SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450478|ref|YP_005237837.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450478|ref|YP_005237837.1|
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.57e-33
Family DnaQ-like 3'-5' exonuclease 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450478|ref|YP_005237837.1|
Sequence length 232
Comment exodeoxyribonuclease X [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MLRIIDTETCGLQGGIVEIASVDVIDGNIVNPMSHLIRPDRPITPQAMAIHRITEAMVAD
KPWIEDVIPLYYGSEWYVAHNASFDRRVLPELPGEWICTMKLSRRLWPGIKYSNMALYKS
RKLSVQTPPGLHHHRALYDCYITAALLIDIMRTTGWTAEEMVNITGRPALLTTFPFGKYR
GKAVSEVAKRDPGYLRWLFNNLDNMSPELRLTLKHYLEDVQAGEQRSNGTPQ
Download sequence
Identical sequences A0A0F6B2K2 A0A0F7J767 A0A0H3NDV6 A0A0K6RFQ6 A0A0T9Y479 A0A0U1IMK6 A0A0W4KFV0 A0A1X2UP74 A0A221YLS3 A0A221YZ57 A0A249UXR8 A0A267SI25 A0A271CUJ8 A0A2D1XDF7 A0A2D3ACS1 A0A2D3TV81 A0A2H9YCC7 A0A2K2ZXV3 C0Q2H3 E8X9E5 G4C217 Q57NC2 Q7CQC9 Q8XFN9 V1W7W4 V7UI74
gi|16765220|ref|NP_460835.1| gi|378984443|ref|YP_005247598.1| gi|488653536|ref|YP_007925339.1| gi|16760829|ref|NP_456446.1| NP_456446.1.84458 NP_460835.1.58477 WP_000944282.1.100002 WP_000944282.1.100007 WP_000944282.1.100008 WP_000944282.1.100010 WP_000944282.1.100036 WP_000944282.1.100079 WP_000944282.1.100115 WP_000944282.1.100196 WP_000944282.1.1002 WP_000944282.1.100234 WP_000944282.1.100258 WP_000944282.1.100266 WP_000944282.1.100284 WP_000944282.1.100288 WP_000944282.1.100313 WP_000944282.1.100314 WP_000944282.1.100321 WP_000944282.1.100354 WP_000944282.1.100376 WP_000944282.1.100421 WP_000944282.1.100424 WP_000944282.1.100432 WP_000944282.1.100436 WP_000944282.1.100438 WP_000944282.1.100446 WP_000944282.1.100450 WP_000944282.1.100472 WP_000944282.1.100484 WP_000944282.1.100488 WP_000944282.1.100589 WP_000944282.1.100592 WP_000944282.1.100597 WP_000944282.1.100610 WP_000944282.1.10065 WP_000944282.1.100732 WP_000944282.1.100733 WP_000944282.1.100739 WP_000944282.1.10074 WP_000944282.1.10076 WP_000944282.1.100764 WP_000944282.1.100781 WP_000944282.1.100793 WP_000944282.1.100799 WP_000944282.1.100869 WP_000944282.1.100870 WP_000944282.1.100871 WP_000944282.1.100882 WP_000944282.1.100941 WP_000944282.1.100944 WP_000944282.1.100953 WP_000944282.1.101007 WP_000944282.1.101011 WP_000944282.1.101020 WP_000944282.1.101074 WP_000944282.1.101078 WP_000944282.1.10108 WP_000944282.1.101094 WP_000944282.1.101126 WP_000944282.1.101180 WP_000944282.1.101185 WP_000944282.1.101199 WP_000944282.1.101226 WP_000944282.1.10124 WP_000944282.1.101259 WP_000944282.1.101271 WP_000944282.1.101284 WP_000944282.1.101291 WP_000944282.1.101312 WP_000944282.1.101320 WP_000944282.1.101322 WP_000944282.1.101353 WP_000944282.1.101374 WP_000944282.1.101386 WP_000944282.1.101404 WP_000944282.1.101420 WP_000944282.1.101454 WP_000944282.1.101473 WP_000944282.1.101519 WP_000944282.1.101520 WP_000944282.1.101589 WP_000944282.1.101609 WP_000944282.1.101612 WP_000944282.1.101616 WP_000944282.1.101636 WP_000944282.1.101639 WP_000944282.1.101707 WP_000944282.1.101724 WP_000944282.1.101734 WP_000944282.1.101741 WP_000944282.1.101815 WP_000944282.1.101839 WP_000944282.1.101878 WP_000944282.1.101890 WP_000944282.1.101941 WP_000944282.1.101949 WP_000944282.1.101953 WP_000944282.1.101975 WP_000944282.1.102009 WP_000944282.1.102050 WP_000944282.1.102087 WP_000944282.1.102103 WP_000944282.1.10220 WP_000944282.1.10266 WP_000944282.1.10276 WP_000944282.1.10338 WP_000944282.1.1038 WP_000944282.1.104 WP_000944282.1.10401 WP_000944282.1.10428 WP_000944282.1.10429 WP_000944282.1.10439 WP_000944282.1.10459 WP_000944282.1.10475 WP_000944282.1.10511 WP_000944282.1.10514 WP_000944282.1.10530 WP_000944282.1.10532 WP_000944282.1.10547 WP_000944282.1.10595 WP_000944282.1.10642 WP_000944282.1.10654 WP_000944282.1.10677 WP_000944282.1.10678 WP_000944282.1.10711 WP_000944282.1.10720 WP_000944282.1.10753 WP_000944282.1.10857 WP_000944282.1.10873 WP_000944282.1.10926 WP_000944282.1.10936 WP_000944282.1.10992 WP_000944282.1.11000 WP_000944282.1.11012 WP_000944282.1.11024 WP_000944282.1.11031 WP_000944282.1.11055 WP_000944282.1.11098 WP_000944282.1.11126 WP_000944282.1.11142 WP_000944282.1.11168 WP_000944282.1.11190 WP_000944282.1.11213 WP_000944282.1.11239 WP_000944282.1.11253 WP_000944282.1.11254 WP_000944282.1.11295 WP_000944282.1.11314 WP_000944282.1.1135 WP_000944282.1.1137 WP_000944282.1.11385 WP_000944282.1.1142 WP_000944282.1.11426 WP_000944282.1.11429 WP_000944282.1.11455 WP_000944282.1.11458 WP_000944282.1.11518 WP_000944282.1.11532 WP_000944282.1.11543 WP_000944282.1.11557 WP_000944282.1.11565 WP_000944282.1.11567 WP_000944282.1.11638 WP_000944282.1.11763 WP_000944282.1.11772 WP_000944282.1.11875 WP_000944282.1.11883 WP_000944282.1.11897 WP_000944282.1.11908 WP_000944282.1.11914 WP_000944282.1.11936 WP_000944282.1.11964 WP_000944282.1.12025 WP_000944282.1.12040 WP_000944282.1.12047 WP_000944282.1.12061 WP_000944282.1.1207 WP_000944282.1.12114 WP_000944282.1.12141 WP_000944282.1.12159 WP_000944282.1.12172 WP_000944282.1.12192 WP_000944282.1.1224 WP_000944282.1.12244 WP_000944282.1.12280 WP_000944282.1.12351 WP_000944282.1.12364 WP_000944282.1.12370 WP_000944282.1.12396 WP_000944282.1.12397 WP_000944282.1.12398 WP_000944282.1.12441 WP_000944282.1.12456 WP_000944282.1.12472 WP_000944282.1.12484 WP_000944282.1.1250 WP_000944282.1.12546 WP_000944282.1.12581 WP_000944282.1.12584 WP_000944282.1.1264 WP_000944282.1.12648 WP_000944282.1.12683 WP_000944282.1.12701 WP_000944282.1.12718 WP_000944282.1.12726 WP_000944282.1.12727 WP_000944282.1.12728 WP_000944282.1.12741 WP_000944282.1.12834 WP_000944282.1.12864 WP_000944282.1.12879 WP_000944282.1.12936 WP_000944282.1.12995 WP_000944282.1.13027 WP_000944282.1.13101 WP_000944282.1.13106 WP_000944282.1.13108 WP_000944282.1.13130 WP_000944282.1.13161 WP_000944282.1.1321 WP_000944282.1.13268 WP_000944282.1.13291 WP_000944282.1.133 WP_000944282.1.13314 WP_000944282.1.13334 WP_000944282.1.13338 WP_000944282.1.13342 WP_000944282.1.13352 WP_000944282.1.13406 WP_000944282.1.13414 WP_000944282.1.13440 WP_000944282.1.13443 WP_000944282.1.13446 WP_000944282.1.13476 WP_000944282.1.13488 WP_000944282.1.13509 WP_000944282.1.13543 WP_000944282.1.13599 WP_000944282.1.13669 WP_000944282.1.13686 WP_000944282.1.1372 WP_000944282.1.13732 WP_000944282.1.13741 WP_000944282.1.13750 WP_000944282.1.13764 WP_000944282.1.1382 WP_000944282.1.13848 WP_000944282.1.13857 WP_000944282.1.1387 WP_000944282.1.13908 WP_000944282.1.13932 WP_000944282.1.13968 WP_000944282.1.1397 WP_000944282.1.13972 WP_000944282.1.140 WP_000944282.1.14001 WP_000944282.1.1401 WP_000944282.1.14050 WP_000944282.1.14056 WP_000944282.1.1408 WP_000944282.1.14089 WP_000944282.1.14099 WP_000944282.1.14120 WP_000944282.1.14123 WP_000944282.1.14150 WP_000944282.1.14151 WP_000944282.1.14191 WP_000944282.1.14197 WP_000944282.1.14212 WP_000944282.1.14239 WP_000944282.1.14280 WP_000944282.1.14286 WP_000944282.1.14320 WP_000944282.1.14333 WP_000944282.1.14369 WP_000944282.1.14379 WP_000944282.1.14399 WP_000944282.1.14406 WP_000944282.1.14410 WP_000944282.1.14444 WP_000944282.1.14446 WP_000944282.1.14466 WP_000944282.1.14467 WP_000944282.1.14474 WP_000944282.1.14495 WP_000944282.1.14500 WP_000944282.1.14516 WP_000944282.1.14519 WP_000944282.1.14524 WP_000944282.1.14526 WP_000944282.1.14550 WP_000944282.1.14554 WP_000944282.1.14575 WP_000944282.1.14701 WP_000944282.1.14703 WP_000944282.1.14719 WP_000944282.1.14725 WP_000944282.1.1473 WP_000944282.1.14765 WP_000944282.1.14789 WP_000944282.1.14810 WP_000944282.1.14852 WP_000944282.1.14876 WP_000944282.1.14877 WP_000944282.1.14884 WP_000944282.1.1489 WP_000944282.1.14894 WP_000944282.1.14917 WP_000944282.1.14930 WP_000944282.1.14932 WP_000944282.1.14936 WP_000944282.1.14947 WP_000944282.1.14948 WP_000944282.1.14964 WP_000944282.1.15055 WP_000944282.1.15059 WP_000944282.1.15079 WP_000944282.1.15100 WP_000944282.1.15102 WP_000944282.1.15124 WP_000944282.1.15184 WP_000944282.1.15223 WP_000944282.1.15226 WP_000944282.1.15244 WP_000944282.1.15265 WP_000944282.1.15316 WP_000944282.1.15362 WP_000944282.1.15369 WP_000944282.1.1540 WP_000944282.1.15415 WP_000944282.1.15423 WP_000944282.1.15433 WP_000944282.1.15439 WP_000944282.1.15468 WP_000944282.1.15487 WP_000944282.1.15508 WP_000944282.1.1551 WP_000944282.1.15535 WP_000944282.1.15581 WP_000944282.1.15586 WP_000944282.1.15597 WP_000944282.1.15627 WP_000944282.1.15637 WP_000944282.1.15710 WP_000944282.1.15717 WP_000944282.1.15784 WP_000944282.1.15830 WP_000944282.1.15835 WP_000944282.1.15905 WP_000944282.1.15909 WP_000944282.1.15912 WP_000944282.1.1592 WP_000944282.1.15922 WP_000944282.1.15970 WP_000944282.1.15995 WP_000944282.1.16000 WP_000944282.1.16006 WP_000944282.1.1601 WP_000944282.1.16028 WP_000944282.1.16046 WP_000944282.1.16051 WP_000944282.1.16058 WP_000944282.1.16062 WP_000944282.1.16063 WP_000944282.1.16103 WP_000944282.1.1611 WP_000944282.1.16150 WP_000944282.1.16155 WP_000944282.1.16172 WP_000944282.1.16226 WP_000944282.1.16233 WP_000944282.1.1626 WP_000944282.1.16264 WP_000944282.1.16273 WP_000944282.1.16284 WP_000944282.1.16328 WP_000944282.1.16344 WP_000944282.1.1635 WP_000944282.1.16452 WP_000944282.1.16461 WP_000944282.1.16462 WP_000944282.1.16465 WP_000944282.1.16468 WP_000944282.1.16508 WP_000944282.1.16522 WP_000944282.1.16551 WP_000944282.1.16581 WP_000944282.1.16588 WP_000944282.1.16614 WP_000944282.1.16650 WP_000944282.1.16658 WP_000944282.1.16666 WP_000944282.1.16673 WP_000944282.1.1668 WP_000944282.1.16686 WP_000944282.1.16691 WP_000944282.1.167 WP_000944282.1.16732 WP_000944282.1.16735 WP_000944282.1.16736 WP_000944282.1.1674 WP_000944282.1.16767 WP_000944282.1.16781 WP_000944282.1.16786 WP_000944282.1.16819 WP_000944282.1.16846 WP_000944282.1.16855 WP_000944282.1.16858 WP_000944282.1.16879 WP_000944282.1.16893 WP_000944282.1.16896 WP_000944282.1.16905 WP_000944282.1.16910 WP_000944282.1.16916 WP_000944282.1.16942 WP_000944282.1.16948 WP_000944282.1.16965 WP_000944282.1.16998 WP_000944282.1.1700 WP_000944282.1.17049 WP_000944282.1.17058 WP_000944282.1.17078 WP_000944282.1.17202 WP_000944282.1.17219 WP_000944282.1.1722 WP_000944282.1.17302 WP_000944282.1.17307 WP_000944282.1.17308 WP_000944282.1.17368 WP_000944282.1.17390 WP_000944282.1.174 WP_000944282.1.17405 WP_000944282.1.17406 WP_000944282.1.17480 WP_000944282.1.1749 WP_000944282.1.17513 WP_000944282.1.17543 WP_000944282.1.17546 WP_000944282.1.17563 WP_000944282.1.1757 WP_000944282.1.17578 WP_000944282.1.17622 WP_000944282.1.17659 WP_000944282.1.17667 WP_000944282.1.17686 WP_000944282.1.17693 WP_000944282.1.17702 WP_000944282.1.17703 WP_000944282.1.17705 WP_000944282.1.17741 WP_000944282.1.17747 WP_000944282.1.17758 WP_000944282.1.17840 WP_000944282.1.17956 WP_000944282.1.18005 WP_000944282.1.1801 WP_000944282.1.18019 WP_000944282.1.18021 WP_000944282.1.18089 WP_000944282.1.18099 WP_000944282.1.18111 WP_000944282.1.18124 WP_000944282.1.18144 WP_000944282.1.18163 WP_000944282.1.18173 WP_000944282.1.18177 WP_000944282.1.18178 WP_000944282.1.18192 WP_000944282.1.1825 WP_000944282.1.18265 WP_000944282.1.18267 WP_000944282.1.18270 WP_000944282.1.18280 WP_000944282.1.18282 WP_000944282.1.18328 WP_000944282.1.18358 WP_000944282.1.18370 WP_000944282.1.18406 WP_000944282.1.18426 WP_000944282.1.18468 WP_000944282.1.18474 WP_000944282.1.18485 WP_000944282.1.18513 WP_000944282.1.18607 WP_000944282.1.18610 WP_000944282.1.18678 WP_000944282.1.18705 WP_000944282.1.18715 WP_000944282.1.18722 WP_000944282.1.18766 