SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450503|ref|YP_005237862.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450503|ref|YP_005237862.1|
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.67e-57
Family RuvC resolvase 0.0000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450503|ref|YP_005237862.1|
Sequence length 173
Comment Holliday junction resolvase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSIILGIDPGSRITGYGVIRQVGRQLTYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQ
PDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKS
QVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR
Download sequence
Identical sequences A0A083ZC67 A0A0F6B2M7 A0A0F7J7D3 A0A0G2NMK4 A0A0H3NMD3 A0A0J5GZ25 A0A0L5XC37 A0A0M0QSZ5 A0A0M3E4E9 A0A0R9PKW9 A0A0U1IMI5 A0A1C3A270 A0A1I0WZ17 A0A1R2V9S1 A0A1S0ZFN3 A0A1S1ARD7 A0A1X2RNT7 A0A1X2UP91 A0A1X2YDX6 A0A1Z3QDV8 A0A212HMV2 A0A212HYV3 A0A221YLV1 A0A221YZ45 A0A265B5J1 A0A267SIX8 A0A271CKY7 A0A271CUL9 A0A2C6FSK2 A0A2C9NYE5 A0A2D1XDG2 A0A2D1XQV4 A0A2D3TV59 A0A2G1P786 A0A2H9YCE3 A0A2I6M760 A0A2I6MYI5 A0A2I6NCN7 A0A2I6NQD2 A0A2I6P392 A0A2K2ZXK3 B4SVE8 B4T7Z6 B4TYS1 B5BH57 B5F3J2 B5R1V5 B5R8D9 E8X9G5 G4C1Z7 G5L7W4 G5MH53 G5NBQ2 G5PLK9 G5Q1C0 G5QGJ4 G5QYN4 G5REE2 G5RU52 G5S9W6 P66762 P66763 Q5PN00 S4KAW0 S5HL69 V1VZC3 V7III0 V7UI56
gi|563652688|ref|YP_008860750.1| gi|207856581|ref|YP_002243232.1| gi|525817794|ref|YP_008247812.1| gi|378450503|ref|YP_005237862.1| gi|378984464|ref|YP_005247619.1| gi|197362109|ref|YP_002141746.1| gi|452119903|ref|YP_007470151.1| gi|528819710|ref|YP_008360913.1| gi|379701083|ref|YP_005242811.1| NP_456465.1.84458 NP_460855.1.58477 WP_000022509.1.100002 WP_000022509.1.100007 WP_000022509.1.100008 WP_000022509.1.100010 WP_000022509.1.100031 WP_000022509.1.100036 WP_000022509.1.100077 WP_000022509.1.100079 WP_000022509.1.10013 WP_000022509.1.100149 WP_000022509.1.100165 WP_000022509.1.100191 WP_000022509.1.100196 WP_000022509.1.1002 WP_000022509.1.100234 WP_000022509.1.100258 WP_000022509.1.100266 WP_000022509.1.100284 WP_000022509.1.100288 WP_000022509.1.100313 WP_000022509.1.100314 WP_000022509.1.100321 WP_000022509.1.100354 WP_000022509.1.100376 WP_000022509.1.100392 WP_000022509.1.100412 WP_000022509.1.100413 WP_000022509.1.100421 WP_000022509.1.100424 WP_000022509.1.100432 WP_000022509.1.100436 WP_000022509.1.100438 WP_000022509.1.100446 WP_000022509.1.100450 WP_000022509.1.100457 WP_000022509.1.100472 WP_000022509.1.100484 WP_000022509.1.100488 WP_000022509.1.100502 WP_000022509.1.100521 WP_000022509.1.100541 WP_000022509.1.100557 WP_000022509.1.100589 WP_000022509.1.100592 WP_000022509.1.100597 WP_000022509.1.100605 WP_000022509.1.100610 WP_000022509.1.100642 WP_000022509.1.10065 WP_000022509.1.100650 WP_000022509.1.100711 WP_000022509.1.100714 WP_000022509.1.100721 WP_000022509.1.100730 WP_000022509.1.100732 WP_000022509.1.100733 WP_000022509.1.100739 WP_000022509.1.10074 WP_000022509.1.10076 WP_000022509.1.100764 WP_000022509.1.100773 WP_000022509.1.100776 WP_000022509.1.100781 WP_000022509.1.100790 WP_000022509.1.100793 WP_000022509.1.100799 WP_000022509.1.10081 WP_000022509.1.100814 WP_000022509.1.100857 WP_000022509.1.100865 WP_000022509.1.100869 WP_000022509.1.100871 WP_000022509.1.100882 WP_000022509.1.100886 WP_000022509.1.100895 WP_000022509.1.100932 WP_000022509.1.100941 WP_000022509.1.100944 WP_000022509.1.100948 WP_000022509.1.100953 WP_000022509.1.100954 WP_000022509.1.101007 WP_000022509.1.101011 WP_000022509.1.101020 WP_000022509.1.101074 WP_000022509.1.101078 WP_000022509.1.10108 WP_000022509.1.101091 WP_000022509.1.101094 WP_000022509.1.101111 WP_000022509.1.101112 WP_000022509.1.101123 WP_000022509.1.101126 WP_000022509.1.101147 WP_000022509.1.101171 WP_000022509.1.101180 WP_000022509.1.101199 WP_000022509.1.101223 WP_000022509.1.101226 WP_000022509.1.101239 WP_000022509.1.10124 WP_000022509.1.101259 WP_000022509.1.101271 WP_000022509.1.101284 WP_000022509.1.101291 WP_000022509.1.1013 WP_000022509.1.101312 WP_000022509.1.101320 WP_000022509.1.101322 WP_000022509.1.101353 WP_000022509.1.101374 WP_000022509.1.101386 WP_000022509.1.101404 WP_000022509.1.101420 WP_000022509.1.101425 WP_000022509.1.101454 WP_000022509.1.101473 WP_000022509.1.101519 WP_000022509.1.101520 WP_000022509.1.101541 WP_000022509.1.101589 WP_000022509.1.101609 WP_000022509.1.101612 WP_000022509.1.101616 WP_000022509.1.101634 WP_000022509.1.101636 WP_000022509.1.101639 WP_000022509.1.10164 WP_000022509.1.101666 WP_000022509.1.101674 WP_000022509.1.101707 WP_000022509.1.101724 WP_000022509.1.101734 