.1.92243 WP_000758418.1.92268 WP_000758418.1.92299 WP_000758418.1.92310 WP_000758418.1.92318 WP_000758418.1.92327 WP_000758418.1.92399 WP_000758418.1.92411 WP_000758418.1.92439 WP_000758418.1.92443 WP_000758418.1.92452 WP_000758418.1.92470 WP_000758418.1.92477 WP_000758418.1.92482 WP_000758418.1.9253 WP_000758418.1.92531 WP_000758418.1.92545 WP_000758418.1.92557 WP_000758418.1.92562 WP_000758418.1.92570 WP_000758418.1.92575 WP_000758418.1.92588 WP_000758418.1.926 WP_000758418.1.92628 WP_000758418.1.92633 WP_000758418.1.92649 WP_000758418.1.92659 WP_000758418.1.92669 WP_000758418.1.92671 WP_000758418.1.92676 WP_000758418.1.92705 WP_000758418.1.9271 WP_000758418.1.92729 WP_000758418.1.92734 WP_000758418.1.92738 WP_000758418.1.92754 WP_000758418.1.92806 WP_000758418.1.92810 WP_000758418.1.92823 WP_000758418.1.92836 WP_000758418.1.92879 WP_000758418.1.92883 WP_000758418.1.92890 WP_000758418.1.92893 WP_000758418.1.92926 WP_000758418.1.92929 WP_000758418.1.92939 WP_000758418.1.92975 WP_000758418.1.92987 WP_000758418.1.93007 WP_000758418.1.93022 WP_000758418.1.93059 WP_000758418.1.93061 WP_000758418.1.93076 WP_000758418.1.93086 WP_000758418.1.93101 WP_000758418.1.93103 WP_000758418.1.93105 WP_000758418.1.93111 WP_000758418.1.93121 WP_000758418.1.93136 WP_000758418.1.93155 WP_000758418.1.93168 WP_000758418.1.93184 WP_000758418.1.93213 WP_000758418.1.93215 WP_000758418.1.93221 WP_000758418.1.93223 WP_000758418.1.93239 WP_000758418.1.93275 WP_000758418.1.93302 WP_000758418.1.93339 WP_000758418.1.93350 WP_000758418.1.9336 WP_000758418.1.93365 WP_000758418.1.93376 WP_000758418.1.93387 WP_000758418.1.93410 WP_000758418.1.93469 WP_000758418.1.93511 WP_000758418.1.93512 WP_000758418.1.93524 WP_000758418.1.93543 WP_000758418.1.93577 WP_000758418.1.93596 WP_000758418.1.93604 WP_000758418.1.93635 WP_000758418.1.93648 WP_000758418.1.93650 WP_000758418.1.93656 WP_000758418.1.93657 WP_000758418.1.93662 WP_000758418.1.93671 WP_000758418.1.937 WP_000758418.1.93705 WP_000758418.1.9374 WP_000758418.1.93741 WP_000758418.1.9375 WP_000758418.1.93754 WP_000758418.1.93761 WP_000758418.1.93767 WP_000758418.1.93780 WP_000758418.1.9380 WP_000758418.1.93803 WP_000758418.1.93804 WP_000758418.1.93809 WP_000758418.1.93828 WP_000758418.1.93837 WP_000758418.1.93842 WP_000758418.1.93843 WP_000758418.1.93875 WP_000758418.1.9389 WP_000758418.1.93909 WP_000758418.1.93919 WP_000758418.1.93937 WP_000758418.1.93938 WP_000758418.1.93984 WP_000758418.1.93986 WP_000758418.1.9399 WP_000758418.1.93994 WP_000758418.1.94017 WP_000758418.1.94056 WP_000758418.1.94064 WP_000758418.1.94070 WP_000758418.1.94072 WP_000758418.1.94079 WP_000758418.1.94097 WP_000758418.1.94107 WP_000758418.1.94132 WP_000758418.1.94142 WP_000758418.1.94162 WP_000758418.1.94168 WP_000758418.1.94181 WP_000758418.1.94198 WP_000758418.1.94215 WP_000758418.1.94303 WP_000758418.1.9432 WP_000758418.1.94352 WP_000758418.1.94354 WP_000758418.1.94365 WP_000758418.1.94380 WP_000758418.1.94390 WP_000758418.1.9440 