WP_000944282.1.18776 WP_000944282.1.1880 WP_000944282.1.18822 WP_000944282.1.1885 WP_000944282.1.18860 WP_000944282.1.18881 WP_000944282.1.18922 WP_000944282.1.18940 WP_000944282.1.18949 WP_000944282.1.18959 WP_000944282.1.19001 WP_000944282.1.19006 WP_000944282.1.19030 WP_000944282.1.19038 WP_000944282.1.19044 WP_000944282.1.19053 WP_000944282.1.19084 WP_000944282.1.19187 WP_000944282.1.19228 WP_000944282.1.19288 WP_000944282.1.19291 WP_000944282.1.19300 WP_000944282.1.19320 WP_000944282.1.19357 WP_000944282.1.1939 WP_000944282.1.19422 WP_000944282.1.19454 WP_000944282.1.19456 WP_000944282.1.19458 WP_000944282.1.19460 WP_000944282.1.19461 WP_000944282.1.19496 WP_000944282.1.19535 WP_000944282.1.19538 WP_000944282.1.19589 WP_000944282.1.19614 WP_000944282.1.19642 WP_000944282.1.19660 WP_000944282.1.19663 WP_000944282.1.1968 WP_000944282.1.19683 WP_000944282.1.19686 WP_000944282.1.19702 WP_000944282.1.19706 WP_000944282.1.19724 WP_000944282.1.19731 WP_000944282.1.19740 WP_000944282.1.19749 WP_000944282.1.19784 WP_000944282.1.19794 WP_000944282.1.19802 WP_000944282.1.19809 WP_000944282.1.19851 WP_000944282.1.19867 WP_000944282.1.1990 WP_000944282.1.1992 WP_000944282.1.1998 WP_000944282.1.19999 WP_000944282.1.20 WP_000944282.1.20023 WP_000944282.1.20034 WP_000944282.1.20089 WP_000944282.1.2010 WP_000944282.1.20119 WP_000944282.1.20212 WP_000944282.1.20218 WP_000944282.1.20254 WP_000944282.1.20255 WP_000944282.1.20271 WP_000944282.1.20296 WP_000944282.1.20330 WP_000944282.1.20339 WP_000944282.1.2036 WP_000944282.1.20362 WP_000944282.1.20376 WP_000944282.1.20415 WP_000944282.1.20418 WP_000944282.1.20419 WP_000944282.1.20443 WP_000944282.1.20465 WP_000944282.1.20488 WP_000944282.1.20492 WP_000944282.1.20503 WP_000944282.1.20525 WP_000944282.1.2053 WP_000944282.1.2054 WP_000944282.1.20553 WP_000944282.1.20626 WP_000944282.1.20635 WP_000944282.1.20646 WP_000944282.1.20718 WP_000944282.1.20721 WP_000944282.1.2073 WP_000944282.1.20740 WP_000944282.1.20828 WP_000944282.1.20862 WP_000944282.1.2087 WP_000944282.1.20883 WP_000944282.1.20886 WP_000944282.1.20900 WP_000944282.1.20908 WP_000944282.1.20947 WP_000944282.1.20953 WP_000944282.1.21010 WP_000944282.1.21049 WP_000944282.1.2106 WP_000944282.1.21062 WP_000944282.1.21089 WP_000944282.1.21144 WP_000944282.1.21146 WP_000944282.1.21162 WP_000944282.1.21184 WP_000944282.1.21185 WP_000944282.1.21245 WP_000944282.1.21246 WP_000944282.1.21269 WP_000944282.1.21286 WP_000944282.1.21366 WP_000944282.1.21399 WP_000944282.1.21400 WP_000944282.1.21404 WP_000944282.1.21443 WP_000944282.1.21453 WP_000944282.1.2146 WP_000944282.1.21492 WP_000944282.1.21497 WP_000944282.1.21499 WP_000944282.1.21548 WP_000944282.1.21603 WP_000944282.1.2166 WP_000944282.1.21674 WP_000944282.1.21692 WP_000944282.1.21751 WP_000944282.1.21757 WP_000944282.1.21825 WP_000944282.1.21845 WP_000944282.1.21886 WP_000944282.1.21910 WP_000944282.1.21940 WP_000944282.1.21946 WP_000944282.1.21966 WP_000944282.1.21981 WP_000944282.1.22019 WP_000944282.1.22024 WP_000944282.1.2205 WP_000944282.1.22062 WP_000944282.1.22064 WP_000944282.1.22067 WP_000944282.1.22117 WP_000944282.1.22118 WP_000944282.1.22126 WP_000944282.1.2216 WP_000944282.1.22205 WP_000944282.1.22208 WP_000944282.1.2221 WP_000944282.1.2224 WP_000944282.1.2227 WP_000944282.1.22270 WP_000944282.1.22323 WP_000944282.1.22337 WP_000944282.1.2235 WP_000944282.1.22373 WP_000944282.1.22379 WP_000944282.1.22427 WP_000944282.1.2246 WP_000944282.1.22476 WP_000944282.1.22485 WP_000944282.1.22537 WP_000944282.1.22565 WP_000944282.1.22582 WP_000944282.1.22614 WP_000944282.1.22620 WP_000944282.1.22652 WP_000944282.1.22676 WP_000944282.1.22683 WP_000944282.1.2284 WP_000944282.1.22845 WP_000944282.1.22870 WP_000944282.1.22895 WP_000944282.1.22926 WP_000944282.1.22943 WP_000944282.1.22967 WP_000944282.1.22979 WP_000944282.1.23040 WP_000944282.1.23058 WP_000944282.1.23102 WP_000944282.1.23114 WP_000944282.1.2314 WP_000944282.1.23148 WP_000944282.1.23169 WP_000944282.1.23175 WP_000944282.1.23192 WP_000944282.1.23218 WP_000944282.1.23259 WP_000944282.1.23274 WP_000944282.1.23279 WP_000944282.1.2331 WP_000944282.1.23311 WP_000944282.1.2332 WP_000944282.1.23340 WP_000944282.1.23343 WP_000944282.1.2336 WP_000944282.1.23365 WP_000944282.1.23412 WP_000944282.1.23426 WP_000944282.1.23460 WP_000944282.1.23466 WP_000944282.1.23472 WP_000944282.1.23482 WP_000944282.1.23492 WP_000944282.1.23500 WP_000944282.1.23503 WP_000944282.1.23513 WP_000944282.1.23515 WP_000944282.1.23529 WP_000944282.1.23548 WP_000944282.1.23571 WP_000944282.1.23604 WP_000944282.1.23634 WP_000944282.1.23639 WP_000944282.1.2364 WP_000944282.1.23643 WP_000944282.1.23646 WP_000944282.1.23679 WP_000944282.1.23685 WP_000944282.1.237 WP_000944282.1.23707 WP_000944282.1.23720 WP_000944282.1.23728 WP_000944282.1.2375 WP_000944282.1.23755 WP_000944282.1.2376 WP_000944282.1.23783 WP_000944282.1.23786 WP_000944282.1.23787 WP_000944282.1.2380 WP_000944282.1.23801 WP_000944282.1.23932 WP_000944282.1.24017 WP_000944282.1.24028 WP_000944282.1.24061 WP_000944282.1.24083 WP_000944282.1.24117 WP_000944282.1.24125 WP_000944282.1.24138 WP_000944282.1.24153 WP_000944282.1.24163 WP_000944282.1.24206 WP_000944282.1.24259 WP_000944282.1.24291 WP_000944282.1.24308 WP_000944282.1.24322 WP_000944282.1.24325 WP_000944282.1.24355 WP_000944282.1.24375 WP_000944282.1.24376 WP_000944282.1.24392 WP_000944282.1.24400 WP_000944282.1.24420 WP_000944282.1.24433 WP_000944282.1.24555 WP_000944282.1.24578 WP_000944282.1.24619 WP_000944282.1.24643 WP_000944282.1.24686 WP_000944282.1.24688 WP_000944282.1.24689 WP_000944282.1.24716 WP_000944282.1.24737 WP_000944282.1.24779 WP_000944282.1.2481 WP_000944282.1.24832 WP_000944282.1.24839 WP_000944282.1.24964 WP_000944282.1.24995 WP_000944282.1.25008 WP_000944282.1.25015 WP_000944282.1.25017 WP_000944282.1.25032 WP_000944282.1.25036 WP_000944282.1.25041 WP_000944282.1.25053 WP_000944282.1.25064 WP_000944282.1.25130 WP_000944282.1.25140 WP_000944282.1.25185 WP_000944282.1.25196 WP_000944282.1.25206 WP_000944282.1.25210 WP_000944282.1.25219 WP_000944282.1.2525 WP_000944282.1.25304 WP_000944282.1.25374 WP_000944282.1.25405 WP_000944282.1.25454 WP_000944282.1.25475 WP_000944282.1.25490 WP_000944282.1.25493 WP_000944282.1.25508 WP_000944282.1.25512 WP_000944282.1.25603 WP_000944282.1.2562 WP_000944282.1.25666 WP_000944282.1.25668 WP_000944282.1.25690 WP_000944282.1.2570 WP_000944282.1.25700 WP_000944282.1.25722 WP_000944282.1.25740 WP_000944282.1.25793 WP_000944282.1.25807 WP_000944282.1.2581 WP_000944282.1.25814 WP_000944282.1.25821 WP_000944282.1.25825 WP_000944282.1.25833 WP_000944282.1.25835 WP_000944282.1.25882 WP_000944282.1.25911 WP_000944282.1.25928 WP_000944282.1.25962 WP_000944282.1.25963 WP_000944282.1.25988 WP_000944282.1.26001 WP_000944282.1.26027 WP_000944282.1.26030 WP_000944282.1.26034 WP_000944282.1.26107 WP_000944282.1.26123 WP_000944282.1.2615 WP_000944282.1.26199 WP_000944282.1.26217 WP_000944282.1.26230 WP_000944282.1.26232 WP_000944282.1.26272 WP_000944282.1.26282 WP_000944282.1.26288 WP_000944282.1.26311 WP_000944282.1.26319 WP_000944282.1.2634 WP_000944282.1.26384 WP_000944282.1.26394 WP_000944282.1.26429 WP_000944282.1.26440 WP_000944282.1.26491 WP_000944282.1.26493 WP_000944282.1.26512 WP_000944282.1.2654 WP_000944282.1.26551 WP_000944282.1.26554 WP_000944282.1.26567 WP_000944282.1.2660 WP_000944282.1.26636 WP_000944282.1.26689 WP_000944282.1.26787 WP_000944282.1.2679 WP_000944282.1.26856 WP_000944282.1.26882 WP_000944282.1.26892 WP_000944282.1.26908 WP_000944282.1.2692 WP_000944282.1.26928 WP_000944282.1.26980 WP_000944282.1.270 WP_000944282.1.27008 WP_000944282.1.27010 WP_000944282.1.27027 WP_000944282.1.27051 WP_000944282.1.27070 WP_000944282.1.27072 WP_000944282.1.27077 WP_000944282.1.27086 WP_000944282.1.27087 WP_000944282.1.27111 WP_000944282.1.27115 WP_000944282.1.2713 WP_000944282.1.2717 WP_000944282.1.27173 WP_000944282.1.27206 WP_000944282.1.27228 WP_000944282.1.27255 WP_000944282.1.27279 WP_000944282.1.27282 WP_000944282.1.27285 WP_000944282.1.27309 WP_000944282.1.27329 WP_000944282.1.27342 WP_000944282.1.27361 WP_000944282.1.27423 WP_000944282.1.27452 WP_000944282.1.27513 WP_000944282.1.27523 WP_000944282.1.27535 WP_000944282.1.27556 WP_000944282.1.27561 WP_000944282.1.27565 WP_000944282.1.27595 WP_000944282.1.27598 WP_000944282.1.27616 WP_000944282.1.2763 WP_000944282.1.27665 WP_000944282.1.27706 WP_000944282.1.27707 WP_000944282.1.27713 WP_000944282.1.27761 WP_000944282.1.2777 WP_000944282.1.27775 WP_000944282.1.27776 WP_000944282.1.27785 WP_000944282.1.27798 WP_000944282.1.27857 WP_000944282.1.27900 WP_000944282.1.27928 WP_000944282.1.27945 WP_000944282.1.27969 WP_000944282.1.27977 WP_000944282.1.27997 WP_000944282.1.28004 WP_000944282.1.28073 WP_000944282.1.2809 WP_000944282.1.28094 WP_000944282.1.28126 WP_000944282.1.28155 WP_000944282.1.28170 WP_000944282.1.28198 WP_000944282.1.2822 WP_000944282.1.28229 WP_000944282.1.28235 WP_000944282.1.2825 WP_000944282.1.28267 WP_000944282.1.28301 WP_000944282.1.28302 WP_000944282.1.2835 WP_000944282.1.28370 WP_000944282.1.28384 WP_000944282.1.28386 WP_000944282.1.28393 WP_000944282.1.28395 WP_000944282.1.284 WP_000944282.1.2845 WP_000944282.1.28479 WP_000944282.1.28514 WP_000944282.1.28538 WP_000944282.1.28575 WP_000944282.1.28625 WP_000944282.1.28627 WP_000944282.1.28655 WP_000944282.1.28673 WP_000944282.1.28692 WP_000944282.1.28694 WP_000944282.1.2873 WP_000944282.1.28775 WP_000944282.1.28776 WP_000944282.1.2879 WP_000944282.1.2890 WP_000944282.1.28902 WP_000944282.1.28917 WP_000944282.1.28938 WP_000944282.1.28946 WP_000944282.1.28948 WP_000944282.1.28962 WP_000944282.1.29006 WP_000944282.1.29010 WP_000944282.1.29023 WP_000944282.1.29042 WP_000944282.1.2905 WP_000944282.1.2907 WP_000944282.1.29081 WP_000944282.1.29089 WP_000944282.1.29099 WP_000944282.1.2910 WP_000944282.1.29130 WP_000944282.1.29153 WP_000944282.1.29203 WP_000944282.1.29237 WP_000944282.1.29248 WP_000944282.1.29255 WP_000944282.1.29288 WP_000944282.1.29349 WP_000944282.1.29389 WP_000944282.1.29439 WP_000944282.1.29454 WP_000944282.1.2946 WP_000944282.1.29462 WP_000944282.1.29563 WP_000944282.1.29588 WP_000944282.1.29601 WP_000944282.1.29606 WP_000944282.1.29615 WP_000944282.1.29619 WP_000944282.1.29704 WP_000944282.1.29727 WP_000944282.1.29743 WP_000944282.1.29774 WP_000944282.1.29782 WP_000944282.1.29833 WP_000944282.1.2984 WP_000944282.1.29845 WP_000944282.1.29851 WP_000944282.1.29865 WP_000944282.1.29886 WP_000944282.1.29898 WP_000944282.1.29919 WP_000944282.1.29923 WP_000944282.1.2994 WP_000944282.1.29964 WP_000944282.1.29969 WP_000944282.1.29983 WP_000944282.1.30006 WP_000944282.1.30009 WP_000944282.1.30013 WP_000944282.1.30018 WP_000944282.1.3002 WP_000944282.1.30027 WP_000944282.1.30034 WP_000944282.1.30049 WP_000944282.1.30058 WP_000944282.1.30093 WP_000944282.1.30170 WP_000944282.1.30172 WP_000944282.1.30179 WP_000944282.1.30180 WP_000944282.1.30185 WP_000944282.1.30354 WP_000944282.1.30357 WP_000944282.1.30362 WP_000944282.1.30386 WP_000944282.1.3042 WP_000944282.1.30421 WP_000944282.1.30425 WP_000944282.1.30440 WP_000944282.1.30448 WP_000944282.1.30469 WP_000944282.1.30489 WP_000944282.1.30505 WP_000944282.1.30507 WP_000944282.1.30517 WP_000944282.1.30535 WP_000944282.1.30542 WP_000944282.1.30544 WP_000944282.1.30547 WP_000944282.1.30556 WP_000944282.1.30572 WP_000944282.1.30573 WP_000944282.1.30585 WP_000944282.1.30618 WP_000944282.1.30664 WP_000944282.1.3068 WP_000944282.1.30688 