WP_000022509.1.101740 WP_000022509.1.101744 WP_000022509.1.101759 WP_000022509.1.10177 WP_000022509.1.101776 WP_000022509.1.101815 WP_000022509.1.101832 WP_000022509.1.101839 WP_000022509.1.101868 WP_000022509.1.101878 WP_000022509.1.101890 WP_000022509.1.101904 WP_000022509.1.101917 WP_000022509.1.101941 WP_000022509.1.101949 WP_000022509.1.101953 WP_000022509.1.101975 WP_000022509.1.102009 WP_000022509.1.102050 WP_000022509.1.102087 WP_000022509.1.102103 WP_000022509.1.102111 WP_000022509.1.10220 WP_000022509.1.10231 WP_000022509.1.10237 WP_000022509.1.10266 WP_000022509.1.10276 WP_000022509.1.10293 WP_000022509.1.10300 WP_000022509.1.10338 WP_000022509.1.1038 WP_000022509.1.10394 WP_000022509.1.104 WP_000022509.1.10401 WP_000022509.1.10428 WP_000022509.1.10429 WP_000022509.1.10439 WP_000022509.1.10459 WP_000022509.1.10463 WP_000022509.1.10465 WP_000022509.1.10475 WP_000022509.1.10498 WP_000022509.1.10507 WP_000022509.1.10511 WP_000022509.1.10514 WP_000022509.1.10530 WP_000022509.1.10532 WP_000022509.1.10547 WP_000022509.1.10562 WP_000022509.1.10566 WP_000022509.1.10568 WP_000022509.1.10595 WP_000022509.1.106 WP_000022509.1.10631 WP_000022509.1.10642 WP_000022509.1.10654 WP_000022509.1.10675 WP_000022509.1.10677 WP_000022509.1.10678 WP_000022509.1.10711 WP_000022509.1.10720 WP_000022509.1.10753 WP_000022509.1.10755 WP_000022509.1.10797 WP_000022509.1.10857 WP_000022509.1.10868 WP_000022509.1.10873 WP_000022509.1.10898 WP_000022509.1.10926 WP_000022509.1.10936 WP_000022509.1.10992 WP_000022509.1.11000 WP_000022509.1.11012 WP_000022509.1.11024 WP_000022509.1.11031 WP_000022509.1.11041 WP_000022509.1.11055 WP_000022509.1.11098 WP_000022509.1.1110 WP_000022509.1.11119 WP_000022509.1.11126 WP_000022509.1.11142 WP_000022509.1.11156 WP_000022509.1.11168 WP_000022509.1.11190 WP_000022509.1.11213 WP_000022509.1.11216 WP_000022509.1.11239 WP_000022509.1.11253 WP_000022509.1.11295 WP_000022509.1.113 WP_000022509.1.11314 WP_000022509.1.1135 WP_000022509.1.11362 WP_000022509.1.11369 WP_000022509.1.1137 WP_000022509.1.11385 WP_000022509.1.11405 WP_000022509.1.1142 WP_000022509.1.11426 WP_000022509.1.11429 WP_000022509.1.11444 WP_000022509.1.11455 WP_000022509.1.11458 WP_000022509.1.11479 WP_000022509.1.1150 WP_000022509.1.11511 WP_000022509.1.11518 WP_000022509.1.11526 WP_000022509.1.11528 WP_000022509.1.11532 WP_000022509.1.11543 WP_000022509.1.11544 WP_000022509.1.11557 WP_000022509.1.1156 WP_000022509.1.11565 WP_000022509.1.11567 WP_000022509.1.11588 WP_000022509.1.11603 WP_000022509.1.11621 WP_000022509.1.11638 WP_000022509.1.11677 WP_000022509.1.11687 WP_000022509.1.1169 WP_000022509.1.11735 WP_000022509.1.1174 WP_000022509.1.11763 WP_000022509.1.11772 WP_000022509.1.11810 WP_000022509.1.11824 WP_000022509.1.11834 WP_000022509.1.11841 WP_000022509.1.11865 WP_000022509.1.11868 WP_000022509.1.11883 WP_000022509.1.11897 WP_000022509.1.11900 WP_000022509.1.11908 WP_000022509.1.11914 WP_000022509.1.11936 WP_000022509.1.11938 WP_000022509.1.11964 WP_000022509.1.11978 WP_000022509.1.12007 WP_000022509.1.12017 WP_000022509.1.12025 WP_000022509.1.12027 WP_000022509.1.12040 WP_000022509.1.12047 WP_000022509.1.12059 WP_000022509.1.12061 WP_000022509.1.12063 WP_000022509.1.1207 WP_000022509.1.12106 WP_000022509.1.12114 WP_000022509.1.12141 WP_000022509.1.12144 WP_000022509.1.1215 WP_000022509.1.12159 WP_000022509.1.12160 WP_000022509.1.12168 WP_000022509.1.12172 WP_000022509.1.12192 WP_000022509.1.12210 WP_000022509.1.1224 WP_000022509.1.12282 WP_000022509.1.12308 WP_000022509.1.12340 WP_000022509.1.12351 WP_000022509.1.12364 WP_000022509.1.12370 WP_000022509.1.12374 WP_000022509.1.12396 WP_000022509.1.12398 WP_000022509.1.12441 WP_000022509.1.12456 WP_000022509.1.1246 WP_000022509.1.12472 WP_000022509.1.12484 WP_000022509.1.12485 WP_000022509.1.1250 WP_000022509.1.12546 WP_000022509.1.12568 WP_000022509.1.12569 WP_000022509.1.12581 WP_000022509.1.12585 WP_000022509.1.12620 WP_000022509.1.1264 WP_000022509.1.12648 WP_000022509.1.12650 WP_000022509.1.12683 WP_000022509.1.12696 WP_000022509.1.12701 WP_000022509.1.12726 WP_000022509.1.12727 WP_000022509.1.12728 WP_000022509.1.12741 WP_000022509.1.12834 WP_000022509.1.12864 WP_000022509.1.12865 WP_000022509.1.12877 WP_000022509.1.12879 WP_000022509.1.12936 WP_000022509.1.12964 WP_000022509.1.1299 WP_000022509.1.12995 WP_000022509.1.1300 WP_000022509.1.13027 WP_000022509.1.13076 WP_000022509.1.13102 WP_000022509.1.13106 WP_000022509.1.13108 WP_000022509.1.13130 WP_000022509.1.13161 WP_000022509.1.13207 WP_000022509.1.1321 WP_000022509.1.13247 