WP_000758418.1.94412 WP_000758418.1.94415 WP_000758418.1.94458 WP_000758418.1.94473 WP_000758418.1.94492 WP_000758418.1.94510 WP_000758418.1.94527 WP_000758418.1.94557 WP_000758418.1.94565 WP_000758418.1.94573 WP_000758418.1.94579 WP_000758418.1.94584 WP_000758418.1.94586 WP_000758418.1.94588 WP_000758418.1.94593 WP_000758418.1.94598 WP_000758418.1.9463 WP_000758418.1.94649 WP_000758418.1.94650 WP_000758418.1.94655 WP_000758418.1.94659 WP_000758418.1.94662 WP_000758418.1.94669 WP_000758418.1.94670 WP_000758418.1.94674 WP_000758418.1.94700 WP_000758418.1.94745 WP_000758418.1.94782 WP_000758418.1.94785 WP_000758418.1.94796 WP_000758418.1.94798 WP_000758418.1.94815 WP_000758418.1.94820 WP_000758418.1.94835 WP_000758418.1.94849 WP_000758418.1.94850 WP_000758418.1.94851 WP_000758418.1.94862 WP_000758418.1.94864 WP_000758418.1.94947 WP_000758418.1.94952 WP_000758418.1.94959 WP_000758418.1.94967 WP_000758418.1.94971 WP_000758418.1.94983 WP_000758418.1.94986 WP_000758418.1.94987 WP_000758418.1.95006 WP_000758418.1.9503 WP_000758418.1.95051 WP_000758418.1.95055 WP_000758418.1.95076 WP_000758418.1.95085 WP_000758418.1.95094 WP_000758418.1.95099 WP_000758418.1.95121 WP_000758418.1.95136 WP_000758418.1.95152 WP_000758418.1.9516 WP_000758418.1.95165 WP_000758418.1.95171 WP_000758418.1.95239 WP_000758418.1.95246 WP_000758418.1.95248 WP_000758418.1.95249 WP_000758418.1.9525 WP_000758418.1.95255 WP_000758418.1.95265 WP_000758418.1.9527 WP_000758418.1.95277 WP_000758418.1.95282 WP_000758418.1.9530 WP_000758418.1.95320 WP_000758418.1.95338 WP_000758418.1.95388 WP_000758418.1.95404 WP_000758418.1.95412 WP_000758418.1.95434 WP_000758418.1.95447 WP_000758418.1.95456 WP_000758418.1.95465 WP_000758418.1.95530 WP_000758418.1.95547 WP_000758418.1.95558 WP_000758418.1.95579 WP_000758418.1.95590 WP_000758418.1.95607 WP_000758418.1.95625 WP_000758418.1.95630 WP_000758418.1.95641 WP_000758418.1.95656 WP_000758418.1.95670 WP_000758418.1.95675 WP_000758418.1.95691 WP_000758418.1.95701 WP_000758418.1.95716 WP_000758418.1.95744 WP_000758418.1.95757 WP_000758418.1.95776 WP_000758418.1.95803 WP_000758418.1.95805 WP_000758418.1.95826 WP_000758418.1.9586 WP_000758418.1.95866 WP_000758418.1.95884 WP_000758418.1.95890 WP_000758418.1.95906 WP_000758418.1.95911 WP_000758418.1.95939 WP_000758418.1.95940 WP_000758418.1.95963 WP_000758418.1.96004 WP_000758418.1.96025 WP_000758418.1.96044 WP_000758418.1.96045 WP_000758418.1.96054 WP_000758418.1.96094 WP_000758418.1.96107 WP_000758418.1.96127 WP_000758418.1.96139 WP_000758418.1.96141 WP_000758418.1.96144 WP_000758418.1.96162 WP_000758418.1.96188 WP_000758418.1.96190 WP_000758418.1.96203 WP_000758418.1.96206 WP_000758418.1.96211 WP_000758418.1.96212 WP_000758418.1.9624 WP_000758418.1.9627 WP_000758418.1.96319 WP_000758418.1.9633 WP_000758418.1.96335 WP_000758418.1.96340 WP_000758418.1.96343 WP_000758418.1.96348 WP_000758418.1.96349 WP_000758418.1.96359 WP_000758418.1.96380 WP_000758418.1.96404 