WP_000944282.1.30794 WP_000944282.1.3080 WP_000944282.1.30806 WP_000944282.1.30819 WP_000944282.1.30823 WP_000944282.1.30833 WP_000944282.1.30835 WP_000944282.1.30967 WP_000944282.1.30972 WP_000944282.1.31 WP_000944282.1.31001 WP_000944282.1.31011 WP_000944282.1.31046 WP_000944282.1.31066 WP_000944282.1.31078 WP_000944282.1.31086 WP_000944282.1.31107 WP_000944282.1.3113 WP_000944282.1.31139 WP_000944282.1.3114 WP_000944282.1.31145 WP_000944282.1.31182 WP_000944282.1.31185 WP_000944282.1.3119 WP_000944282.1.31190 WP_000944282.1.31195 WP_000944282.1.31196 WP_000944282.1.31198 WP_000944282.1.31205 WP_000944282.1.3121 WP_000944282.1.31219 WP_000944282.1.31222 WP_000944282.1.31223 WP_000944282.1.31251 WP_000944282.1.31281 WP_000944282.1.31303 WP_000944282.1.3131 WP_000944282.1.31352 WP_000944282.1.31362 WP_000944282.1.31389 WP_000944282.1.31413 WP_000944282.1.31446 WP_000944282.1.31504 WP_000944282.1.31515 WP_000944282.1.31533 WP_000944282.1.31578 WP_000944282.1.31658 WP_000944282.1.31665 WP_000944282.1.3170 WP_000944282.1.31720 WP_000944282.1.31725 WP_000944282.1.31762 WP_000944282.1.31799 WP_000944282.1.31836 WP_000944282.1.31845 WP_000944282.1.31854 WP_000944282.1.31927 WP_000944282.1.31940 WP_000944282.1.31951 WP_000944282.1.31952 WP_000944282.1.31967 WP_000944282.1.31972 WP_000944282.1.32006 WP_000944282.1.32041 WP_000944282.1.32042 WP_000944282.1.32056 WP_000944282.1.3207 WP_000944282.1.32170 WP_000944282.1.32189 WP_000944282.1.32192 WP_000944282.1.32202 WP_000944282.1.32206 WP_000944282.1.32263 WP_000944282.1.32293 WP_000944282.1.32299 WP_000944282.1.32368 WP_000944282.1.32408 WP_000944282.1.32422 WP_000944282.1.32423 WP_000944282.1.32424 WP_000944282.1.32425 WP_000944282.1.32434 WP_000944282.1.32438 WP_000944282.1.32458 WP_000944282.1.32460 WP_000944282.1.32491 WP_000944282.1.32493 WP_000944282.1.32515 WP_000944282.1.32527 WP_000944282.1.32529 WP_000944282.1.32545 WP_000944282.1.32563 WP_000944282.1.32578 WP_000944282.1.32617 WP_000944282.1.32624 WP_000944282.1.32660 WP_000944282.1.3270 WP_000944282.1.32702 WP_000944282.1.32714 WP_000944282.1.32725 WP_000944282.1.32747 WP_000944282.1.32786 WP_000944282.1.32804 WP_000944282.1.32838 WP_000944282.1.32848 WP_000944282.1.32860 WP_000944282.1.32868 WP_000944282.1.3290 WP_000944282.1.32902 WP_000944282.1.32907 WP_000944282.1.32930 WP_000944282.1.32940 WP_000944282.1.32941 WP_000944282.1.3296 WP_000944282.1.32961 WP_000944282.1.32966 WP_000944282.1.32985 WP_000944282.1.33030 WP_000944282.1.33037 WP_000944282.1.3305 WP_000944282.1.33051 WP_000944282.1.33065 WP_000944282.1.33078 WP_000944282.1.33106 WP_000944282.1.33122 WP_000944282.1.33127 WP_000944282.1.33143 WP_000944282.1.3315 WP_000944282.1.33208 WP_000944282.1.33214 WP_000944282.1.33247 WP_000944282.1.33248 WP_000944282.1.33261 WP_000944282.1.33280 WP_000944282.1.33283 WP_000944282.1.333 WP_000944282.1.33313 WP_000944282.1.33339 WP_000944282.1.33382 WP_000944282.1.33486 WP_000944282.1.33490 WP_000944282.1.33492 WP_000944282.1.33501 WP_000944282.1.33529 WP_000944282.1.33553 WP_000944282.1.33592 WP_000944282.1.33609 WP_000944282.1.33629 WP_000944282.1.33659 WP_000944282.1.33689 WP_000944282.1.33693 WP_000944282.1.3370 WP_000944282.1.33730 WP_000944282.1.33741 WP_000944282.1.33840 WP_000944282.1.33894 WP_000944282.1.3392 WP_000944282.1.33926 WP_000944282.1.3395 WP_000944282.1.33957 WP_000944282.1.33969 WP_000944282.1.33986 WP_000944282.1.34001 WP_000944282.1.34043 WP_000944282.1.34059 WP_000944282.1.34075 WP_000944282.1.34118 WP_000944282.1.34126 WP_000944282.1.34211 WP_000944282.1.34214 WP_000944282.1.34234 WP_000944282.1.34257 WP_000944282.1.34279 WP_000944282.1.34284 WP_000944282.1.34304 WP_000944282.1.34319 WP_000944282.1.34376 WP_000944282.1.34382 WP_000944282.1.34453 WP_000944282.1.34458 WP_000944282.1.34484 WP_000944282.1.34496 WP_000944282.1.34517 WP_000944282.1.34530 WP_000944282.1.34610 WP_000944282.1.34659 WP_000944282.1.34665 WP_000944282.1.34667 WP_000944282.1.34694 WP_000944282.1.34703 WP_000944282.1.34707 WP_000944282.1.34751 WP_000944282.1.34801 WP_000944282.1.34808 WP_000944282.1.34824 WP_000944282.1.34834 WP_000944282.1.34854 WP_000944282.1.34856 WP_000944282.1.3489 WP_000944282.1.34932 WP_000944282.1.34962 WP_000944282.1.34972 WP_000944282.1.34975 WP_000944282.1.34977 WP_000944282.1.35001 WP_000944282.1.35040 WP_000944282.1.35045 WP_000944282.1.35074 WP_000944282.1.35129 WP_000944282.1.35175 WP_000944282.1.35184 WP_000944282.1.35240 WP_000944282.1.35274 WP_000944282.1.35404 WP_000944282.1.35408 WP_000944282.1.35425 WP_000944282.1.35429 WP_000944282.1.35446 WP_000944282.1.35463 WP_000944282.1.35503 WP_000944282.1.35509 WP_000944282.1.35532 WP_000944282.1.35560 WP_000944282.1.3557 WP_000944282.1.35590 WP_000944282.1.35628 WP_000944282.1.35648 WP_000944282.1.3570 WP_000944282.1.35712 WP_000944282.1.35713 WP_000944282.1.35736 WP_000944282.1.35777 WP_000944282.1.35791 WP_000944282.1.35795 WP_000944282.1.35868 WP_000944282.1.35870 WP_000944282.1.35916 WP_000944282.1.35938 WP_000944282.1.35940 WP_000944282.1.35966 WP_000944282.1.36000 WP_000944282.1.36003 WP_000944282.1.3601 WP_000944282.1.36034 WP_000944282.1.36036 WP_000944282.1.36069 WP_000944282.1.36172 WP_000944282.1.36286 WP_000944282.1.36291 WP_000944282.1.36298 WP_000944282.1.36308 WP_000944282.1.36323 WP_000944282.1.36343 WP_000944282.1.36460 WP_000944282.1.3649 WP_000944282.1.36495 WP_000944282.1.36526 WP_000944282.1.36542 WP_000944282.1.36567 WP_000944282.1.36579 WP_000944282.1.36609 WP_000944282.1.36617 WP_000944282.1.36643 WP_000944282.1.36663 WP_000944282.1.36690 WP_000944282.1.3670 WP_000944282.1.36701 WP_000944282.1.36705 WP_000944282.1.36725 WP_000944282.1.36751 WP_000944282.1.36779 WP_000944282.1.36798 WP_000944282.1.36802 WP_000944282.1.36821 WP_000944282.1.36839 WP_000944282.1.36853 WP_000944282.1.36899 WP_000944282.1.36918 WP_000944282.1.36931 WP_000944282.1.36948 WP_000944282.1.36949 WP_000944282.1.36950 WP_000944282.1.36978 WP_000944282.1.37013 WP_000944282.1.37014 WP_000944282.1.37063 WP_000944282.1.37073 WP_000944282.1.37111 WP_000944282.1.37112 WP_000944282.1.37133 WP_000944282.1.37176 WP_000944282.1.37199 WP_000944282.1.37200 WP_000944282.1.37256 WP_000944282.1.37258 WP_000944282.1.37267 WP_000944282.1.37293 WP_000944282.1.37303 WP_000944282.1.37320 WP_000944282.1.37370 WP_000944282.1.37376 WP_000944282.1.3744 WP_000944282.1.37478 WP_000944282.1.37498 WP_000944282.1.37504 WP_000944282.1.3751 WP_000944282.1.37513 WP_000944282.1.37521 WP_000944282.1.37584 WP_000944282.1.37590 WP_000944282.1.37593 WP_000944282.1.37600 WP_000944282.1.37610 WP_000944282.1.37613 WP_000944282.1.37618 WP_000944282.1.37659 WP_000944282.1.37662 WP_000944282.1.37675 WP_000944282.1.37687 WP_000944282.1.37691 WP_000944282.1.37761 WP_000944282.1.37775 WP_000944282.1.37777 WP_000944282.1.378 WP_000944282.1.379 WP_000944282.1.37911 WP_000944282.1.37941 WP_000944282.1.37968 WP_000944282.1.37978 WP_000944282.1.37985 WP_000944282.1.38001 WP_000944282.1.38061 WP_000944282.1.38064 WP_000944282.1.38108 WP_000944282.1.38125 WP_000944282.1.38145 WP_000944282.1.3816 WP_000944282.1.38207 WP_000944282.1.38261 WP_000944282.1.38266 WP_000944282.1.38273 WP_000944282.1.383 WP_000944282.1.38310 WP_000944282.1.38322 WP_000944282.1.3834 WP_000944282.1.38349 WP_000944282.1.38351 WP_000944282.1.3838 WP_000944282.1.38381 WP_000944282.1.38440 WP_000944282.1.3848 WP_000944282.1.38486 WP_000944282.1.38512 WP_000944282.1.38515 WP_000944282.1.38595 WP_000944282.1.3860 WP_000944282.1.38613 WP_000944282.1.38622 WP_000944282.1.38642 WP_000944282.1.38673 WP_000944282.1.3869 WP_000944282.1.38693 WP_000944282.1.38734 WP_000944282.1.38740 WP_000944282.1.38773 WP_000944282.1.38830 WP_000944282.1.38877 WP_000944282.1.38881 WP_000944282.1.38882 WP_000944282.1.38895 WP_000944282.1.38913 WP_000944282.1.38983 WP_000944282.1.38996 WP_000944282.1.39003 WP_000944282.1.39038 WP_000944282.1.39056 WP_000944282.1.3907 WP_000944282.1.39105 WP_000944282.1.39113 WP_000944282.1.39128 WP_000944282.1.39136 WP_000944282.1.3914 WP_000944282.1.39140 WP_000944282.1.39147 WP_000944282.1.39161 WP_000944282.1.39197 WP_000944282.1.39210 WP_000944282.1.39229 WP_000944282.1.39235 WP_000944282.1.39275 WP_000944282.1.3931 WP_000944282.1.39385 WP_000944282.1.39405 WP_000944282.1.39420 WP_000944282.1.39435 WP_000944282.1.39449 WP_000944282.1.39471 WP_000944282.1.39497 WP_000944282.1.39502 WP_000944282.1.39512 WP_000944282.1.39530 WP_000944282.1.39553 WP_000944282.1.39556 WP_000944282.1.39609 WP_000944282.1.39619 WP_000944282.1.39620 WP_000944282.1.39624 WP_000944282.1.39629 WP_000944282.1.39632 WP_000944282.1.39659 WP_000944282.1.39667 WP_000944282.1.39763 WP_000944282.1.39775 WP_000944282.1.39808 WP_000944282.1.39862 WP_000944282.1.39879 WP_000944282.1.39890 WP_000944282.1.39921 WP_000944282.1.39923 WP_000944282.1.39941 WP_000944282.1.39945 WP_000944282.1.39947 WP_000944282.1.40017 WP_000944282.1.40025 WP_000944282.1.40072 WP_000944282.1.40073 WP_000944282.1.40095 WP_000944282.1.40097 WP_000944282.1.401 WP_000944282.1.4011 WP_000944282.1.40111 WP_000944282.1.40160 WP_000944282.1.40167 WP_000944282.1.40170 WP_000944282.1.40208 WP_000944282.1.40229 WP_000944282.1.40240 WP_000944282.1.40257 WP_000944282.1.40258 WP_000944282.1.40279 WP_000944282.1.40292 WP_000944282.1.40305 WP_000944282.1.40311 WP_000944282.1.40361 WP_000944282.1.40380 WP_000944282.1.40395 WP_000944282.1.4042 WP_000944282.1.40465 WP_000944282.1.40467 WP_000944282.1.40492 WP_000944282.1.40496 WP_000944282.1.40508 WP_000944282.1.40517 WP_000944282.1.40698 WP_000944282.1.40710 WP_000944282.1.40722 WP_000944282.1.4075 WP_000944282.1.40750 WP_000944282.1.40763 WP_000944282.1.40771 WP_000944282.1.40854 WP_000944282.1.4087 WP_000944282.1.40877 WP_000944282.1.4089 WP_000944282.1.40924 WP_000944282.1.40932 WP_000944282.1.40946 WP_000944282.1.40979 WP_000944282.1.41004 WP_000944282.1.41048 WP_000944282.1.41050 WP_000944282.1.4106 WP_000944282.1.41070 WP_000944282.1.41074 WP_000944282.1.41075 WP_000944282.1.41086 WP_000944282.1.41091 WP_000944282.1.41097 WP_000944282.1.41132 WP_000944282.1.41176 WP_000944282.1.41226 WP_000944282.1.41251 WP_000944282.1.41258 WP_000944282.1.41279 WP_000944282.1.41299 WP_000944282.1.41305 WP_000944282.1.41310 WP_000944282.1.41321 WP_000944282.1.41333 WP_000944282.1.41335 WP_000944282.1.41345 WP_000944282.1.4136 WP_000944282.1.41415 WP_000944282.1.41438 WP_000944282.1.41440 WP_000944282.1.41459 WP_000944282.1.41498 WP_000944282.1.41516 WP_000944282.1.41519 WP_000944282.1.41524 WP_000944282.1.41554 WP_000944282.1.41572 WP_000944282.1.41591 WP_000944282.1.41631 WP_000944282.1.41658 WP_000944282.1.41659 WP_000944282.1.41662 WP_000944282.1.41708 WP_000944282.1.41716 WP_000944282.1.41746 WP_000944282.1.41761 WP_000944282.1.4178 WP_000944282.1.41789 WP_000944282.1.41824 WP_000944282.1.41825 WP_000944282.1.41836 WP_000944282.1.41859 WP_000944282.1.41862 WP_000944282.1.41877 WP_000944282.1.41882 WP_000944282.1.41894 WP_000944282.1.41904 WP_000944282.1.41919 WP_000944282.1.41929 WP_000944282.1.41931 WP_000944282.1.41938 WP_000944282.1.4194 WP_000944282.1.41979 WP_000944282.1.41998 WP_000944282.1.42009 WP_000944282.1.42069 WP_000944282.1.42081 WP_000944282.1.42090 WP_000944282.1.42104 WP_000944282.1.42109 WP_000944282.1.42111 WP_000944282.1.42187 WP_000944282.1.42200 WP_000944282.1.42219 WP_000944282.1.42238 WP_000944282.1.42244 WP_000944282.1.42257 WP_000944282.1.42261 WP_000944282.1.42276 WP_000944282.1.42320 WP_000944282.1.42328 WP_000944282.1.42342 WP_000944282.1.42349 WP_000944282.1.42364 