WP_000022509.1.1326 WP_000022509.1.13262 WP_000022509.1.13268 WP_000022509.1.13274 WP_000022509.1.13291 WP_000022509.1.133 WP_000022509.1.13311 WP_000022509.1.13314 WP_000022509.1.13334 WP_000022509.1.13338 WP_000022509.1.13342 WP_000022509.1.13352 WP_000022509.1.13367 WP_000022509.1.13391 WP_000022509.1.13406 WP_000022509.1.13414 WP_000022509.1.13429 WP_000022509.1.13440 WP_000022509.1.13443 WP_000022509.1.13446 WP_000022509.1.1346 WP_000022509.1.13476 WP_000022509.1.13488 WP_000022509.1.13509 WP_000022509.1.13528 WP_000022509.1.13543 WP_000022509.1.13573 WP_000022509.1.13599 WP_000022509.1.13602 WP_000022509.1.13625 WP_000022509.1.13661 WP_000022509.1.13669 WP_000022509.1.13686 WP_000022509.1.13691 WP_000022509.1.1372 WP_000022509.1.13732 WP_000022509.1.13741 WP_000022509.1.13750 WP_000022509.1.13764 WP_000022509.1.13799 WP_000022509.1.13819 WP_000022509.1.1382 WP_000022509.1.13827 WP_000022509.1.13829 WP_000022509.1.13848 WP_000022509.1.13857 WP_000022509.1.1387 WP_000022509.1.13908 WP_000022509.1.13932 WP_000022509.1.13967 WP_000022509.1.13968 WP_000022509.1.1397 WP_000022509.1.13972 WP_000022509.1.140 WP_000022509.1.14001 WP_000022509.1.1401 WP_000022509.1.14011 WP_000022509.1.14041 WP_000022509.1.14050 WP_000022509.1.14056 WP_000022509.1.1408 WP_000022509.1.14089 WP_000022509.1.14099 WP_000022509.1.14111 WP_000022509.1.1412 WP_000022509.1.14120 WP_000022509.1.14123 WP_000022509.1.14150 WP_000022509.1.14151 WP_000022509.1.14191 WP_000022509.1.14197 WP_000022509.1.14212 WP_000022509.1.14239 WP_000022509.1.14280 WP_000022509.1.14296 WP_000022509.1.14320 WP_000022509.1.14333 WP_000022509.1.14369 WP_000022509.1.14379 WP_000022509.1.14399 WP_000022509.1.1440 WP_000022509.1.14406 WP_000022509.1.14410 WP_000022509.1.14436 WP_000022509.1.14444 WP_000022509.1.14446 WP_000022509.1.14458 WP_000022509.1.14466 WP_000022509.1.14467 WP_000022509.1.14474 WP_000022509.1.14495 WP_000022509.1.14500 WP_000022509.1.14505 WP_000022509.1.14519 WP_000022509.1.14524 WP_000022509.1.14526 WP_000022509.1.14528 WP_000022509.1.14550 WP_000022509.1.14554 WP_000022509.1.14575 WP_000022509.1.146 WP_000022509.1.14618 WP_000022509.1.14701 WP_000022509.1.14703 WP_000022509.1.14706 WP_000022509.1.14708 WP_000022509.1.14719 WP_000022509.1.14725 WP_000022509.1.1473 WP_000022509.1.14737 WP_000022509.1.14765 WP_000022509.1.14793 WP_000022509.1.14810 WP_000022509.1.14819 WP_000022509.1.14852 WP_000022509.1.14876 WP_000022509.1.14877 WP_000022509.1.14884 WP_000022509.1.1489 WP_000022509.1.14894 WP_000022509.1.14913 WP_000022509.1.14917 WP_000022509.1.14927 WP_000022509.1.14930 WP_000022509.1.14932 WP_000022509.1.14936 WP_000022509.1.14947 WP_000022509.1.14948 WP_000022509.1.14964 WP_000022509.1.15011 WP_000022509.1.15046 WP_000022509.1.15054 WP_000022509.1.15055 WP_000022509.1.15059 WP_000022509.1.15067 WP_000022509.1.15079 WP_000022509.1.15100 WP_000022509.1.15124 WP_000022509.1.15184 WP_000022509.1.15223 WP_000022509.1.15226 WP_000022509.1.15244 WP_000022509.1.15265 WP_000022509.1.15276 WP_000022509.1.15316 WP_000022509.1.15318 WP_000022509.1.15362 WP_000022509.1.15369 WP_000022509.1.1540 WP_000022509.1.15415 WP_000022509.1.15423 WP_000022509.1.15433 WP_000022509.1.15439 WP_000022509.1.15479 WP_000022509.1.15483 WP_000022509.1.15487 WP_000022509.1.15508 WP_000022509.1.1551 WP_000022509.1.15535 WP_000022509.1.15581 WP_000022509.1.15585 WP_000022509.1.15586 WP_000022509.1.15597 WP_000022509.1.15616 WP_000022509.1.15625 WP_000022509.1.15627 WP_000022509.1.15644 WP_000022509.1.1568 WP_000022509.1.15708 WP_000022509.1.15710 WP_000022509.1.15717 WP_000022509.1.15777 WP_000022509.1.15784 WP_000022509.1.15795 WP_000022509.1.158 WP_000022509.1.15830 WP_000022509.1.15835 WP_000022509.1.15862 WP_000022509.1.15881 WP_000022509.1.15905 WP_000022509.1.15909 WP_000022509.1.15910 WP_000022509.1.15912 WP_000022509.1.1592 WP_000022509.1.15922 WP_000022509.1.15938 WP_000022509.1.15970 WP_000022509.1.15978 WP_000022509.1.15986 WP_000022509.1.15995 WP_000022509.1.16000 WP_000022509.1.16004 WP_000022509.1.16006 WP_000022509.1.1601 WP_000022509.1.16046 WP_000022509.1.16047 WP_000022509.1.16051 WP_000022509.1.16058 WP_000022509.1.16062 WP_000022509.1.16063 WP_000022509.1.16103 WP_000022509.1.1611 WP_000022509.1.16125 WP_000022509.1.16150 WP_000022509.1.16155 WP_000022509.1.16158 WP_000022509.1.16166 WP_000022509.1.16201 WP_000022509.1.16226 WP_000022509.1.16233 WP_000022509.1.1626 WP_000022509.1.16264 WP_000022509.1.16273 WP_000022509.1.16284 WP_000022509.1.16328 WP_000022509.1.16331 WP_000022509.1.16344 WP_000022509.1.1635 