WP_000758418.1.96429 WP_000758418.1.9644 WP_000758418.1.96469 WP_000758418.1.96490 WP_000758418.1.96497 WP_000758418.1.96500 WP_000758418.1.96521 WP_000758418.1.96533 WP_000758418.1.96537 WP_000758418.1.96539 WP_000758418.1.96552 WP_000758418.1.96555 WP_000758418.1.96563 WP_000758418.1.96584 WP_000758418.1.96588 WP_000758418.1.96600 WP_000758418.1.96610 WP_000758418.1.96625 WP_000758418.1.96635 WP_000758418.1.9664 WP_000758418.1.96640 WP_000758418.1.96662 WP_000758418.1.96675 WP_000758418.1.9670 WP_000758418.1.96721 WP_000758418.1.96732 WP_000758418.1.96735 WP_000758418.1.9674 WP_000758418.1.96750 WP_000758418.1.96761 WP_000758418.1.96771 WP_000758418.1.96792 WP_000758418.1.96798 WP_000758418.1.96801 WP_000758418.1.96803 WP_000758418.1.96810 WP_000758418.1.96876 WP_000758418.1.96890 WP_000758418.1.96902 WP_000758418.1.96925 WP_000758418.1.96938 WP_000758418.1.96946 WP_000758418.1.96957 WP_000758418.1.96978 WP_000758418.1.96993 WP_000758418.1.97005 WP_000758418.1.97015 WP_000758418.1.97026 WP_000758418.1.97028 WP_000758418.1.97047 WP_000758418.1.97089 WP_000758418.1.97103 WP_000758418.1.97143 WP_000758418.1.97145 WP_000758418.1.97154 WP_000758418.1.97184 WP_000758418.1.97185 WP_000758418.1.97190 WP_000758418.1.97224 WP_000758418.1.97260 WP_000758418.1.97287 WP_000758418.1.97291 WP_000758418.1.97297 WP_000758418.1.97318 WP_000758418.1.97322 WP_000758418.1.97328 WP_000758418.1.97337 WP_000758418.1.97368 WP_000758418.1.97369 WP_000758418.1.97386 WP_000758418.1.97413 WP_000758418.1.97422 WP_000758418.1.97441 WP_000758418.1.97477 WP_000758418.1.97487 WP_000758418.1.97496 WP_000758418.1.97497 WP_000758418.1.97505 WP_000758418.1.97547 WP_000758418.1.97594 WP_000758418.1.97597 WP_000758418.1.97599 WP_000758418.1.97604 WP_000758418.1.97606 WP_000758418.1.97613 WP_000758418.1.97615 WP_000758418.1.97620 WP_000758418.1.97626 WP_000758418.1.97628 WP_000758418.1.97631 WP_000758418.1.97646 WP_000758418.1.97648 WP_000758418.1.97656 WP_000758418.1.97690 WP_000758418.1.97691 WP_000758418.1.97693 WP_000758418.1.97704 WP_000758418.1.97725 WP_000758418.1.97727 WP_000758418.1.97732 WP_000758418.1.97736 WP_000758418.1.9774 WP_000758418.1.9775 WP_000758418.1.97768 WP_000758418.1.97772 WP_000758418.1.97819 WP_000758418.1.97840 WP_000758418.1.97846 WP_000758418.1.97873 WP_000758418.1.9793 WP_000758418.1.97938 WP_000758418.1.97981 WP_000758418.1.97986 WP_000758418.1.9799 WP_000758418.1.97991 WP_000758418.1.98006 WP_000758418.1.98019 WP_000758418.1.98022 WP_000758418.1.98036 WP_000758418.1.9805 WP_000758418.1.98080 WP_000758418.1.98086 WP_000758418.1.98107 WP_000758418.1.9811 WP_000758418.1.98110 WP_000758418.1.98119 WP_000758418.1.98146 WP_000758418.1.98158 WP_000758418.1.98170 WP_000758418.1.98219 WP_000758418.1.98236 WP_000758418.1.98250 WP_000758418.1.9826 WP_000758418.1.98263 WP_000758418.1.98314 WP_000758418.1.98338 WP_000758418.1.98392 WP_000758418.1.98402 WP_000758418.1.9841 WP_000758418.1.98418 WP_000758418.1.98440 WP_000758418.1.98446 