WP_000944282.1.42371 WP_000944282.1.42379 WP_000944282.1.42391 WP_000944282.1.42399 WP_000944282.1.42404 WP_000944282.1.42422 WP_000944282.1.42433 WP_000944282.1.42489 WP_000944282.1.42491 WP_000944282.1.42539 WP_000944282.1.42603 WP_000944282.1.42650 WP_000944282.1.42655 WP_000944282.1.4267 WP_000944282.1.42685 WP_000944282.1.42701 WP_000944282.1.42707 WP_000944282.1.4276 WP_000944282.1.42794 WP_000944282.1.42805 WP_000944282.1.42815 WP_000944282.1.42859 WP_000944282.1.42864 WP_000944282.1.4288 WP_000944282.1.42957 WP_000944282.1.4298 WP_000944282.1.42981 WP_000944282.1.43008 WP_000944282.1.43016 WP_000944282.1.43018 WP_000944282.1.43019 WP_000944282.1.43041 WP_000944282.1.43065 WP_000944282.1.43068 WP_000944282.1.43069 WP_000944282.1.43128 WP_000944282.1.43141 WP_000944282.1.43149 WP_000944282.1.43157 WP_000944282.1.43161 WP_000944282.1.43190 WP_000944282.1.43198 WP_000944282.1.43244 WP_000944282.1.4326 WP_000944282.1.43276 WP_000944282.1.43290 WP_000944282.1.43292 WP_000944282.1.43299 WP_000944282.1.43307 WP_000944282.1.43312 WP_000944282.1.43334 WP_000944282.1.43351 WP_000944282.1.43437 WP_000944282.1.43438 WP_000944282.1.43441 WP_000944282.1.43513 WP_000944282.1.43520 WP_000944282.1.43522 WP_000944282.1.43606 WP_000944282.1.43613 WP_000944282.1.43633 WP_000944282.1.43637 WP_000944282.1.43651 WP_000944282.1.43668 WP_000944282.1.43710 WP_000944282.1.43722 WP_000944282.1.4373 WP_000944282.1.43801 WP_000944282.1.43812 WP_000944282.1.43839 WP_000944282.1.43873 WP_000944282.1.43878 WP_000944282.1.43886 WP_000944282.1.43888 WP_000944282.1.43919 WP_000944282.1.43974 WP_000944282.1.44043 WP_000944282.1.44049 WP_000944282.1.44099 WP_000944282.1.44101 WP_000944282.1.44113 WP_000944282.1.44121 WP_000944282.1.44160 WP_000944282.1.44180 WP_000944282.1.44191 WP_000944282.1.44196 WP_000944282.1.44248 WP_000944282.1.44262 WP_000944282.1.44268 WP_000944282.1.4427 WP_000944282.1.44291 WP_000944282.1.44296 WP_000944282.1.44310 WP_000944282.1.44343 WP_000944282.1.44351 WP_000944282.1.44360 WP_000944282.1.44416 WP_000944282.1.44431 WP_000944282.1.44437 WP_000944282.1.44479 WP_000944282.1.44546 WP_000944282.1.44593 WP_000944282.1.44607 WP_000944282.1.44640 WP_000944282.1.4467 WP_000944282.1.4468 WP_000944282.1.44702 WP_000944282.1.44747 WP_000944282.1.44762 WP_000944282.1.44815 WP_000944282.1.44828 WP_000944282.1.4485 WP_000944282.1.44877 WP_000944282.1.44879 WP_000944282.1.449 WP_000944282.1.44917 WP_000944282.1.44927 WP_000944282.1.44943 WP_000944282.1.44971 WP_000944282.1.44998 WP_000944282.1.4501 WP_000944282.1.45027 WP_000944282.1.45045 WP_000944282.1.45067 WP_000944282.1.45072 WP_000944282.1.45074 WP_000944282.1.45079 WP_000944282.1.45093 WP_000944282.1.45098 WP_000944282.1.45136 WP_000944282.1.45177 WP_000944282.1.45184 WP_000944282.1.45229 WP_000944282.1.45241 WP_000944282.1.45259 WP_000944282.1.45322 WP_000944282.1.45344 WP_000944282.1.45349 WP_000944282.1.45365 WP_000944282.1.4540 WP_000944282.1.45435 WP_000944282.1.45462 WP_000944282.1.45523 WP_000944282.1.45550 WP_000944282.1.45585 WP_000944282.1.45596 WP_000944282.1.45648 WP_000944282.1.45660 WP_000944282.1.45690 WP_000944282.1.45781 WP_000944282.1.45797 WP_000944282.1.458 WP_000944282.1.45829 WP_000944282.1.45871 WP_000944282.1.46011 WP_000944282.1.46028 WP_000944282.1.46030 WP_000944282.1.46069 WP_000944282.1.46077 WP_000944282.1.46112 WP_000944282.1.46169 WP_000944282.1.46173 WP_000944282.1.46174 WP_000944282.1.46187 WP_000944282.1.46205 WP_000944282.1.46225 WP_000944282.1.46241 WP_000944282.1.46243 WP_000944282.1.46286 WP_000944282.1.46299 WP_000944282.1.46303 WP_000944282.1.46307 WP_000944282.1.46323 WP_000944282.1.46355 WP_000944282.1.464 WP_000944282.1.46454 WP_000944282.1.46461 WP_000944282.1.46504 WP_000944282.1.46505 WP_000944282.1.46551 WP_000944282.1.46559 WP_000944282.1.46572 WP_000944282.1.46574 WP_000944282.1.46595 WP_000944282.1.46666 WP_000944282.1.46675 WP_000944282.1.46693 WP_000944282.1.46701 WP_000944282.1.46732 WP_000944282.1.46749 WP_000944282.1.46781 WP_000944282.1.46816 WP_000944282.1.46842 WP_000944282.1.4690 WP_000944282.1.46920 WP_000944282.1.46930 WP_000944282.1.46945 WP_000944282.1.47036 WP_000944282.1.47037 WP_000944282.1.47042 WP_000944282.1.47057 WP_000944282.1.47059 WP_000944282.1.47067 WP_000944282.1.47085 WP_000944282.1.47123 WP_000944282.1.47214 WP_000944282.1.47215 WP_000944282.1.47245 WP_000944282.1.47257 WP_000944282.1.47389 WP_000944282.1.47429 WP_000944282.1.47442 WP_000944282.1.47448 WP_000944282.1.4747 WP_000944282.1.47472 WP_000944282.1.47478 WP_000944282.1.47506 WP_000944282.1.47523 WP_000944282.1.47531 WP_000944282.1.47532 WP_000944282.1.47605 WP_000944282.1.47621 WP_000944282.1.47630 WP_000944282.1.47649 WP_000944282.1.4770 WP_000944282.1.4774 WP_000944282.1.47756 WP_000944282.1.47799 WP_000944282.1.4781 WP_000944282.1.47814 WP_000944282.1.47817 WP_000944282.1.47849 WP_000944282.1.47886 WP_000944282.1.47898 WP_000944282.1.47902 WP_000944282.1.47928 WP_000944282.1.47992 WP_000944282.1.48019 WP_000944282.1.48100 WP_000944282.1.48114 WP_000944282.1.48139 WP_000944282.1.48190 WP_000944282.1.48209 WP_000944282.1.48218 WP_000944282.1.48242 WP_000944282.1.48247 WP_000944282.1.48253 WP_000944282.1.48292 WP_000944282.1.483 WP_000944282.1.48324 WP_000944282.1.48367 WP_000944282.1.48377 WP_000944282.1.48426 WP_000944282.1.48430 WP_000944282.1.48436 WP_000944282.1.48455 WP_000944282.1.48493 WP_000944282.1.4853 WP_000944282.1.48570 WP_000944282.1.48586 WP_000944282.1.4859 WP_000944282.1.48591 WP_000944282.1.48610 WP_000944282.1.48631 WP_000944282.1.48663 WP_000944282.1.48690 WP_000944282.1.48734 WP_000944282.1.48755 WP_000944282.1.48756 WP_000944282.1.48774 WP_000944282.1.48778 WP_000944282.1.48788 WP_000944282.1.48849 WP_000944282.1.4885 WP_000944282.1.48855 WP_000944282.1.48886 WP_000944282.1.48894 WP_000944282.1.48918 WP_000944282.1.48919 WP_000944282.1.48931 WP_000944282.1.48955 WP_000944282.1.48963 WP_000944282.1.48973 WP_000944282.1.48985 WP_000944282.1.49004 WP_000944282.1.49012 WP_000944282.1.49084 WP_000944282.1.49106 WP_000944282.1.49117 WP_000944282.1.49121 WP_000944282.1.4914 WP_000944282.1.49140 WP_000944282.1.49153 WP_000944282.1.49155 WP_000944282.1.49166 WP_000944282.1.49204 WP_000944282.1.49233 WP_000944282.1.49239 WP_000944282.1.49256 WP_000944282.1.49262 WP_000944282.1.49290 WP_000944282.1.49304 WP_000944282.1.49340 WP_000944282.1.49355 WP_000944282.1.49366 WP_000944282.1.49429 WP_000944282.1.49434 WP_000944282.1.49450 WP_000944282.1.49472 WP_000944282.1.49490 WP_000944282.1.495 WP_000944282.1.49515 WP_000944282.1.49545 WP_000944282.1.49572 WP_000944282.1.49574 WP_000944282.1.49602 WP_000944282.1.49647 WP_000944282.1.49703 WP_000944282.1.49769 WP_000944282.1.49780 WP_000944282.1.4979 WP_000944282.1.49803 WP_000944282.1.49805 WP_000944282.1.49846 WP_000944282.1.49848 WP_000944282.1.4991 WP_000944282.1.49929 WP_000944282.1.49947 WP_000944282.1.49959 WP_000944282.1.49997 WP_000944282.1.50 WP_000944282.1.50014 WP_000944282.1.50030 WP_000944282.1.50043 WP_000944282.1.50080 WP_000944282.1.50103 WP_000944282.1.50158 WP_000944282.1.50161 WP_000944282.1.50198 WP_000944282.1.50211 WP_000944282.1.50239 WP_000944282.1.50247 WP_000944282.1.50251 WP_000944282.1.50308 WP_000944282.1.50309 WP_000944282.1.50374 WP_000944282.1.50376 WP_000944282.1.50386 WP_000944282.1.50387 WP_000944282.1.50389 WP_000944282.1.50406 WP_000944282.1.50468 WP_000944282.1.50469 WP_000944282.1.50478 WP_000944282.1.50497 WP_000944282.1.5051 WP_000944282.1.50563 WP_000944282.1.50566 WP_000944282.1.50570 WP_000944282.1.50576 WP_000944282.1.50593 WP_000944282.1.50626 WP_000944282.1.50676 WP_000944282.1.50726 WP_000944282.1.50771 WP_000944282.1.50774 WP_000944282.1.50777 WP_000944282.1.50782 WP_000944282.1.50800 WP_000944282.1.50804 WP_000944282.1.50808 WP_000944282.1.50811 WP_000944282.1.50875 WP_000944282.1.5088 WP_000944282.1.50885 WP_000944282.1.509 WP_000944282.1.50908 WP_000944282.1.50929 WP_000944282.1.50941 WP_000944282.1.50954 WP_000944282.1.50970 WP_000944282.1.51014 WP_000944282.1.51022 WP_000944282.1.51040 WP_000944282.1.51048 WP_000944282.1.51100 WP_000944282.1.51131 WP_000944282.1.51134 WP_000944282.1.51179 WP_000944282.1.51182 WP_000944282.1.51186 WP_000944282.1.51227 WP_000944282.1.5127 WP_000944282.1.51305 WP_000944282.1.51315 WP_000944282.1.51331 WP_000944282.1.51338 WP_000944282.1.5136 WP_000944282.1.51394 WP_000944282.1.51419 WP_000944282.1.51474 WP_000944282.1.51487 WP_000944282.1.51488 WP_000944282.1.51519 WP_000944282.1.51598 WP_000944282.1.51613 WP_000944282.1.51634 WP_000944282.1.51644 WP_000944282.1.51649 WP_000944282.1.51686 WP_000944282.1.51700 WP_000944282.1.51724 WP_000944282.1.51734 WP_000944282.1.51756 WP_000944282.1.51838 WP_000944282.1.51863 WP_000944282.1.51911 WP_000944282.1.51914 WP_000944282.1.51932 WP_000944282.1.51935 WP_000944282.1.51989 WP_000944282.1.52057 WP_000944282.1.52114 WP_000944282.1.52121 WP_000944282.1.52129 WP_000944282.1.52148 WP_000944282.1.5216 WP_000944282.1.52161 WP_000944282.1.52191 WP_000944282.1.52202 WP_000944282.1.52209 WP_000944282.1.52255 WP_000944282.1.52339 WP_000944282.1.52346 WP_000944282.1.52353 WP_000944282.1.52361 WP_000944282.1.52438 WP_000944282.1.52469 WP_000944282.1.52571 WP_000944282.1.526 WP_000944282.1.52608 WP_000944282.1.52647 WP_000944282.1.52653 WP_000944282.1.52656 WP_000944282.1.52742 WP_000944282.1.52743 WP_000944282.1.52744 WP_000944282.1.52773 WP_000944282.1.52795 WP_000944282.1.52807 WP_000944282.1.52851 WP_000944282.1.52857 WP_000944282.1.52858 WP_000944282.1.52887 WP_000944282.1.52898 WP_000944282.1.52915 WP_000944282.1.53092 WP_000944282.1.53100 WP_000944282.1.53141 WP_000944282.1.53151 WP_000944282.1.53154 WP_000944282.1.53158 WP_000944282.1.53159 WP_000944282.1.53190 WP_000944282.1.53203 WP_000944282.1.53206 WP_000944282.1.53210 WP_000944282.1.53233 WP_000944282.1.53286 WP_000944282.1.53307 WP_000944282.1.53321 WP_000944282.1.53368 WP_000944282.1.53375 WP_000944282.1.53406 WP_000944282.1.53436 WP_000944282.1.53450 WP_000944282.1.53454 WP_000944282.1.53466 WP_000944282.1.5349 WP_000944282.1.53529 WP_000944282.1.53540 WP_000944282.1.53543 WP_000944282.1.53555 WP_000944282.1.53559 WP_000944282.1.5356 WP_000944282.1.53571 WP_000944282.1.5358 WP_000944282.1.53675 WP_000944282.1.53692 WP_000944282.1.53696 WP_000944282.1.53723 WP_000944282.1.5374 WP_000944282.1.53750 WP_000944282.1.53757 WP_000944282.1.53772 WP_000944282.1.53800 WP_000944282.1.53812 WP_000944282.1.53815 WP_000944282.1.53839 WP_000944282.1.53892 WP_000944282.1.53898 WP_000944282.1.53902 WP_000944282.1.53935 WP_000944282.1.53958 WP_000944282.1.53981 WP_000944282.1.53984 WP_000944282.1.54033 WP_000944282.1.54075 WP_000944282.1.54132 WP_000944282.1.54136 WP_000944282.1.54159 WP_000944282.1.54170 WP_000944282.1.54175 WP_000944282.1.54196 WP_000944282.1.542 WP_000944282.1.54203 WP_000944282.1.54209 WP_000944282.1.54259 WP_000944282.1.54271 WP_000944282.1.54273 WP_000944282.1.54274 WP_000944282.1.5430 WP_000944282.1.54319 WP_000944282.1.54364 WP_000944282.1.54371 WP_000944282.1.54400 WP_000944282.1.54431 WP_000944282.1.54442 WP_000944282.1.54482 WP_000944282.1.54522 WP_000944282.1.54558 WP_000944282.1.5456 WP_000944282.1.54569 WP_000944282.1.54589 WP_000944282.1.54607 WP_000944282.1.54644 WP_000944282.1.54662 WP_000944282.1.54667 WP_000944282.1.54678 WP_000944282.1.54681 WP_000944282.1.54694 WP_000944282.1.54722 WP_000944282.1.54748 WP_000944282.1.54749 WP_000944282.1.54764 WP_000944282.1.54774 WP_000944282.1.5481 WP_000944282.1.54814 