WP_000022509.1.16361 WP_000022509.1.16363 WP_000022509.1.16365 WP_000022509.1.16366 WP_000022509.1.16394 WP_000022509.1.16452 WP_000022509.1.16453 WP_000022509.1.16461 WP_000022509.1.16462 WP_000022509.1.16465 WP_000022509.1.16468 WP_000022509.1.16474 WP_000022509.1.16508 WP_000022509.1.16522 WP_000022509.1.16525 WP_000022509.1.16551 WP_000022509.1.16565 WP_000022509.1.16581 WP_000022509.1.16588 WP_000022509.1.16614 WP_000022509.1.16650 WP_000022509.1.16656 WP_000022509.1.16658 WP_000022509.1.16666 WP_000022509.1.16673 WP_000022509.1.1668 WP_000022509.1.16686 WP_000022509.1.16691 WP_000022509.1.167 WP_000022509.1.16710 WP_000022509.1.16729 WP_000022509.1.16732 WP_000022509.1.16735 WP_000022509.1.16736 WP_000022509.1.1674 WP_000022509.1.16767 WP_000022509.1.16781 WP_000022509.1.16786 WP_000022509.1.16804 WP_000022509.1.16817 WP_000022509.1.16826 WP_000022509.1.16846 WP_000022509.1.16855 WP_000022509.1.16858 WP_000022509.1.16873 WP_000022509.1.16879 WP_000022509.1.1689 WP_000022509.1.16893 WP_000022509.1.16896 WP_000022509.1.16903 WP_000022509.1.16905 WP_000022509.1.16910 WP_000022509.1.16916 WP_000022509.1.16941 WP_000022509.1.16942 WP_000022509.1.16944 WP_000022509.1.16948 WP_000022509.1.16949 WP_000022509.1.16965 WP_000022509.1.16972 WP_000022509.1.16998 WP_000022509.1.1700 WP_000022509.1.17031 WP_000022509.1.17049 WP_000022509.1.17058 WP_000022509.1.17060 WP_000022509.1.17078 WP_000022509.1.17093 WP_000022509.1.17096 WP_000022509.1.17098 WP_000022509.1.17105 WP_000022509.1.17188 WP_000022509.1.17202 WP_000022509.1.17219 WP_000022509.1.1722 WP_000022509.1.17270 WP_000022509.1.17285 WP_000022509.1.17302 WP_000022509.1.17307 WP_000022509.1.17308 WP_000022509.1.1733 WP_000022509.1.17368 WP_000022509.1.1737 WP_000022509.1.174 WP_000022509.1.17405 WP_000022509.1.17406 WP_000022509.1.17439 WP_000022509.1.17447 WP_000022509.1.17480 WP_000022509.1.17482 WP_000022509.1.1749 WP_000022509.1.17513 WP_000022509.1.17525 WP_000022509.1.17543 WP_000022509.1.17546 WP_000022509.1.17560 WP_000022509.1.17563 WP_000022509.1.1757 WP_000022509.1.17578 WP_000022509.1.17583 WP_000022509.1.17622 WP_000022509.1.17659 WP_000022509.1.17667 WP_000022509.1.17686 WP_000022509.1.17702 WP_000022509.1.17703 WP_000022509.1.17705 WP_000022509.1.17732 WP_000022509.1.17741 WP_000022509.1.17743 WP_000022509.1.17747 WP_000022509.1.17755 WP_000022509.1.17840 WP_000022509.1.17865 WP_000022509.1.17886 WP_000022509.1.17891 WP_000022509.1.17901 WP_000022509.1.17914 WP_000022509.1.17936 WP_000022509.1.17949 WP_000022509.1.17956 WP_000022509.1.1798 WP_000022509.1.17991 WP_000022509.1.18005 WP_000022509.1.1801 WP_000022509.1.18019 WP_000022509.1.18021 WP_000022509.1.18022 WP_000022509.1.18056 WP_000022509.1.18061 WP_000022509.1.1807 WP_000022509.1.18089 WP_000022509.1.18092 WP_000022509.1.18099 WP_000022509.1.18103 WP_000022509.1.18109 WP_000022509.1.18111 WP_000022509.1.18122 WP_000022509.1.18124 WP_000022509.1.1814 WP_000022509.1.18144 WP_000022509.1.18149 WP_000022509.1.18163 WP_000022509.1.18173 WP_000022509.1.18177 WP_000022509.1.18178 WP_000022509.1.1818 WP_000022509.1.18192 WP_000022509.1.18249 WP_000022509.1.1825 WP_000022509.1.18254 WP_000022509.1.18265 WP_000022509.1.18267 WP_000022509.1.18270 WP_000022509.1.18277 WP_000022509.1.18280 WP_000022509.1.18281 WP_000022509.1.18282 WP_000022509.1.18328 WP_000022509.1.18355 WP_000022509.1.18358 WP_000022509.1.18365 WP_000022509.1.18370 WP_000022509.1.18384 WP_000022509.1.18406 WP_000022509.1.18426 WP_000022509.1.18441 WP_000022509.1.18445 WP_000022509.1.18468 WP_000022509.1.18474 WP_000022509.1.18485 WP_000022509.1.18489 WP_000022509.1.18513 WP_000022509.1.18607 WP_000022509.1.18610 WP_000022509.1.18641 WP_000022509.1.18678 WP_000022509.1.18686 WP_000022509.1.18692 WP_000022509.1.18705 WP_000022509.1.18715 WP_000022509.1.18722 WP_000022509.1.18737 WP_000022509.1.18766 WP_000022509.1.18776 WP_000022509.1.1880 WP_000022509.1.18822 WP_000022509.1.18847 WP_000022509.1.1885 WP_000022509.1.18860 WP_000022509.1.18881 WP_000022509.1.18886 WP_000022509.1.18895 WP_000022509.1.18919 WP_000022509.1.18922 WP_000022509.1.18940 WP_000022509.1.18949 WP_000022509.1.1895 WP_000022509.1.18959 WP_000022509.1.1897 WP_000022509.1.18972 WP_000022509.1.19001 WP_000022509.1.19006 WP_000022509.1.19030 WP_000022509.1.19038 WP_000022509.1.19044 WP_000022509.1.19053 WP_000022509.1.19055 WP_000022509.1.19064 WP_000022509.1.19084 WP_000022509.1.19093 WP_000022509.1.19163 WP_000022509.1.19174 WP_000022509.1.19187 WP_000022509.1.19228 WP_000022509.1.19240 WP_000022509.1.19273 