WP_000758418.1.98448 WP_000758418.1.98457 WP_000758418.1.98472 WP_000758418.1.98483 WP_000758418.1.98495 WP_000758418.1.9850 WP_000758418.1.98502 WP_000758418.1.98513 WP_000758418.1.98531 WP_000758418.1.98570 WP_000758418.1.98577 WP_000758418.1.98607 WP_000758418.1.98608 WP_000758418.1.98627 WP_000758418.1.98676 WP_000758418.1.98677 WP_000758418.1.98726 WP_000758418.1.98731 WP_000758418.1.98760 WP_000758418.1.98762 WP_000758418.1.98763 WP_000758418.1.9877 WP_000758418.1.98779 WP_000758418.1.98801 WP_000758418.1.98818 WP_000758418.1.98843 WP_000758418.1.98899 WP_000758418.1.98931 WP_000758418.1.9898 WP_000758418.1.9899 WP_000758418.1.99057 WP_000758418.1.99071 WP_000758418.1.99072 WP_000758418.1.99097 WP_000758418.1.99098 WP_000758418.1.99107 WP_000758418.1.99163 WP_000758418.1.99184 WP_000758418.1.9919 WP_000758418.1.99197 WP_000758418.1.99198 WP_000758418.1.99215 WP_000758418.1.99219 WP_000758418.1.99255 WP_000758418.1.99267 WP_000758418.1.99276 WP_000758418.1.99327 WP_000758418.1.99335 WP_000758418.1.99339 WP_000758418.1.99350 WP_000758418.1.99360 WP_000758418.1.99363 WP_000758418.1.99369 WP_000758418.1.99370 WP_000758418.1.99388 WP_000758418.1.99397 WP_000758418.1.99456 WP_000758418.1.99463 WP_000758418.1.99483 WP_000758418.1.99490 WP_000758418.1.99493 WP_000758418.1.9954 WP_000758418.1.99546 WP_000758418.1.99577 WP_000758418.1.99579 WP_000758418.1.99595 WP_000758418.1.99613 WP_000758418.1.99626 WP_000758418.1.99630 WP_000758418.1.99637 WP_000758418.1.99646 WP_000758418.1.99657 WP_000758418.1.99660 WP_000758418.1.99671 WP_000758418.1.99676 WP_000758418.1.99712 WP_000758418.1.99725 WP_000758418.1.99764 WP_000758418.1.99783 WP_000758418.1.99813 WP_000758418.1.99824 WP_000758418.1.99829 WP_000758418.1.99837 WP_000758418.1.99841 WP_000758418.1.99858 WP_000758418.1.99889 WP_000758418.1.9992 WP_000758418.1.99924 WP_000758418.1.99958 WP_000758418.1.99961 WP_000758418.1.99996 gi|482903630|ref|YP_007902190.1| gi|198244166|ref|YP_002215322.1| ABAK02000001|CDS_1247927-1246242 ABAM02000001|CDS_2376824-2375139 ABAN01000035|CDS_28041-29726 ABAO01000022|CDS_64660-62975 ABEI01000029|CDS_28074-29759 ABEJ01000013|CDS_115709-114024 ABEL01000002|CDS_503468-501783 ABFF01000008|CDS_65250-63565 ABFG01000001|CDS_415804-417489 ABFH02000002|CDS_176899-178584 AE006468|CDS_1916907-1915222 AE014613|CDS_1142624-1144309 AL513382|CDS_1838508-1836823 AM933172|CDS_1298876-1300561 CP000886|CDS_1202775-1204460 CP001113|CDS_1915272-1913587 CP001120|CDS_1964712-1963027 CP001127|CDS_1894915-1893230 CP001144|CDS_1450800-1452485 CP001363|CDS_1928309-1926624 FN424405|CDS_1910134-1908449 gi|378445224|ref|YP_005232856.1| gi|378959216|ref|YP_005216702.1| gi|550901173|ref|YP_008670265.1| gi|207856675|ref|YP_002243326.1| gi|194447353|ref|YP_002045864.1| gi|488653593|ref|YP_007925396.1| gi|16760708|ref|NP_456325.1| gi|378989159|ref|YP_005252323.1| gi|528819617|ref|YP_008360820.1| gi|378984380|ref|YP_005247535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]