WP_000944282.1.54827 WP_000944282.1.54845 WP_000944282.1.5485 WP_000944282.1.54865 WP_000944282.1.54935 WP_000944282.1.54979 WP_000944282.1.54984 WP_000944282.1.54992 WP_000944282.1.55008 WP_000944282.1.55010 WP_000944282.1.55034 WP_000944282.1.55073 WP_000944282.1.55152 WP_000944282.1.55156 WP_000944282.1.55163 WP_000944282.1.55165 WP_000944282.1.55178 WP_000944282.1.55215 WP_000944282.1.5523 WP_000944282.1.5527 WP_000944282.1.55285 WP_000944282.1.55290 WP_000944282.1.55294 WP_000944282.1.55310 WP_000944282.1.55317 WP_000944282.1.55379 WP_000944282.1.5539 WP_000944282.1.55461 WP_000944282.1.55468 WP_000944282.1.55475 WP_000944282.1.55506 WP_000944282.1.5555 WP_000944282.1.55554 WP_000944282.1.55557 WP_000944282.1.55604 WP_000944282.1.55614 WP_000944282.1.55639 WP_000944282.1.55647 WP_000944282.1.55672 WP_000944282.1.55699 WP_000944282.1.55725 WP_000944282.1.55743 WP_000944282.1.55768 WP_000944282.1.55780 WP_000944282.1.55782 WP_000944282.1.55796 WP_000944282.1.55967 WP_000944282.1.55993 WP_000944282.1.56002 WP_000944282.1.56012 WP_000944282.1.56026 WP_000944282.1.56059 WP_000944282.1.56100 WP_000944282.1.56105 WP_000944282.1.56144 WP_000944282.1.56172 WP_000944282.1.5621 WP_000944282.1.56226 WP_000944282.1.56238 WP_000944282.1.56286 WP_000944282.1.56304 WP_000944282.1.56305 WP_000944282.1.56311 WP_000944282.1.56354 WP_000944282.1.56368 WP_000944282.1.56389 WP_000944282.1.56414 WP_000944282.1.56419 WP_000944282.1.56423 WP_000944282.1.56438 WP_000944282.1.56512 WP_000944282.1.56514 WP_000944282.1.56535 WP_000944282.1.56560 WP_000944282.1.56585 WP_000944282.1.56597 WP_000944282.1.56601 WP_000944282.1.56614 WP_000944282.1.56640 WP_000944282.1.56647 WP_000944282.1.56651 WP_000944282.1.56671 WP_000944282.1.56682 WP_000944282.1.56724 WP_000944282.1.56825 WP_000944282.1.56853 WP_000944282.1.56875 WP_000944282.1.56877 WP_000944282.1.56887 WP_000944282.1.56889 WP_000944282.1.56893 WP_000944282.1.57000 WP_000944282.1.57137 WP_000944282.1.57147 WP_000944282.1.57168 WP_000944282.1.57179 WP_000944282.1.57186 WP_000944282.1.57187 WP_000944282.1.57232 WP_000944282.1.57233 WP_000944282.1.57307 WP_000944282.1.57342 WP_000944282.1.57377 WP_000944282.1.57418 WP_000944282.1.57433 WP_000944282.1.57494 WP_000944282.1.57515 WP_000944282.1.57529 WP_000944282.1.57555 WP_000944282.1.57576 WP_000944282.1.57601 WP_000944282.1.57607 WP_000944282.1.57641 WP_000944282.1.57684 WP_000944282.1.57699 WP_000944282.1.57709 WP_000944282.1.57735 WP_000944282.1.57763 WP_000944282.1.57785 WP_000944282.1.57800 WP_000944282.1.5781 WP_000944282.1.57862 WP_000944282.1.57873 WP_000944282.1.57890 WP_000944282.1.57891 WP_000944282.1.57902 WP_000944282.1.57965 WP_000944282.1.57972 WP_000944282.1.57978 WP_000944282.1.58008 WP_000944282.1.5801 WP_000944282.1.58040 WP_000944282.1.58041 WP_000944282.1.58044 WP_000944282.1.58081 WP_000944282.1.5809 WP_000944282.1.58132 WP_000944282.1.58153 WP_000944282.1.58157 WP_000944282.1.58173 WP_000944282.1.58191 WP_000944282.1.58194 WP_000944282.1.58252 WP_000944282.1.58261 WP_000944282.1.58274 WP_000944282.1.58282 WP_000944282.1.58324 WP_000944282.1.58326 WP_000944282.1.58357 WP_000944282.1.5836 WP_000944282.1.58372 WP_000944282.1.58418 WP_000944282.1.58442 WP_000944282.1.5846 WP_000944282.1.58485 WP_000944282.1.58537 WP_000944282.1.5854 WP_000944282.1.58548 WP_000944282.1.58568 WP_000944282.1.5858 WP_000944282.1.58583 WP_000944282.1.58604 WP_000944282.1.58652 WP_000944282.1.58662 WP_000944282.1.58663 WP_000944282.1.58669 WP_000944282.1.58724 WP_000944282.1.58729 WP_000944282.1.58745 WP_000944282.1.5875 WP_000944282.1.5878 WP_000944282.1.58796 WP_000944282.1.58803 WP_000944282.1.58807 WP_000944282.1.58831 WP_000944282.1.58834 WP_000944282.1.58836 WP_000944282.1.58847 WP_000944282.1.5886 WP_000944282.1.58861 WP_000944282.1.58883 WP_000944282.1.58898 WP_000944282.1.58932 WP_000944282.1.58949 WP_000944282.1.58963 WP_000944282.1.58970 WP_000944282.1.58974 WP_000944282.1.59020 WP_000944282.1.59043 WP_000944282.1.59056 WP_000944282.1.59061 WP_000944282.1.59064 WP_000944282.1.59084 WP_000944282.1.59094 WP_000944282.1.59097 WP_000944282.1.59125 WP_000944282.1.59136 WP_000944282.1.59148 WP_000944282.1.59224 WP_000944282.1.59282 WP_000944282.1.59299 WP_000944282.1.59313 WP_000944282.1.59321 WP_000944282.1.59336 WP_000944282.1.59375 WP_000944282.1.59381 WP_000944282.1.59412 WP_000944282.1.59458 WP_000944282.1.5949 WP_000944282.1.59490 WP_000944282.1.59501 WP_000944282.1.59508 WP_000944282.1.59510 WP_000944282.1.59512 WP_000944282.1.5953 WP_000944282.1.59636 WP_000944282.1.59641 WP_000944282.1.59684 WP_000944282.1.5969 WP_000944282.1.59694 WP_000944282.1.59751 WP_000944282.1.59771 WP_000944282.1.5979 WP_000944282.1.59827 WP_000944282.1.59829 WP_000944282.1.59830 WP_000944282.1.59847 WP_000944282.1.59863 WP_000944282.1.59953 WP_000944282.1.59969 WP_000944282.1.59994 WP_000944282.1.60004 WP_000944282.1.60008 WP_000944282.1.60021 WP_000944282.1.60045 WP_000944282.1.60052 WP_000944282.1.60069 WP_000944282.1.60076 WP_000944282.1.60114 WP_000944282.1.60140 WP_000944282.1.60154 WP_000944282.1.60155 WP_000944282.1.60168 WP_000944282.1.60192 WP_000944282.1.60199 WP_000944282.1.60209 WP_000944282.1.60212 WP_000944282.1.60213 WP_000944282.1.60231 WP_000944282.1.60253 WP_000944282.1.60285 WP_000944282.1.60322 WP_000944282.1.60324 WP_000944282.1.60330 WP_000944282.1.60356 WP_000944282.1.60370 WP_000944282.1.60379 WP_000944282.1.6038 WP_000944282.1.60380 WP_000944282.1.6041 WP_000944282.1.60424 WP_000944282.1.60464 WP_000944282.1.60469 WP_000944282.1.60481 WP_000944282.1.60486 WP_000944282.1.605 WP_000944282.1.60507 WP_000944282.1.6058 WP_000944282.1.60584 WP_000944282.1.60597 WP_000944282.1.6060 WP_000944282.1.60608 WP_000944282.1.60643 WP_000944282.1.60676 WP_000944282.1.60708 WP_000944282.1.60725 WP_000944282.1.60783 WP_000944282.1.60792 WP_000944282.1.60794 WP_000944282.1.60807 WP_000944282.1.60855 WP_000944282.1.6086 WP_000944282.1.60874 WP_000944282.1.60882 WP_000944282.1.60889 WP_000944282.1.60919 WP_000944282.1.60926 WP_000944282.1.60941 WP_000944282.1.60950 WP_000944282.1.60976 WP_000944282.1.60988 WP_000944282.1.60990 WP_000944282.1.6104 WP_000944282.1.61044 WP_000944282.1.61076 WP_000944282.1.61078 WP_000944282.1.6108 WP_000944282.1.61087 WP_000944282.1.61114 WP_000944282.1.61123 WP_000944282.1.6114 WP_000944282.1.61146 WP_000944282.1.61147 WP_000944282.1.61168 WP_000944282.1.61184 WP_000944282.1.61201 WP_000944282.1.61210 WP_000944282.1.61218 WP_000944282.1.61232 WP_000944282.1.6129 WP_000944282.1.61296 WP_000944282.1.61345 WP_000944282.1.61357 WP_000944282.1.61417 WP_000944282.1.61509 WP_000944282.1.61511 WP_000944282.1.61539 WP_000944282.1.61542 WP_000944282.1.61553 WP_000944282.1.61574 WP_000944282.1.61582 WP_000944282.1.61609 WP_000944282.1.6164 WP_000944282.1.61649 WP_000944282.1.61652 WP_000944282.1.61662 WP_000944282.1.61697 WP_000944282.1.61712 WP_000944282.1.61714 WP_000944282.1.61730 WP_000944282.1.61743 WP_000944282.1.61783 WP_000944282.1.61809 WP_000944282.1.61857 WP_000944282.1.61877 WP_000944282.1.61918 WP_000944282.1.61920 WP_000944282.1.61922 WP_000944282.1.61924 WP_000944282.1.61952 WP_000944282.1.61968 WP_000944282.1.62007 WP_000944282.1.62025 WP_000944282.1.62120 WP_000944282.1.62122 WP_000944282.1.62124 WP_000944282.1.62199 WP_000944282.1.62204 WP_000944282.1.62222 WP_000944282.1.62223 WP_000944282.1.62271 WP_000944282.1.62302 WP_000944282.1.62304 WP_000944282.1.62314 WP_000944282.1.62323 WP_000944282.1.62333 WP_000944282.1.62338 WP_000944282.1.62339 WP_000944282.1.62344 WP_000944282.1.62361 WP_000944282.1.62364 WP_000944282.1.62374 WP_000944282.1.62380 WP_000944282.1.62403 WP_000944282.1.62404 WP_000944282.1.62411 WP_000944282.1.62436 WP_000944282.1.62475 WP_000944282.1.62504 WP_000944282.1.62522 WP_000944282.1.6253 WP_000944282.1.62536 WP_000944282.1.62570 WP_000944282.1.62619 WP_000944282.1.62640 WP_000944282.1.62677 WP_000944282.1.62686 WP_000944282.1.62725 WP_000944282.1.62751 WP_000944282.1.62825 WP_000944282.1.62853 WP_000944282.1.62903 WP_000944282.1.62910 WP_000944282.1.62913 WP_000944282.1.62932 WP_000944282.1.62955 WP_000944282.1.62960 WP_000944282.1.62976 WP_000944282.1.63016 WP_000944282.1.63025 WP_000944282.1.63063 WP_000944282.1.63069 WP_000944282.1.63087 WP_000944282.1.63129 WP_000944282.1.63169 WP_000944282.1.63181 WP_000944282.1.63203 WP_000944282.1.63243 WP_000944282.1.63256 WP_000944282.1.63290 WP_000944282.1.63297 WP_000944282.1.63382 WP_000944282.1.63432 WP_000944282.1.63448 WP_000944282.1.63455 WP_000944282.1.63461 WP_000944282.1.63479 WP_000944282.1.63499 WP_000944282.1.63514 WP_000944282.1.63568 WP_000944282.1.6357 WP_000944282.1.63577 WP_000944282.1.63583 WP_000944282.1.63592 WP_000944282.1.63663 WP_000944282.1.63664 WP_000944282.1.6367 WP_000944282.1.63677 WP_000944282.1.63718 WP_000944282.1.63736 WP_000944282.1.6375 WP_000944282.1.63757 WP_000944282.1.63816 WP_000944282.1.63834 WP_000944282.1.63864 WP_000944282.1.63876 WP_000944282.1.6389 WP_000944282.1.63901 WP_000944282.1.63903 WP_000944282.1.63955 WP_000944282.1.63963 WP_000944282.1.6399 WP_000944282.1.64007 WP_000944282.1.64032 WP_000944282.1.64046 WP_000944282.1.64087 WP_000944282.1.6415 WP_000944282.1.64208 WP_000944282.1.6423 WP_000944282.1.64244 WP_000944282.1.64293 WP_000944282.1.64332 WP_000944282.1.64376 WP_000944282.1.644 WP_000944282.1.64403 WP_000944282.1.64412 WP_000944282.1.64471 WP_000944282.1.64501 WP_000944282.1.64538 WP_000944282.1.64632 WP_000944282.1.64645 WP_000944282.1.64648 WP_000944282.1.64649 WP_000944282.1.64654 WP_000944282.1.64662 WP_000944282.1.64663 WP_000944282.1.64667 WP_000944282.1.64690 WP_000944282.1.64702 WP_000944282.1.64709 WP_000944282.1.64710 WP_000944282.1.64744 WP_000944282.1.64757 WP_000944282.1.64763 WP_000944282.1.64781 WP_000944282.1.64798 WP_000944282.1.64817 WP_000944282.1.64831 WP_000944282.1.64847 WP_000944282.1.6487 WP_000944282.1.6489 WP_000944282.1.64891 WP_000944282.1.64919 WP_000944282.1.64920 WP_000944282.1.64974 WP_000944282.1.64977 WP_000944282.1.65016 WP_000944282.1.65018 WP_000944282.1.65027 WP_000944282.1.65028 WP_000944282.1.65054 WP_000944282.1.65075 WP_000944282.1.6514 WP_000944282.1.65163 WP_000944282.1.65168 WP_000944282.1.65171 WP_000944282.1.65172 WP_000944282.1.65185 WP_000944282.1.65191 WP_000944282.1.65200 WP_000944282.1.65211 WP_000944282.1.65218 WP_000944282.1.65226 WP_000944282.1.65238 WP_000944282.1.65248 WP_000944282.1.65249 WP_000944282.1.65266 WP_000944282.1.65348 WP_000944282.1.6535 WP_000944282.1.65394 WP_000944282.1.65395 WP_000944282.1.65437 WP_000944282.1.65459 WP_000944282.1.65463 WP_000944282.1.65474 WP_000944282.1.65487 WP_000944282.1.6549 WP_000944282.1.65499 WP_000944282.1.6554 WP_000944282.1.65572 WP_000944282.1.6561 WP_000944282.1.65633 WP_000944282.1.6565 WP_000944282.1.65650 WP_000944282.1.65696 WP_000944282.1.65697 WP_000944282.1.65699 WP_000944282.1.65737 WP_000944282.1.6575 WP_000944282.1.65755 WP_000944282.1.65782 WP_000944282.1.65790 WP_000944282.1.65812 WP_000944282.1.65846 WP_000944282.1.65849 WP_000944282.1.65863 WP_000944282.1.65876 WP_000944282.1.65968 WP_000944282.1.65985 WP_000944282.1.66021 WP_000944282.1.66031 WP_000944282.1.66052 WP_000944282.1.66064 WP_000944282.1.66109 WP_000944282.1.66129 WP_000944282.1.66145 WP_000944282.1.66183 WP_000944282.1.6620 WP_000944282.1.66216 WP_000944282.1.66234 WP_000944282.1.66270 WP_000944282.1.66272 WP_000944282.1.66273 WP_000944282.1.6630 WP_000944282.1.66314 WP_000944282.1.66324 WP_000944282.1.6634 WP_000944282.1.66358 