WP_000022509.1.19288 WP_000022509.1.19291 WP_000022509.1.19300 WP_000022509.1.19320 WP_000022509.1.19340 WP_000022509.1.19357 WP_000022509.1.19373 WP_000022509.1.1939 WP_000022509.1.19405 WP_000022509.1.19422 WP_000022509.1.19433 WP_000022509.1.19454 WP_000022509.1.19456 WP_000022509.1.19460 WP_000022509.1.19461 WP_000022509.1.19469 WP_000022509.1.19496 WP_000022509.1.19535 WP_000022509.1.19538 WP_000022509.1.1954 WP_000022509.1.1955 WP_000022509.1.19588 WP_000022509.1.19589 WP_000022509.1.19614 WP_000022509.1.19616 WP_000022509.1.19642 WP_000022509.1.19656 WP_000022509.1.19660 WP_000022509.1.19663 WP_000022509.1.1968 WP_000022509.1.19683 WP_000022509.1.19686 WP_000022509.1.19702 WP_000022509.1.19706 WP_000022509.1.19723 WP_000022509.1.19724 WP_000022509.1.19731 WP_000022509.1.19740 WP_000022509.1.19749 WP_000022509.1.19784 WP_000022509.1.19793 WP_000022509.1.19794 WP_000022509.1.19802 WP_000022509.1.19809 WP_000022509.1.19823 WP_000022509.1.19834 WP_000022509.1.19851 WP_000022509.1.19863 WP_000022509.1.19867 WP_000022509.1.19882 WP_000022509.1.19884 WP_000022509.1.1990 WP_000022509.1.1992 WP_000022509.1.19938 WP_000022509.1.19967 WP_000022509.1.19970 WP_000022509.1.19975 WP_000022509.1.1998 WP_000022509.1.19987 WP_000022509.1.19999 WP_000022509.1.20 WP_000022509.1.20023 WP_000022509.1.20081 WP_000022509.1.20086 WP_000022509.1.20089 WP_000022509.1.20091 WP_000022509.1.2010 WP_000022509.1.20212 WP_000022509.1.20218 WP_000022509.1.20254 WP_000022509.1.20255 WP_000022509.1.2026 WP_000022509.1.20261 WP_000022509.1.20266 WP_000022509.1.20271 WP_000022509.1.20296 WP_000022509.1.20330 WP_000022509.1.20339 WP_000022509.1.20349 WP_000022509.1.2036 WP_000022509.1.20362 WP_000022509.1.20364 WP_000022509.1.20376 WP_000022509.1.20391 WP_000022509.1.2041 WP_000022509.1.20415 WP_000022509.1.20418 WP_000022509.1.20419 WP_000022509.1.20425 WP_000022509.1.20437 WP_000022509.1.20443 WP_000022509.1.20446 WP_000022509.1.20465 WP_000022509.1.2047 WP_000022509.1.20488 WP_000022509.1.20492 WP_000022509.1.20525 WP_000022509.1.2053 WP_000022509.1.2054 WP_000022509.1.20553 WP_000022509.1.20564 WP_000022509.1.20573 WP_000022509.1.20614 WP_000022509.1.20626 WP_000022509.1.20631 WP_000022509.1.20635 WP_000022509.1.20646 WP_000022509.1.20695 WP_000022509.1.20718 WP_000022509.1.2073 WP_000022509.1.20740 WP_000022509.1.20760 WP_000022509.1.20787 WP_000022509.1.20795 WP_000022509.1.20810 WP_000022509.1.20828 WP_000022509.1.20862 WP_000022509.1.2087 WP_000022509.1.20883 WP_000022509.1.20886 WP_000022509.1.20894 WP_000022509.1.20900 WP_000022509.1.20908 WP_000022509.1.2091 WP_000022509.1.20947 WP_000022509.1.20953 WP_000022509.1.2101 WP_000022509.1.21010 WP_000022509.1.21049 WP_000022509.1.2106 WP_000022509.1.21062 WP_000022509.1.2107 WP_000022509.1.21075 WP_000022509.1.21079 WP_000022509.1.21086 WP_000022509.1.21089 WP_000022509.1.21103 WP_000022509.1.21136 WP_000022509.1.21144 WP_000022509.1.21146 WP_000022509.1.2116 WP_000022509.1.21162 WP_000022509.1.21165 WP_000022509.1.21181 WP_000022509.1.21184 WP_000022509.1.21185 WP_000022509.1.21194 WP_000022509.1.21202 WP_000022509.1.21241 WP_000022509.1.21245 WP_000022509.1.21246 WP_000022509.1.21260 WP_000022509.1.21269 WP_000022509.1.21286 WP_000022509.1.2130 WP_000022509.1.21309 WP_000022509.1.21326 WP_000022509.1.21332 WP_000022509.1.21351 WP_000022509.1.21362 WP_000022509.1.21366 WP_000022509.1.2139 WP_000022509.1.21399 WP_000022509.1.21400 WP_000022509.1.21404 WP_000022509.1.21423 WP_000022509.1.21443 WP_000022509.1.21453 WP_000022509.1.2146 WP_000022509.1.21473 WP_000022509.1.21492 WP_000022509.1.21497 WP_000022509.1.21499 WP_000022509.1.21534 WP_000022509.1.21548 WP_000022509.1.21603 WP_000022509.1.2166 WP_000022509.1.21674 WP_000022509.1.21681 WP_000022509.1.21692 WP_000022509.1.21715 WP_000022509.1.21728 WP_000022509.1.21730 WP_000022509.1.21750 WP_000022509.1.21751 WP_000022509.1.21757 WP_000022509.1.21792 WP_000022509.1.21845 WP_000022509.1.21877 WP_000022509.1.21886 WP_000022509.1.21909 WP_000022509.1.21910 WP_000022509.1.21940 WP_000022509.1.21946 WP_000022509.1.21950 WP_000022509.1.21966 WP_000022509.1.21981 WP_000022509.1.21991 WP_000022509.1.22019 WP_000022509.1.22024 WP_000022509.1.22030 WP_000022509.1.2205 WP_000022509.1.22051 WP_000022509.1.22062 WP_000022509.1.22064 WP_000022509.1.22067 WP_000022509.1.22069 WP_000022509.1.22096 WP_000022509.1.22117 WP_000022509.1.22118 WP_000022509.1.22126 WP_000022509.1.22136 WP_000022509.1.22158 WP_000022509.1.2216 WP_000022509.1.22162 WP_000022509.1.22169 WP_000022509.1.22205 WP_000022509.1.22208 WP_000022509.1.2221 WP_000022509.1.22235 WP_000022509.1.2227 WP_000022509.1.22296 WP_000022509.1.22315 WP_000022509.1.22323 WP_000022509.1.22337 WP_000022509.1.22346 WP_000022509.1.2235 WP_000022509.1.22373 WP_000022509.1.22379 WP_000022509.1.22388 WP_000022509.1.22427 WP_000022509.1.22449 WP_000022509.1.22451 WP_000022509.1.22453 WP_000022509.1.22454 WP_000022509.1.2246 WP_000022509.1.22460 WP_000022509.1.22476 WP_000022509.1.22485 WP_000022509.1.22514 WP_000022509.1.22537 WP_000022509.1.22565 WP_000022509.1.22566 WP_000022509.1.22575 WP_000022509.1.22582 WP_000022509.1.22595 WP_000022509.1.22604 WP_000022509.1.22605 WP_000022509.1.22614 WP_000022509.1.22620 WP_000022509.1.22623 WP_000022509.1.22652 WP_000022509.1.22676 WP_000022509.1.22683 WP_000022509.1.22692 WP_000022509.1.22695 WP_000022509.1.22758 WP_000022509.1.22760 WP_000022509.1.2283 WP_000022509.1.2284 WP_000022509.1.22845 WP_000022509.1.22855 WP_000022509.1.22857 WP_000022509.1.22864 WP_000022509.1.22870 WP_000022509.1.22880 WP_000022509.1.22895 WP_000022509.1.22902 WP_000022509.1.22926 WP_000022509.1.22943 WP_000022509.1.22947 WP_000022509.1.22966 WP_000022509.1.22967 WP_000022509.1.22979 WP_000022509.1.23010 WP_000022509.1.23040 WP_000022509.1.23053 WP_000022509.1.23058 WP_000022509.1.23080 WP_000022509.1.23102 WP_000022509.1.23114 WP_000022509.1.2314 WP_000022509.1.23148 WP_000022509.1.23155 WP_000022509.1.23169 WP_000022509.1.23172 WP_000022509.1.23175 WP_000022509.1.23192 WP_000022509.1.23218 WP_000022509.1.2324 WP_000022509.1.23246 WP_000022509.1.23258 WP_000022509.1.23259 WP_000022509.1.23274 WP_000022509.1.23279 WP_000022509.1.2331 WP_000022509.1.23311 WP_000022509.1.2332 WP_000022509.1.23329 WP_000022509.1.23340 WP_000022509.1.23343 WP_000022509.1.2336 WP_000022509.1.23365 WP_000022509.1.23379 WP_000022509.1.23409 WP_000022509.1.23412 WP_000022509.1.2342 WP_000022509.1.23426 WP_000022509.1.23442 WP_000022509.1.23444 WP_000022509.1.23460 WP_000022509.1.23472 WP_000022509.1.23482 WP_000022509.1.23485 WP_000022509.1.23492 WP_000022509.1.235 WP_000022509.1.23500 WP_000022509.1.23503 WP_000022509.1.23509 WP_000022509.1.23515 WP_000022509.1.23548 WP_000022509.1.23571 WP_000022509.1.2358 WP_000022509.1.23587 WP_000022509.1.23604 WP_000022509.1.23621 WP_000022509.1.23629 WP_000022509.1.23631 WP_000022509.1.23634 WP_000022509.1.23639 WP_000022509.1.2364 WP_000022509.1.23646 WP_000022509.1.23675 WP_000022509.1.23679 WP_000022509.1.237 WP_000022509.1.23707 WP_000022509.1.23720 WP_000022509.1.23728 WP_000022509.1.23736 WP_000022509.1.23746 WP_000022509.1.2375 WP_000022509.1.2376 WP_000022509.1.23783 WP_000022509.1.23786 WP_000022509.1.23787 WP_000022509.1.2380 WP_000022509.1.23801 WP_000022509.1.23932 WP_000022509.1.23959 WP_000022509.1.24017 WP_000022509.1.24028 WP_000022509.1.24061 WP_000022509.1.24082 WP_000022509.1.24083 WP_000022509.1.24117 WP_000022509.1.24125 WP_000022509.1.24138 WP_000022509.1.24145 WP_000022509.1.2415 WP_000022509.1.24153 WP_000022509.1.24158 WP_000022509.1.24206 WP_000022509.1.24214 WP_000022509.1.24250 WP_000022509.1.24291 WP_000022509.1.24297 WP_000022509.1.24303 WP_000022509.1.24308 WP_000022509.1.24322 WP_000022509.1.24355 WP_000022509.1.24361 WP_000022509.1.24375 WP_000022509.1.24376 WP_000022509.1.24392 WP_000022509.1.24394 WP_000022509.1.24400 WP_000022509.1.24408 WP_000022509.1.24409 WP_000022509.1.24412 WP_000022509.1.24419 WP_000022509.1.24420 WP_000022509.1.24450 WP_000022509.1.24476 WP_000022509.1.24494 WP_000022509.1.24521 WP_000022509.1.24555 WP_000022509.1.24578 WP_000022509.1.24619 WP_000022509.1.24643 WP_000022509.1.2467 WP_000022509.1.24673 WP_000022509.1.24686 WP_000022509.1.24688 WP_000022509.1.24689 WP_000022509.1.24696 WP_000022509.1.24716 WP_000022509.1.24727 WP_000022509.1.24737 WP_000022509.1.24779 WP_000022509.1.2481 WP_000022509.1.24832 WP_000022509.1.24837 WP_000022509.1.24839 WP_000022509.1.24873 WP_000022509.1.24901 WP_000022509.1.24944 WP_000022509.1.24964 WP_000022509.1.24995 WP_000022509.1.25008 WP_000022509.1.25015 WP_000022509.1.25017 WP_000022509.1.25032 WP_000022509.1.25041 WP_000022509.1.25053 WP_000022509.1.25064 WP_000022509.1.25119 WP_000022509.1.25130 WP_000022509.1.25140 WP_000022509.1.25159 WP_000022509.1.25175 WP_000022509.1.25185 WP_000022509.1.25196 WP_000022509.1.25205 WP_000022509.1.25206 WP_000022509.1.25210 WP_000022509.1.25217 WP_000022509.1.25219 WP_000022509.1.25229 WP_000022509.1.25297 WP_000022509.1.25304 WP_000022509.1.25354 WP_000022509.1.25374 WP_000022509.1.25397 WP_000022509.1.25405 WP_000022509.1.25426 WP_000022509.1.25454 