WP_000944282.1.66361 WP_000944282.1.66362 WP_000944282.1.66368 WP_000944282.1.6638 WP_000944282.1.6640 WP_000944282.1.66480 WP_000944282.1.66506 WP_000944282.1.66600 WP_000944282.1.66665 WP_000944282.1.66681 WP_000944282.1.66684 WP_000944282.1.66698 WP_000944282.1.66755 WP_000944282.1.66759 WP_000944282.1.66779 WP_000944282.1.6680 WP_000944282.1.66801 WP_000944282.1.66807 WP_000944282.1.66824 WP_000944282.1.66825 WP_000944282.1.66834 WP_000944282.1.66860 WP_000944282.1.66876 WP_000944282.1.66901 WP_000944282.1.6692 WP_000944282.1.66953 WP_000944282.1.66955 WP_000944282.1.66962 WP_000944282.1.66981 WP_000944282.1.67 WP_000944282.1.67024 WP_000944282.1.67037 WP_000944282.1.67042 WP_000944282.1.67045 WP_000944282.1.67101 WP_000944282.1.67143 WP_000944282.1.67181 WP_000944282.1.67201 WP_000944282.1.67211 WP_000944282.1.67237 WP_000944282.1.67268 WP_000944282.1.67288 WP_000944282.1.67336 WP_000944282.1.67339 WP_000944282.1.67347 WP_000944282.1.67387 WP_000944282.1.67394 WP_000944282.1.67397 WP_000944282.1.67403 WP_000944282.1.67424 WP_000944282.1.67430 WP_000944282.1.67442 WP_000944282.1.67465 WP_000944282.1.67539 WP_000944282.1.67552 WP_000944282.1.67556 WP_000944282.1.67576 WP_000944282.1.67604 WP_000944282.1.67617 WP_000944282.1.67619 WP_000944282.1.67625 WP_000944282.1.67627 WP_000944282.1.67633 WP_000944282.1.67641 WP_000944282.1.67657 WP_000944282.1.67673 WP_000944282.1.67682 WP_000944282.1.67718 WP_000944282.1.67729 WP_000944282.1.67772 WP_000944282.1.67774 WP_000944282.1.67803 WP_000944282.1.67820 WP_000944282.1.67827 WP_000944282.1.67829 WP_000944282.1.67887 WP_000944282.1.67910 WP_000944282.1.67942 WP_000944282.1.67954 WP_000944282.1.67977 WP_000944282.1.68 WP_000944282.1.68073 WP_000944282.1.6809 WP_000944282.1.68105 WP_000944282.1.68113 WP_000944282.1.68115 WP_000944282.1.68131 WP_000944282.1.68147 WP_000944282.1.68182 WP_000944282.1.6819 WP_000944282.1.68201 WP_000944282.1.68206 WP_000944282.1.68210 WP_000944282.1.6827 WP_000944282.1.68275 WP_000944282.1.68285 WP_000944282.1.68359 WP_000944282.1.68420 WP_000944282.1.68478 WP_000944282.1.6849 WP_000944282.1.685 WP_000944282.1.68514 WP_000944282.1.68532 WP_000944282.1.68547 WP_000944282.1.68564 WP_000944282.1.68589 WP_000944282.1.68591 WP_000944282.1.68655 WP_000944282.1.68656 WP_000944282.1.68688 WP_000944282.1.68690 WP_000944282.1.68742 WP_000944282.1.6875 WP_000944282.1.68770 WP_000944282.1.68778 WP_000944282.1.68787 WP_000944282.1.6879 WP_000944282.1.68809 WP_000944282.1.68816 WP_000944282.1.68894 WP_000944282.1.68914 WP_000944282.1.68928 WP_000944282.1.68958 WP_000944282.1.68975 WP_000944282.1.69006 WP_000944282.1.69053 WP_000944282.1.6913 WP_000944282.1.69146 WP_000944282.1.69170 WP_000944282.1.69210 WP_000944282.1.69255 WP_000944282.1.69270 WP_000944282.1.69282 WP_000944282.1.69320 WP_000944282.1.69346 WP_000944282.1.69371 WP_000944282.1.69376 WP_000944282.1.69385 WP_000944282.1.69396 WP_000944282.1.69397 WP_000944282.1.69465 WP_000944282.1.69466 WP_000944282.1.69515 WP_000944282.1.69564 WP_000944282.1.69588 WP_000944282.1.69592 WP_000944282.1.69597 WP_000944282.1.69611 WP_000944282.1.69636 WP_000944282.1.69642 WP_000944282.1.69644 WP_000944282.1.69656 WP_000944282.1.69657 WP_000944282.1.69690 WP_000944282.1.69704 WP_000944282.1.69710 WP_000944282.1.69754 WP_000944282.1.69760 WP_000944282.1.69807 WP_000944282.1.69808 WP_000944282.1.69848 WP_000944282.1.69890 WP_000944282.1.69923 WP_000944282.1.69948 WP_000944282.1.69953 WP_000944282.1.69975 WP_000944282.1.69982 WP_000944282.1.70010 WP_000944282.1.70047 WP_000944282.1.70049 WP_000944282.1.70058 WP_000944282.1.70061 WP_000944282.1.70205 WP_000944282.1.7021 WP_000944282.1.70240 WP_000944282.1.70241 WP_000944282.1.70248 WP_000944282.1.70249 WP_000944282.1.70261 WP_000944282.1.70269 WP_000944282.1.70289 WP_000944282.1.70314 WP_000944282.1.70321 WP_000944282.1.7033 WP_000944282.1.70427 WP_000944282.1.70433 WP_000944282.1.70447 WP_000944282.1.70485 WP_000944282.1.70488 WP_000944282.1.70491 WP_000944282.1.70545 WP_000944282.1.70580 WP_000944282.1.70623 WP_000944282.1.70643 WP_000944282.1.70671 WP_000944282.1.70679 WP_000944282.1.70683 WP_000944282.1.70708 WP_000944282.1.70717 WP_000944282.1.70731 WP_000944282.1.70732 WP_000944282.1.70772 WP_000944282.1.70845 WP_000944282.1.70846 WP_000944282.1.70869 WP_000944282.1.70883 WP_000944282.1.70922 WP_000944282.1.70948 WP_000944282.1.70969 WP_000944282.1.70981 WP_000944282.1.70995 WP_000944282.1.71007 WP_000944282.1.71010 WP_000944282.1.71039 WP_000944282.1.71057 WP_000944282.1.71069 WP_000944282.1.71081 WP_000944282.1.7110 WP_000944282.1.71116 WP_000944282.1.71117 WP_000944282.1.71120 WP_000944282.1.71146 WP_000944282.1.71165 WP_000944282.1.71186 WP_000944282.1.71188 WP_000944282.1.71202 WP_000944282.1.71243 WP_000944282.1.71299 WP_000944282.1.71306 WP_000944282.1.71337 WP_000944282.1.71368 WP_000944282.1.71378 WP_000944282.1.71401 WP_000944282.1.71418 WP_000944282.1.7142 WP_000944282.1.71446 WP_000944282.1.71452 WP_000944282.1.71455 WP_000944282.1.71456 WP_000944282.1.71481 WP_000944282.1.71487 WP_000944282.1.71523 WP_000944282.1.71542 WP_000944282.1.71566 WP_000944282.1.71640 WP_000944282.1.71651 WP_000944282.1.71653 WP_000944282.1.71656 WP_000944282.1.71691 WP_000944282.1.71702 WP_000944282.1.71716 WP_000944282.1.7174 WP_000944282.1.71746 WP_000944282.1.71750 WP_000944282.1.71756 WP_000944282.1.71845 WP_000944282.1.71872 WP_000944282.1.71881 WP_000944282.1.71908 WP_000944282.1.71923 WP_000944282.1.71929 WP_000944282.1.71941 WP_000944282.1.71950 WP_000944282.1.71952 WP_000944282.1.71954 WP_000944282.1.71973 WP_000944282.1.71985 WP_000944282.1.72003 WP_000944282.1.72068 WP_000944282.1.72073 WP_000944282.1.72105 WP_000944282.1.72107 WP_000944282.1.72188 WP_000944282.1.72203 WP_000944282.1.72226 WP_000944282.1.72269 WP_000944282.1.72283 WP_000944282.1.72350 WP_000944282.1.72351 WP_000944282.1.72372 WP_000944282.1.72376 WP_000944282.1.72383 WP_000944282.1.7243 WP_000944282.1.72461 WP_000944282.1.72527 WP_000944282.1.7255 WP_000944282.1.72594 WP_000944282.1.72631 WP_000944282.1.72638 WP_000944282.1.72642 WP_000944282.1.72667 WP_000944282.1.72674 WP_000944282.1.72689 WP_000944282.1.72724 WP_000944282.1.72789 WP_000944282.1.72828 WP_000944282.1.72871 WP_000944282.1.72887 WP_000944282.1.72892 WP_000944282.1.72896 WP_000944282.1.72944 WP_000944282.1.72969 WP_000944282.1.72975 WP_000944282.1.72987 WP_000944282.1.73052 WP_000944282.1.73062 WP_000944282.1.7311 WP_000944282.1.73114 WP_000944282.1.7315 WP_000944282.1.73177 WP_000944282.1.73180 WP_000944282.1.73200 WP_000944282.1.73258 WP_000944282.1.73285 WP_000944282.1.7332 WP_000944282.1.73328 WP_000944282.1.7333 WP_000944282.1.7334 WP_000944282.1.73352 WP_000944282.1.73377 WP_000944282.1.73389 WP_000944282.1.73425 WP_000944282.1.73481 WP_000944282.1.73488 WP_000944282.1.73504 WP_000944282.1.73512 WP_000944282.1.7353 WP_000944282.1.73535 WP_000944282.1.73544 WP_000944282.1.7356 WP_000944282.1.73561 WP_000944282.1.73581 WP_000944282.1.73598 WP_000944282.1.7361 WP_000944282.1.73617 WP_000944282.1.73648 WP_000944282.1.73667 WP_000944282.1.73669 WP_000944282.1.7374 WP_000944282.1.73753 WP_000944282.1.73758 WP_000944282.1.73768 WP_000944282.1.73794 WP_000944282.1.73831 WP_000944282.1.73849 WP_000944282.1.7387 WP_000944282.1.73924 WP_000944282.1.73926 WP_000944282.1.73948 WP_000944282.1.73956 WP_000944282.1.73999 WP_000944282.1.74024 WP_000944282.1.74028 WP_000944282.1.74029 WP_000944282.1.74030 WP_000944282.1.74038 WP_000944282.1.74040 WP_000944282.1.74043 WP_000944282.1.74058 WP_000944282.1.74070 WP_000944282.1.74077 WP_000944282.1.74135 WP_000944282.1.74181 WP_000944282.1.74191 WP_000944282.1.74214 WP_000944282.1.74241 WP_000944282.1.74285 WP_000944282.1.7430 WP_000944282.1.74317 WP_000944282.1.7433 WP_000944282.1.74379 WP_000944282.1.74402 WP_000944282.1.74410 WP_000944282.1.74415 WP_000944282.1.74418 WP_000944282.1.74422 WP_000944282.1.74466 WP_000944282.1.74500 WP_000944282.1.74529 WP_000944282.1.74545 WP_000944282.1.74570 WP_000944282.1.7458 WP_000944282.1.74616 WP_000944282.1.74620 WP_000944282.1.74621 WP_000944282.1.74639 WP_000944282.1.74644 WP_000944282.1.74647 WP_000944282.1.74661 WP_000944282.1.74677 WP_000944282.1.74699 WP_000944282.1.74702 WP_000944282.1.74745 WP_000944282.1.74806 WP_000944282.1.74807 WP_000944282.1.74831 WP_000944282.1.74884 WP_000944282.1.74894 WP_000944282.1.74929 WP_000944282.1.74939 WP_000944282.1.74946 WP_000944282.1.74973 WP_000944282.1.75009 WP_000944282.1.7507 WP_000944282.1.75089 WP_000944282.1.75114 WP_000944282.1.75116 WP_000944282.1.75129 WP_000944282.1.75180 WP_000944282.1.75187 WP_000944282.1.75237 WP_000944282.1.75273 WP_000944282.1.75288 WP_000944282.1.75296 WP_000944282.1.75334 WP_000944282.1.75362 WP_000944282.1.75385 WP_000944282.1.75392 WP_000944282.1.75402 WP_000944282.1.75413 WP_000944282.1.7543 WP_000944282.1.75433 WP_000944282.1.75494 WP_000944282.1.75532 WP_000944282.1.75565 WP_000944282.1.75585 WP_000944282.1.75593 WP_000944282.1.75609 WP_000944282.1.75610 WP_000944282.1.75626 WP_000944282.1.75633 WP_000944282.1.75664 WP_000944282.1.75703 WP_000944282.1.75718 WP_000944282.1.75745 WP_000944282.1.75760 WP_000944282.1.75764 WP_000944282.1.75828 WP_000944282.1.75837 WP_000944282.1.75844 WP_000944282.1.75873 WP_000944282.1.75874 WP_000944282.1.75884 WP_000944282.1.75886 WP_000944282.1.75898 WP_000944282.1.75945 WP_000944282.1.75957 WP_000944282.1.76 WP_000944282.1.76020 WP_000944282.1.76024 WP_000944282.1.76081 WP_000944282.1.76097 WP_000944282.1.76116 WP_000944282.1.76122 WP_000944282.1.76156 WP_000944282.1.76162 WP_000944282.1.76164 WP_000944282.1.76186 WP_000944282.1.76197 WP_000944282.1.76252 WP_000944282.1.76256 WP_000944282.1.7629 WP_000944282.1.7633 WP_000944282.1.76339 WP_000944282.1.7634 WP_000944282.1.76364 WP_000944282.1.76366 WP_000944282.1.76417 WP_000944282.1.76445 WP_000944282.1.7646 WP_000944282.1.76471 WP_000944282.1.76510 WP_000944282.1.76532 WP_000944282.1.76548 WP_000944282.1.76558 WP_000944282.1.76572 WP_000944282.1.76576 WP_000944282.1.7660 WP_000944282.1.76641 WP_000944282.1.76651 WP_000944282.1.76653 WP_000944282.1.76673 WP_000944282.1.76706 WP_000944282.1.7672 WP_000944282.1.76721 WP_000944282.1.76724 WP_000944282.1.76756 WP_000944282.1.76760 WP_000944282.1.76788 WP_000944282.1.76806 WP_000944282.1.76854 WP_000944282.1.76875 WP_000944282.1.76880 WP_000944282.1.76899 WP_000944282.1.76916 WP_000944282.1.76932 WP_000944282.1.76973 WP_000944282.1.76988 WP_000944282.1.77016 WP_000944282.1.77038 WP_000944282.1.77047 WP_000944282.1.77080 WP_000944282.1.77087 WP_000944282.1.77090 WP_000944282.1.77111 WP_000944282.1.7712 WP_000944282.1.77180 WP_000944282.1.77193 WP_000944282.1.77244 WP_000944282.1.77292 WP_000944282.1.77299 WP_000944282.1.77313 WP_000944282.1.77349 WP_000944282.1.77384 WP_000944282.1.77390 WP_000944282.1.77414 WP_000944282.1.77431 WP_000944282.1.77436 WP_000944282.1.77440 WP_000944282.1.77501 WP_000944282.1.77512 WP_000944282.1.77513 WP_000944282.1.77514 WP_000944282.1.77529 WP_000944282.1.77549 WP_000944282.1.77563 WP_000944282.1.77565 WP_000944282.1.77596 WP_000944282.1.77629 WP_000944282.1.77646 WP_000944282.1.77653 WP_000944282.1.77692 WP_000944282.1.77702 WP_000944282.1.77713 WP_000944282.1.7772 WP_000944282.1.77729 WP_000944282.1.77754 WP_000944282.1.7782 WP_000944282.1.77825 WP_000944282.1.77837 WP_000944282.1.77846 WP_000944282.1.77851 WP_000944282.1.77898 WP_000944282.1.77900 WP_000944282.1.77918 WP_000944282.1.77923 WP_000944282.1.77960 WP_000944282.1.77975 