WP_000022509.1.25475 WP_000022509.1.25490 WP_000022509.1.25493 WP_000022509.1.25498 WP_000022509.1.25508 WP_000022509.1.25512 WP_000022509.1.25514 WP_000022509.1.2554 WP_000022509.1.25546 WP_000022509.1.25564 WP_000022509.1.25596 WP_000022509.1.25603 WP_000022509.1.25618 WP_000022509.1.2562 WP_000022509.1.25666 WP_000022509.1.25668 WP_000022509.1.25690 WP_000022509.1.2570 WP_000022509.1.25700 WP_000022509.1.25703 WP_000022509.1.25708 WP_000022509.1.25740 WP_000022509.1.25780 WP_000022509.1.25807 WP_000022509.1.25809 WP_000022509.1.2581 WP_000022509.1.25814 WP_000022509.1.25821 WP_000022509.1.25825 WP_000022509.1.25833 WP_000022509.1.25835 WP_000022509.1.25846 WP_000022509.1.25882 WP_000022509.1.25911 WP_000022509.1.25928 WP_000022509.1.25944 WP_000022509.1.25951 WP_000022509.1.25962 WP_000022509.1.25963 WP_000022509.1.25988 WP_000022509.1.26001 WP_000022509.1.26027 WP_000022509.1.26034 WP_000022509.1.26075 WP_000022509.1.26083 WP_000022509.1.26093 WP_000022509.1.26107 WP_000022509.1.26122 WP_000022509.1.26123 WP_000022509.1.26129 WP_000022509.1.2615 WP_000022509.1.26194 WP_000022509.1.26199 WP_000022509.1.26213 WP_000022509.1.26217 WP_000022509.1.26224 WP_000022509.1.26230 WP_000022509.1.26232 WP_000022509.1.26269 WP_000022509.1.26272 WP_000022509.1.26282 WP_000022509.1.26286 WP_000022509.1.26288 WP_000022509.1.26311 WP_000022509.1.26319 WP_000022509.1.26363 WP_000022509.1.26384 WP_000022509.1.26394 WP_000022509.1.26426 WP_000022509.1.26429 WP_000022509.1.26440 WP_000022509.1.26441 WP_000022509.1.26491 WP_000022509.1.26493 WP_000022509.1.26512 WP_000022509.1.2654 WP_000022509.1.26551 WP_000022509.1.26554 WP_000022509.1.26563 WP_000022509.1.26567 WP_000022509.1.26582 WP_000022509.1.26636 WP_000022509.1.26646 WP_000022509.1.2667 WP_000022509.1.26687 WP_000022509.1.26689 WP_000022509.1.26709 WP_000022509.1.2672 WP_000022509.1.26741 WP_000022509.1.26750 WP_000022509.1.26758 WP_000022509.1.26787 WP_000022509.1.2679 WP_000022509.1.26794 WP_000022509.1.26833 WP_000022509.1.26882 WP_000022509.1.26883 WP_000022509.1.26892 WP_000022509.1.26908 WP_000022509.1.26919 WP_000022509.1.2692 WP_000022509.1.26924 WP_000022509.1.26928 WP_000022509.1.26936 WP_000022509.1.270 WP_000022509.1.27008 WP_000022509.1.27010 WP_000022509.1.27027 WP_000022509.1.27051 WP_000022509.1.27055 WP_000022509.1.27070 WP_000022509.1.27072 WP_000022509.1.27077 WP_000022509.1.27084 WP_000022509.1.27086 WP_000022509.1.27087 WP_000022509.1.27111 WP_000022509.1.27115 WP_000022509.1.27122 WP_000022509.1.2713 WP_000022509.1.27169 WP_000022509.1.2717 WP_000022509.1.27173 WP_000022509.1.272 WP_000022509.1.27206 WP_000022509.1.27223 WP_000022509.1.27228 WP_000022509.1.2723 WP_000022509.1.27272 WP_000022509.1.27282 WP_000022509.1.27285 WP_000022509.1.27309 WP_000022509.1.27314 WP_000022509.1.27329 WP_000022509.1.27342 WP_000022509.1.27361 WP_000022509.1.27383 WP_000022509.1.27419 WP_000022509.1.27423 WP_000022509.1.27452 WP_000022509.1.27513 WP_000022509.1.27522 WP_000022509.1.27535 WP_000022509.1.27544 WP_000022509.1.27547 WP_000022509.1.27561 WP_000022509.1.27565 WP_000022509.1.27595 WP_000022509.1.27598 WP_000022509.1.27616 WP_000022509.1.2763 WP_000022509.1.27632 WP_000022509.1.27638 WP_000022509.1.27655 WP_000022509.1.27658 WP_000022509.1.27665 WP_000022509.1.27679 WP_000022509.1.27706 WP_000022509.1.27707 WP_000022509.1.27755 WP_000022509.1.27761 WP_000022509.1.2777 WP_000022509.1.27775 WP_000022509.1.27776 WP_000022509.1.27785 WP_000022509.1.27798 WP_000022509.1.27800 WP_000022509.1.27815 WP_000022509.1.27833 WP_000022509.1.27857 WP_000022509.1.27883 WP_000022509.1.27900 WP_000022509.1.27928 WP_000022509.1.27945 WP_000022509.1.27977 WP_000022509.1.27995 WP_000022509.1.27997 WP_000022509.1.28002 WP_000022509.1.28004 WP_000022509.1.28032 WP_000022509.1.28037 WP_000022509.1.28056 WP_000022509.1.2806 WP_000022509.1.28073 WP_000022509.1.2809 WP_000022509.1.28094 WP_000022509.1.28116 WP_000022509.1.28126 WP_000022509.1.28139 WP_000022509.1.28155 WP_000022509.1.28170 WP_000022509.1.28174 WP_000022509.1.28198 WP_000022509.1.28200 WP_000022509.1.2822 WP_000022509.1.28225 WP_000022509.1.28229 WP_000022509.1.28232 WP_000022509.1.28233 WP_000022509.1.28235 WP_000022509.1.2825 WP_000022509.1.28267 WP_000022509.1.28302 WP_000022509.1.28303 WP_000022509.1.2835 WP_000022509.1.28370 WP_000022509.1.28384 WP_000022509.1.28386 WP_000022509.1.28393 WP_000022509.1.28395 WP_000022509.1.284 WP_000022509.1.2845 WP_000022509.1.28462 WP_000022509.1.28479 WP_000022509.1.28504 WP_000022509.1.28514 WP_000022509.1.2853 WP_000022509.1.28538 WP_000022509.1.28570 