WP_000944282.1.77987 WP_000944282.1.78026 WP_000944282.1.78033 WP_000944282.1.78035 WP_000944282.1.78048 WP_000944282.1.78076 WP_000944282.1.78096 WP_000944282.1.78100 WP_000944282.1.78107 WP_000944282.1.78110 WP_000944282.1.78120 WP_000944282.1.78166 WP_000944282.1.78168 WP_000944282.1.78170 WP_000944282.1.78192 WP_000944282.1.78195 WP_000944282.1.78201 WP_000944282.1.78259 WP_000944282.1.78291 WP_000944282.1.78301 WP_000944282.1.78309 WP_000944282.1.78320 WP_000944282.1.78382 WP_000944282.1.78383 WP_000944282.1.78388 WP_000944282.1.78407 WP_000944282.1.78410 WP_000944282.1.78495 WP_000944282.1.78496 WP_000944282.1.7861 WP_000944282.1.78618 WP_000944282.1.7862 WP_000944282.1.78626 WP_000944282.1.78661 WP_000944282.1.78673 WP_000944282.1.78674 WP_000944282.1.78676 WP_000944282.1.78715 WP_000944282.1.78735 WP_000944282.1.78738 WP_000944282.1.78761 WP_000944282.1.78771 WP_000944282.1.78802 WP_000944282.1.78830 WP_000944282.1.78835 WP_000944282.1.78862 WP_000944282.1.78871 WP_000944282.1.78874 WP_000944282.1.789 WP_000944282.1.7891 WP_000944282.1.78913 WP_000944282.1.78918 WP_000944282.1.78930 WP_000944282.1.78993 WP_000944282.1.79011 WP_000944282.1.79012 WP_000944282.1.79069 WP_000944282.1.79074 WP_000944282.1.79081 WP_000944282.1.79098 WP_000944282.1.79151 WP_000944282.1.79155 WP_000944282.1.79164 WP_000944282.1.79167 WP_000944282.1.79203 WP_000944282.1.79204 WP_000944282.1.79235 WP_000944282.1.79280 WP_000944282.1.79335 WP_000944282.1.79397 WP_000944282.1.79427 WP_000944282.1.79456 WP_000944282.1.79462 WP_000944282.1.79472 WP_000944282.1.79490 WP_000944282.1.79495 WP_000944282.1.79529 WP_000944282.1.79532 WP_000944282.1.79547 WP_000944282.1.79570 WP_000944282.1.7964 WP_000944282.1.79642 WP_000944282.1.79645 WP_000944282.1.79654 WP_000944282.1.79659 WP_000944282.1.79668 WP_000944282.1.7970 WP_000944282.1.79708 WP_000944282.1.79722 WP_000944282.1.79772 WP_000944282.1.79832 WP_000944282.1.79867 WP_000944282.1.79880 WP_000944282.1.79914 WP_000944282.1.79916 WP_000944282.1.79934 WP_000944282.1.79942 WP_000944282.1.79945 WP_000944282.1.80065 WP_000944282.1.80077 WP_000944282.1.80103 WP_000944282.1.80137 WP_000944282.1.80182 WP_000944282.1.80250 WP_000944282.1.80273 WP_000944282.1.80282 WP_000944282.1.80293 WP_000944282.1.80296 WP_000944282.1.80307 WP_000944282.1.80354 WP_000944282.1.80366 WP_000944282.1.80368 WP_000944282.1.80386 WP_000944282.1.80400 WP_000944282.1.80448 WP_000944282.1.80462 WP_000944282.1.80479 WP_000944282.1.8049 WP_000944282.1.80492 WP_000944282.1.80529 WP_000944282.1.80569 WP_000944282.1.80586 WP_000944282.1.80629 WP_000944282.1.80638 WP_000944282.1.80651 WP_000944282.1.80664 WP_000944282.1.80696 WP_000944282.1.80780 WP_000944282.1.80819 WP_000944282.1.80831 WP_000944282.1.80850 WP_000944282.1.80857 WP_000944282.1.80868 WP_000944282.1.80881 WP_000944282.1.80927 WP_000944282.1.80939 WP_000944282.1.8096 WP_000944282.1.80973 WP_000944282.1.80984 WP_000944282.1.81037 WP_000944282.1.81067 WP_000944282.1.81069 WP_000944282.1.81131 WP_000944282.1.81149 WP_000944282.1.81175 WP_000944282.1.81187 WP_000944282.1.8119 WP_000944282.1.81193 WP_000944282.1.81231 WP_000944282.1.81262 WP_000944282.1.81268 WP_000944282.1.81269 WP_000944282.1.81271 WP_000944282.1.81275 WP_000944282.1.8131 WP_000944282.1.81333 WP_000944282.1.81342 WP_000944282.1.81354 WP_000944282.1.81364 WP_000944282.1.81409 WP_000944282.1.81410 WP_000944282.1.81425 WP_000944282.1.81472 WP_000944282.1.81494 WP_000944282.1.81504 WP_000944282.1.81548 WP_000944282.1.81557 WP_000944282.1.81676 WP_000944282.1.8168 WP_000944282.1.81681 WP_000944282.1.8170 WP_000944282.1.81727 WP_000944282.1.81743 WP_000944282.1.81746 WP_000944282.1.81750 WP_000944282.1.81763 WP_000944282.1.81785 WP_000944282.1.81855 WP_000944282.1.81902 WP_000944282.1.81921 WP_000944282.1.81931 WP_000944282.1.81936 WP_000944282.1.81949 WP_000944282.1.8196 WP_000944282.1.81974 WP_000944282.1.81977 WP_000944282.1.81995 WP_000944282.1.82037 WP_000944282.1.82070 WP_000944282.1.82076 WP_000944282.1.82099 WP_000944282.1.82131 WP_000944282.1.82141 WP_000944282.1.82156 WP_000944282.1.8218 WP_000944282.1.82180 WP_000944282.1.82201 WP_000944282.1.82214 WP_000944282.1.82225 WP_000944282.1.82258 WP_000944282.1.82269 WP_000944282.1.82337 WP_000944282.1.82347 WP_000944282.1.8236 WP_000944282.1.82369 WP_000944282.1.82395 WP_000944282.1.8240 WP_000944282.1.82408 WP_000944282.1.82416 WP_000944282.1.8242 WP_000944282.1.82456 WP_000944282.1.82465 WP_000944282.1.82473 WP_000944282.1.82479 WP_000944282.1.82503 WP_000944282.1.82515 WP_000944282.1.82529 WP_000944282.1.82530 WP_000944282.1.82553 WP_000944282.1.82570 WP_000944282.1.82584 WP_000944282.1.82636 WP_000944282.1.82646 WP_000944282.1.82648 WP_000944282.1.82670 WP_000944282.1.82676 WP_000944282.1.82731 WP_000944282.1.82761 WP_000944282.1.82812 WP_000944282.1.8282 WP_000944282.1.82841 WP_000944282.1.82850 WP_000944282.1.82872 WP_000944282.1.82886 WP_000944282.1.8294 WP_000944282.1.82944 WP_000944282.1.82946 WP_000944282.1.82956 WP_000944282.1.82959 WP_000944282.1.83007 WP_000944282.1.8304 WP_000944282.1.83092 WP_000944282.1.83128 WP_000944282.1.83139 WP_000944282.1.83180 WP_000944282.1.83221 WP_000944282.1.83229 WP_000944282.1.83235 WP_000944282.1.83252 WP_000944282.1.83290 WP_000944282.1.83305 WP_000944282.1.83333 WP_000944282.1.83360 WP_000944282.1.83365 WP_000944282.1.83378 WP_000944282.1.83413 WP_000944282.1.83491 WP_000944282.1.83516 WP_000944282.1.83523 WP_000944282.1.8354 WP_000944282.1.83598 WP_000944282.1.83650 WP_000944282.1.83651 WP_000944282.1.83657 WP_000944282.1.83677 WP_000944282.1.83710 WP_000944282.1.83721 WP_000944282.1.8375 WP_000944282.1.83760 WP_000944282.1.83854 WP_000944282.1.83923 WP_000944282.1.83979 WP_000944282.1.83994 WP_000944282.1.83995 WP_000944282.1.84 WP_000944282.1.84031 WP_000944282.1.8406 WP_000944282.1.84076 WP_000944282.1.84077 WP_000944282.1.84103 WP_000944282.1.84106 WP_000944282.1.84110 WP_000944282.1.84127 WP_000944282.1.84150 WP_000944282.1.84168 WP_000944282.1.84179 WP_000944282.1.84230 WP_000944282.1.84252 WP_000944282.1.84283 WP_000944282.1.8431 WP_000944282.1.84345 WP_000944282.1.84355 WP_000944282.1.84369 WP_000944282.1.84392 WP_000944282.1.84401 WP_000944282.1.8441 WP_000944282.1.84435 WP_000944282.1.84461 WP_000944282.1.84475 WP_000944282.1.84532 WP_000944282.1.84551 WP_000944282.1.84567 WP_000944282.1.84631 WP_000944282.1.84659 WP_000944282.1.84693 WP_000944282.1.84711 WP_000944282.1.84727 WP_000944282.1.84744 WP_000944282.1.84745 WP_000944282.1.84773 WP_000944282.1.84899 WP_000944282.1.849 WP_000944282.1.84945 WP_000944282.1.84967 WP_000944282.1.8497 WP_000944282.1.85004 WP_000944282.1.8502 WP_000944282.1.85039 WP_000944282.1.85040 WP_000944282.1.85094 WP_000944282.1.85126 WP_000944282.1.85134 WP_000944282.1.85153 WP_000944282.1.85178 WP_000944282.1.85180 WP_000944282.1.85190 WP_000944282.1.85273 WP_000944282.1.8533 WP_000944282.1.85338 WP_000944282.1.85339 WP_000944282.1.85433 WP_000944282.1.8545 WP_000944282.1.85469 WP_000944282.1.85481 WP_000944282.1.85483 WP_000944282.1.85511 WP_000944282.1.85512 WP_000944282.1.85541 WP_000944282.1.8556 WP_000944282.1.8557 WP_000944282.1.85606 WP_000944282.1.85615 WP_000944282.1.85617 WP_000944282.1.85635 WP_000944282.1.85646 WP_000944282.1.85663 WP_000944282.1.85665 WP_000944282.1.85669 WP_000944282.1.85671 WP_000944282.1.85672 WP_000944282.1.85675 WP_000944282.1.85688 WP_000944282.1.85703 WP_000944282.1.85723 WP_000944282.1.85728 WP_000944282.1.85742 WP_000944282.1.85746 WP_000944282.1.85777 WP_000944282.1.85784 WP_000944282.1.85811 WP_000944282.1.85854 WP_000944282.1.85855 WP_000944282.1.85886 WP_000944282.1.859 WP_000944282.1.85900 WP_000944282.1.85904 WP_000944282.1.8591 WP_000944282.1.85917 WP_000944282.1.8594 WP_000944282.1.85976 WP_000944282.1.85977 WP_000944282.1.860 WP_000944282.1.86007 WP_000944282.1.86010 WP_000944282.1.8605 WP_000944282.1.86084 WP_000944282.1.8610 WP_000944282.1.86120 WP_000944282.1.8614 WP_000944282.1.86156 WP_000944282.1.86285 WP_000944282.1.86306 WP_000944282.1.86310 WP_000944282.1.86316 WP_000944282.1.86323 WP_000944282.1.86342 WP_000944282.1.86356 WP_000944282.1.86389 WP_000944282.1.8640 WP_000944282.1.8642 WP_000944282.1.86426 WP_000944282.1.86450 WP_000944282.1.86453 WP_000944282.1.86469 WP_000944282.1.86489 WP_000944282.1.86530 WP_000944282.1.86580 WP_000944282.1.86588 WP_000944282.1.86661 WP_000944282.1.86663 WP_000944282.1.86699 WP_000944282.1.8672 WP_000944282.1.86744 WP_000944282.1.86770 WP_000944282.1.8678 WP_000944282.1.86794 WP_000944282.1.86800 WP_000944282.1.86807 WP_000944282.1.86810 WP_000944282.1.86811 WP_000944282.1.86815 WP_000944282.1.8684 WP_000944282.1.86860 WP_000944282.1.86895 WP_000944282.1.86902 WP_000944282.1.86906 WP_000944282.1.86945 WP_000944282.1.86989 WP_000944282.1.87023 WP_000944282.1.87034 WP_000944282.1.87041 WP_000944282.1.87051 WP_000944282.1.87095 WP_000944282.1.87136 WP_000944282.1.87148 WP_000944282.1.87155 WP_000944282.1.8722 WP_000944282.1.87258 WP_000944282.1.87293 WP_000944282.1.87323 WP_000944282.1.8736 WP_000944282.1.87420 WP_000944282.1.87460 WP_000944282.1.87528 WP_000944282.1.87552 WP_000944282.1.87560 WP_000944282.1.87584 WP_000944282.1.8760 WP_000944282.1.87600 WP_000944282.1.87609 WP_000944282.1.87612 WP_000944282.1.87615 WP_000944282.1.87618 WP_000944282.1.87626 WP_000944282.1.87651 WP_000944282.1.87653 WP_000944282.1.87659 WP_000944282.1.8767 WP_000944282.1.87698 WP_000944282.1.87706 WP_000944282.1.87739 WP_000944282.1.87741 WP_000944282.1.87742 WP_000944282.1.87779 WP_000944282.1.87852 WP_000944282.1.87875 WP_000944282.1.87933 WP_000944282.1.87945 WP_000944282.1.87949 WP_000944282.1.87999 WP_000944282.1.88014 WP_000944282.1.88019 WP_000944282.1.88025 WP_000944282.1.88026 WP_000944282.1.8805 WP_000944282.1.8806 WP_000944282.1.88073 WP_000944282.1.8809 WP_000944282.1.881 WP_000944282.1.88145 WP_000944282.1.88174 WP_000944282.1.88199 WP_000944282.1.88222 WP_000944282.1.88244 WP_000944282.1.88291 WP_000944282.1.88293 WP_000944282.1.88299 WP_000944282.1.88303 WP_000944282.1.88313 WP_000944282.1.88359 WP_000944282.1.8837 WP_000944282.1.88393 WP_000944282.1.88407 WP_000944282.1.88414 WP_000944282.1.88423 WP_000944282.1.88444 WP_000944282.1.88446 WP_000944282.1.88458 WP_000944282.1.88501 WP_000944282.1.88538 WP_000944282.1.88547 WP_000944282.1.886 WP_000944282.1.88620 WP_000944282.1.88647 WP_000944282.1.88648 WP_000944282.1.88651 WP_000944282.1.88692 WP_000944282.1.88698 WP_000944282.1.88703 WP_000944282.1.88707 WP_000944282.1.88727 WP_000944282.1.88772 WP_000944282.1.88792 WP_000944282.1.88845 WP_000944282.1.88850 WP_000944282.1.8889 WP_000944282.1.88892 WP_000944282.1.88894 WP_000944282.1.88902 WP_000944282.1.8891 WP_000944282.1.88967 WP_000944282.1.88981 WP_000944282.1.88995 WP_000944282.1.89008 WP_000944282.1.89054 WP_000944282.1.89116 WP_000944282.1.89138 WP_000944282.1.89174 WP_000944282.1.89182 WP_000944282.1.89188 WP_000944282.1.89215 WP_000944282.1.89298 WP_000944282.1.89304 WP_000944282.1.89308 WP_000944282.1.89311 WP_000944282.1.89314 WP_000944282.1.89328 WP_000944282.1.89332 WP_000944282.1.89343 WP_000944282.1.89354 WP_000944282.1.89395 WP_000944282.1.8940 WP_000944282.1.89449 WP_000944282.1.8947 WP_000944282.1.89503 WP_000944282.1.89512 WP_000944282.1.89527 WP_000944282.1.89570 WP_000944282.1.89580 WP_000944282.1.89591 WP_000944282.1.89604 WP_000944282.1.89612 WP_000944282.1.89622 WP_000944282.1.89632 WP_000944282.1.89647 WP_000944282.1.89659 WP_000944282.1.89668 WP_000944282.1.89706 WP_000944282.1.89713 WP_000944282.1.89733 WP_000944282.1.89777 WP_000944282.1.89796 WP_000944282.1.89804 WP_000944282.1.89845 WP_000944282.1.89888 WP_000944282.1.89902 WP_000944282.1.89911 WP_000944282.1.8995 WP_000944282.1.89952 WP_000944282.1.8996 WP_000944282.1.89975 WP_000944282.1.90007 WP_000944282.1.9002 WP_000944282.1.90033 WP_000944282.1.90097 WP_000944282.1.9011 WP_000944282.1.90193 WP_000944282.1.90196 WP_000944282.1.90211 WP_000944282.1.90220 WP_000944282.1.90240 WP_000944282.1.90252 WP_000944282.1.90274 WP_000944282.1.90280 WP_000944282.1.90311 WP_000944282.1.90330 WP_000944282.1.90338 WP_000944282.1.90363 WP_000944282.1.90365 WP_000944282.1.90417 WP_000944282.1.90428 WP_000944282.1.90440 WP_000944282.1.90453 WP_000944282.1.90458 WP_000944282.1.90489 WP_000944282.1.90513 WP_000944282.1.90582 WP_000944282.1.90585 WP_000944282.1.9064 WP_000944282.1.90641 WP_000944282.1.90701 WP_000944282.1.90713 WP_000944282.1.90734 WP_000944282.1.90792 WP_000944282.1.90794 WP_000944282.1.90796 WP_000944282.1.90811 WP_000944282.1.90876 WP_000944282.1.9091 WP_000944282.1.91003 WP_000944282.1.91042 WP_000944282.1.91067 WP_000944282.1.91069 WP_000944282.1.91107 WP_000944282.1.91164 WP_000944282.1.91205 WP_000944282.1.91239 WP_000944282.1.91278 WP_000944282.1.91291 WP_000944282.1.9131 WP_000944282.1.91313 WP_000944282.1.91334 WP_000944282.1.9135 WP_000944282.1.91459 WP_000944282.1.91470 WP_000944282.1.91506 WP_000944282.1.91512 WP_000944282.1.91524 WP_000944282.1.91557 WP_000944282.1.91564 WP_000944282.1.91580 WP_000944282.1.91597 WP_000944282.1.91625 WP_000944282.1.91628 WP_000944282.1.91655 WP_000944282.1.91702 WP_000944282.1.91715 WP_000944282.1.91724 WP_000944282.1.91732 WP_000944282.1.91736 WP_000944282.1.91788 WP_000944282.1.91806 WP_000944282.1.9187 WP_000944282.1.91870 WP_000944282.1.91903 WP_000944282.1.92013 WP_000944282.1.92018 WP_000944282.1.92044 WP_000944282.1.92060 WP_000944282.1.92087 WP_000944282.1.92093 WP_000944282.1.92098 WP_000944282.1.92108 WP_000944282.1.92156 WP_000944282.1.92171 WP_000944282.1.92172 WP_000944282.1.92183 WP_000944282.1.92208 WP_000944282.1.92213 WP_000944282.1.92240 WP_000944282.1.92243 WP_000944282.1.92268 WP_000944282.1.92299 WP_000944282.1.92310 WP_000944282.1.92318 WP_000944282.1.92327 WP_000944282.1.92399 WP_000944282.1.92411 WP_000944282.1.92443 WP_000944282.1.92470 WP_000944282.1.92477 WP_000944282.1.92482 WP_000944282.1.92531 WP_000944282.1.92545 WP_000944282.1.92570 WP_000944282.1.92575 WP_000944282.1.92588 WP_000944282.1.926 WP_000944282.1.92633 WP_000944282.1.92649 WP_000944282.1.92669 WP_000944282.1.92671 WP_000944282.1.92676 WP_000944282.1.92705 WP_000944282.1.9271 WP_000944282.1.92729 WP_000944282.1.92734 WP_000944282.1.92738 WP_000944282.1.92758 WP_000944282.1.92810 WP_000944282.1.92823 WP_000944282.1.92879 WP_000944282.1.92975 WP_000944282.1.92987 WP_000944282.1.93007 WP_000944282.1.93022 WP_000944282.1.93086 WP_000944282.1.93101 WP_000944282.1.93103 WP_000944282.1.93105 WP_000944282.1.93111 WP_000944282.1.93121 WP_000944282.1.93136 WP_000944282.1.93155 WP_000944282.1.93168 WP_000944282.1.93184 WP_000944282.1.93213 WP_000944282.1.93221 WP_000944282.1.93223 WP_000944282.1.93239 WP_000944282.1.93275 WP_000944282.1.93302 WP_000944282.1.93322 WP_000944282.1.9336 WP_000944282.1.93365 WP_000944282.1.93376 WP_000944282.1.93387 WP_000944282.1.93469 WP_000944282.1.93511 WP_000944282.1.93512 WP_000944282.1.93543 WP_000944282.1.93604 WP_000944282.1.93635 WP_000944282.1.93650 WP_000944282.1.93656 WP_000944282.1.93657 WP_000944282.1.93662 WP_000944282.1.93691 WP_000944282.1.937 WP_000944282.1.93705 WP_000944282.1.9374 WP_000944282.1.93741 WP_000944282.1.9375 WP_000944282.1.93754 WP_000944282.1.93780 WP_000944282.1.93804 WP_000944282.1.93828 WP_000944282.1.93837 WP_000944282.1.93842 WP_000944282.1.93843 WP_000944282.1.93875 WP_000944282.1.9389 WP_000944282.1.93909 WP_000944282.1.93919 WP_000944282.1.93938 WP_000944282.1.93984 WP_000944282.1.93986 WP_000944282.1.9399 WP_000944282.1.93994 WP_000944282.1.94017 WP_000944282.1.94039 WP_000944282.1.94064 WP_000944282.1.94070 WP_000944282.1.94072 WP_000944282.1.94079 WP_000944282.1.94097 WP_000944282.1.94107 WP_000944282.1.94132 WP_000944282.1.94142 WP_000944282.1.94162 WP_000944282.1.94167 WP_000944282.1.94168 WP_000944282.1.94181 WP_000944282.1.94198 WP_000944282.1.94215 WP_000944282.1.94303 WP_000944282.1.9432 WP_000944282.1.94354 WP_000944282.1.94365 WP_000944282.1.94379 WP_000944282.1.94380 WP_000944282.1.94383 WP_000944282.1.94390 WP_000944282.1.94415 WP_000944282.1.94458 WP_000944282.1.94492 WP_000944282.1.94510 WP_000944282.1.94527 WP_000944282.1.94557 WP_000944282.1.94562 WP_000944282.1.94565 WP_000944282.1.94573 WP_000944282.1.94579 WP_000944282.1.94584 WP_000944282.1.94586 WP_000944282.1.94593 WP_000944282.1.94650 WP_000944282.1.94659 WP_000944282.1.94662 WP_000944282.1.94669 WP_000944282.1.94674 WP_000944282.1.94700 WP_000944282.1.94722 WP_000944282.1.94745 WP_000944282.1.94782 WP_000944282.1.94785 WP_000944282.1.94796 WP_000944282.1.94798 WP_000944282.1.94815 WP_000944282.1.94817 WP_000944282.1.94820 WP_000944282.1.94850 WP_000944282.1.94851 WP_000944282.1.94862 WP_000944282.1.94864 WP_000944282.1.94947 WP_000944282.1.94952 WP_000944282.1.94959 WP_000944282.1.94967 WP_000944282.1.94982 WP_000944282.1.95006 WP_000944282.1.95051 WP_000944282.1.95055 WP_000944282.1.95076 WP_000944282.1.95085 WP_000944282.1.95094 WP_000944282.1.95099 WP_000944282.1.95121 WP_000944282.1.95152 WP_000944282.1.95165 WP_000944282.1.95171 WP_000944282.1.95239 WP_000944282.1.95246 WP_000944282.1.95249 WP_000944282.1.9525 WP_000944282.1.95255 WP_000944282.1.95265 WP_000944282.1.95282 WP_000944282.1.95289 WP_000944282.1.95298 WP_000944282.1.9530 WP_000944282.1.95320 WP_000944282.1.95338 WP_000944282.1.95404 WP_000944282.1.95412 WP_000944282.1.95530 WP_000944282.1.95546 WP_000944282.1.95547 WP_000944282.1.95579 WP_000944282.1.95590 WP_000944282.1.95625 WP_000944282.1.95630 WP_000944282.1.95641 WP_000944282.1.95675 WP_000944282.1.95701 WP_000944282.1.95716 WP_000944282.1.9574 WP_000944282.1.95776 WP_000944282.1.95805 WP_000944282.1.95826 WP_000944282.1.95884 WP_000944282.1.95890 WP_000944282.1.95906 WP_000944282.1.95911 WP_000944282.1.95940 WP_000944282.1.96025 WP_000944282.1.96044 WP_000944282.1.96045 WP_000944282.1.96054 WP_000944282.1.96094 WP_000944282.1.96127 WP_000944282.1.96139 WP_000944282.1.96144 WP_000944282.1.96188 WP_000944282.1.96190 WP_000944282.1.96203 WP_000944282.1.96211 WP_000944282.1.96212 WP_000944282.1.96317 WP_000944282.1.96319 WP_000944282.1.9633 WP_000944282.1.96335 WP_000944282.1.96343 WP_000944282.1.96359 WP_000944282.1.96429 WP_000944282.1.9644 WP_000944282.1.96469 WP_000944282.1.96497 WP_000944282.1.96500 WP_000944282.1.96533 WP_000944282.1.96539 WP_000944282.1.96552 WP_000944282.1.96555 WP_000944282.1.96563 WP_000944282.1.96600 WP_000944282.1.96610 WP_000944282.1.96625 WP_000944282.1.96635 WP_000944282.1.9664 WP_000944282.1.96640 WP_000944282.1.96662 WP_000944282.1.96675 WP_000944282.1.9670 WP_000944282.1.96732 WP_000944282.1.96750 WP_000944282.1.96758 WP_000944282.1.96771 WP_000944282.1.96792 WP_000944282.1.96801 WP_000944282.1.96803 WP_000944282.1.96810 WP_000944282.1.9686 WP_000944282.1.96890 WP_000944282.1.96902 WP_000944282.1.96925 WP_000944282.1.96938 WP_000944282.1.96946 WP_000944282.1.96957 WP_000944282.1.96978 WP_000944282.1.97015 WP_000944282.1.97026 WP_000944282.1.97028 WP_000944282.1.97079 WP_000944282.1.97089 WP_000944282.1.97145 WP_000944282.1.97154 WP_000944282.1.97184 WP_000944282.1.97185 WP_000944282.1.97190 WP_000944282.1.97224 WP_000944282.1.97287 WP_000944282.1.97291 WP_000944282.1.97318 WP_000944282.1.97337 WP_000944282.1.97368 WP_000944282.1.97369 WP_000944282.1.97386 WP_000944282.1.97413 WP_000944282.1.97422 WP_000944282.1.97441 WP_000944282.1.97480 WP_000944282.1.97497 WP_000944282.1.97505 WP_000944282.1.97594 WP_000944282.1.97597 WP_000944282.1.97599 WP_000944282.1.97606 WP_000944282.1.97613 WP_000944282.1.97615 WP_000944282.1.97620 WP_000944282.1.97626 WP_000944282.1.97628 WP_000944282.1.97646 WP_000944282.1.97690 WP_000944282.1.97691 WP_000944282.1.97693 WP_000944282.1.97725 WP_000944282.1.97727 WP_000944282.1.97732 WP_000944282.1.97736 WP_000944282.1.9775 WP_000944282.1.97768 WP_000944282.1.97772 WP_000944282.1.97800 WP_000944282.1.97819 WP_000944282.1.97840 WP_000944282.1.97846 WP_000944282.1.97873 WP_000944282.1.97938 WP_000944282.1.97983 WP_000944282.1.97986 WP_000944282.1.98006 WP_000944282.1.98019 WP_000944282.1.98022 WP_000944282.1.98036 WP_000944282.1.9805 WP_000944282.1.98080 WP_000944282.1.98086 WP_000944282.1.98107 WP_000944282.1.9811 WP_000944282.1.98110 WP_000944282.1.98146 WP_000944282.1.98158 WP_000944282.1.98201 WP_000944282.1.98219 WP_000944282.1.98263 WP_000944282.1.98314 WP_000944282.1.98392 WP_000944282.1.9841 WP_000944282.1.98418 WP_000944282.1.98438 WP_000944282.1.98446 WP_000944282.1.98448 WP_000944282.1.98457 WP_000944282.1.98483 WP_000944282.1.98495 WP_000944282.1.9850 WP_000944282.1.98502 WP_000944282.1.98531 WP_000944282.1.98577 WP_000944282.1.98607 WP_000944282.1.98627 WP_000944282.1.98676 WP_000944282.1.98677 WP_000944282.1.98760 WP_000944282.1.98762 WP_000944282.1.9877 WP_000944282.1.98779 WP_000944282.1.98801 WP_000944282.1.98818 WP_000944282.1.98843 WP_000944282.1.98899 WP_000944282.1.98931 WP_000944282.1.9898 WP_000944282.1.99071 WP_000944282.1.99072 WP_000944282.1.99098 WP_000944282.1.99163 WP_000944282.1.99184 WP_000944282.1.9919 WP_000944282.1.99197 WP_000944282.1.99219 WP_000944282.1.99255 WP_000944282.1.99276 WP_000944282.1.99327 WP_000944282.1.99335 WP_000944282.1.99339 WP_000944282.1.99350 WP_000944282.1.99360 WP_000944282.1.99363 WP_000944282.1.99369 WP_000944282.1.99370 WP_000944282.1.99388 WP_000944282.1.99397 WP_000944282.1.99426 WP_000944282.1.99463 WP_000944282.1.99469 WP_000944282.1.99483 WP_000944282.1.9954 WP_000944282.1.99546 WP_000944282.1.99579 WP_000944282.1.99595 WP_000944282.1.99646 WP_000944282.1.99657 WP_000944282.1.99660 WP_000944282.1.99671 WP_000944282.1.99676 WP_000944282.1.99712 WP_000944282.1.99764 WP_000944282.1.99783 WP_000944282.1.99813 WP_000944282.1.99829 WP_000944282.1.99837 WP_000944282.1.99841 WP_000944282.1.99858 WP_000944282.1.99889 WP_000944282.1.9992 WP_000944282.1.99958 WP_000944282.1.99996 gi|482903696|ref|YP_007902256.1| gi|409249788|ref|YP_006885603.1| gi|379701063|ref|YP_005242791.1| 209261.t0999 220341.STY2084 321314.SC1883 476213.SPC_1838 99287.STM1878 gi|538362496|ref|YP_008505781.1| gi|224583619|ref|YP_002637417.1| ABAK02000001|CDS_1351841-1352539 ABAM02000001|CDS_2430999-2431697 ABAO01000029|CDS_42111-42809 ABEI01000019|CDS_69298-69996 ABFF01000008|CDS_154617-155315 ABFG01000001|CDS_353183-352485 ABFH02000002|CDS_120949-120251 AE006468|CDS_1971072-1971770 AE014613|CDS_1089772-1089074 AE017220|CDS_1992331-1993029 AL513382|CDS_1936709-1937407 CP000857|CDS_1900395-1899697 CP001363|CDS_1982477-1983175 FN424405|CDS_1954583-1955281 NZ_ACBF01000010|CDS_62244-61546 gi|549724504|ref|YP_008644694.1| gi|383496558|ref|YP_005397247.1| gi|550901277|ref|YP_008670369.1| gi|378445270|ref|YP_005232902.1| gi|378699751|ref|YP_005181708.1| gi|62180453|ref|YP_216870.1| gi|525837997|ref|YP_008254916.1| gi|29141480|ref|NP_804822.1| gi|378450478|ref|YP_005237837.1| gi|549479610|ref|YP_008613660.1| gi|378989225|ref|YP_005252389.1| gi|526220459|ref|YP_008266085.1| gi|378959156|ref|YP_005216642.1| gi|525947059|ref|YP_008308341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]