WP_000022509.1.28575 WP_000022509.1.28612 WP_000022509.1.28620 WP_000022509.1.28625 WP_000022509.1.28627 WP_000022509.1.28655 WP_000022509.1.28673 WP_000022509.1.28692 WP_000022509.1.28694 WP_000022509.1.2873 WP_000022509.1.28733 WP_000022509.1.28773 WP_000022509.1.28775 WP_000022509.1.28776 WP_000022509.1.2879 WP_000022509.1.28811 WP_000022509.1.2890 WP_000022509.1.28902 WP_000022509.1.28917 WP_000022509.1.28921 WP_000022509.1.28938 WP_000022509.1.28946 WP_000022509.1.28948 WP_000022509.1.28962 WP_000022509.1.28963 WP_000022509.1.28977 WP_000022509.1.29006 WP_000022509.1.29010 WP_000022509.1.29023 WP_000022509.1.29042 WP_000022509.1.2905 WP_000022509.1.2907 WP_000022509.1.29081 WP_000022509.1.29089 WP_000022509.1.2910 WP_000022509.1.29113 WP_000022509.1.29130 WP_000022509.1.29153 WP_000022509.1.29168 WP_000022509.1.29174 WP_000022509.1.29190 WP_000022509.1.29203 WP_000022509.1.29218 WP_000022509.1.29237 WP_000022509.1.2924 WP_000022509.1.29248 WP_000022509.1.29265 WP_000022509.1.29288 WP_000022509.1.2932 WP_000022509.1.29349 WP_000022509.1.29379 WP_000022509.1.29389 WP_000022509.1.29422 WP_000022509.1.29436 WP_000022509.1.29439 WP_000022509.1.29454 WP_000022509.1.2946 WP_000022509.1.29462 WP_000022509.1.29509 WP_000022509.1.29530 WP_000022509.1.29563 WP_000022509.1.29576 WP_000022509.1.29588 WP_000022509.1.29601 WP_000022509.1.29606 WP_000022509.1.29615 WP_000022509.1.29619 WP_000022509.1.29682 WP_000022509.1.29704 WP_000022509.1.29727 WP_000022509.1.29732 WP_000022509.1.29743 WP_000022509.1.29768 WP_000022509.1.29774 WP_000022509.1.29775 WP_000022509.1.29782 WP_000022509.1.29827 WP_000022509.1.29833 WP_000022509.1.2984 WP_000022509.1.29845 WP_000022509.1.29851 WP_000022509.1.29865 WP_000022509.1.29886 WP_000022509.1.29898 WP_000022509.1.29919 WP_000022509.1.29923 WP_000022509.1.29924 WP_000022509.1.2994 WP_000022509.1.29943 WP_000022509.1.29964 WP_000022509.1.29969 WP_000022509.1.29983 WP_000022509.1.29990 WP_000022509.1.30006 WP_000022509.1.30009 WP_000022509.1.30013 WP_000022509.1.30018 WP_000022509.1.3002 WP_000022509.1.30022 WP_000022509.1.30027 WP_000022509.1.30034 WP_000022509.1.30049 WP_000022509.1.3005 WP_000022509.1.30058 WP_000022509.1.30059 WP_000022509.1.30086 WP_000022509.1.30093 WP_000022509.1.30165 WP_000022509.1.30170 WP_000022509.1.30172 WP_000022509.1.30179 WP_000022509.1.30180 WP_000022509.1.30185 WP_000022509.1.30195 WP_000022509.1.30202 WP_000022509.1.30210 WP_000022509.1.30213 WP_000022509.1.30225 WP_000022509.1.30246 WP_000022509.1.30278 WP_000022509.1.30331 WP_000022509.1.30354 WP_000022509.1.30356 WP_000022509.1.30357 WP_000022509.1.30362 WP_000022509.1.30386 WP_000022509.1.30389 WP_000022509.1.3042 WP_000022509.1.30421 WP_000022509.1.30425 WP_000022509.1.30440 WP_000022509.1.30448 WP_000022509.1.30469 WP_000022509.1.30489 WP_000022509.1.30492 WP_000022509.1.30505 WP_000022509.1.30507 WP_000022509.1.30517 WP_000022509.1.30535 WP_000022509.1.30542 WP_000022509.1.30544 WP_000022509.1.30547 WP_000022509.1.30548 WP_000022509.1.30555 WP_000022509.1.30556 WP_000022509.1.30572 WP_000022509.1.30585 WP_000022509.1.30589 WP_000022509.1.30618 WP_000022509.1.30619 WP_000022509.1.30627 WP_000022509.1.30635 WP_000022509.1.3066 WP_000022509.1.30664 WP_000022509.1.3068 WP_000022509.1.30688 WP_000022509.1.30696 WP_000022509.1.30752 WP_000022509.1.3076 WP_000022509.1.30794 WP_000022509.1.30802 WP_000022509.1.30803 WP_000022509.1.30806 WP_000022509.1.30819 WP_000022509.1.30823 WP_000022509.1.30833 WP_000022509.1.30835 WP_000022509.1.3089 WP_000022509.1.30909 WP_000022509.1.30934 WP_000022509.1.3095 WP_000022509.1.30951 WP_000022509.1.30967 WP_000022509.1.30968 WP_000022509.1.30972 WP_000022509.1.31 WP_000022509.1.31001 WP_000022509.1.31011 WP_000022509.1.31042 WP_000022509.1.31046 WP_000022509.1.31066 WP_000022509.1.31069 WP_000022509.1.31078 WP_000022509.1.31086 WP_000022509.1.31092 WP_000022509.1.31111 WP_000022509.1.31122 WP_000022509.1.3113 WP_000022509.1.31139 WP_000022509.1.3114 WP_000022509.1.31145 WP_000022509.1.31155 WP_000022509.1.31156 WP_000022509.1.31167 WP_000022509.1.31171 WP_000022509.1.31182 WP_000022509.1.31185 WP_000022509.1.3119 WP_000022509.1.31190 WP_000022509.1.31195 WP_000022509.1.31198 WP_000022509.1.31205 WP_000022509.1.3121 WP_000022509.1.31210 WP_000022509.1.31214 WP_000022509.1.31219 WP_000022509.1.31222 WP_000022509.1.31223 WP_000022509.1.31262 WP_000022509.1.3127 WP_000022509.1.31272 WP_000022509.1.31281 WP_000022509.1.31303 WP_000022509.1.3131 WP_000022509.1.31335 WP_000022509.1.31352 WP_000022509.1.31362 WP_000022509.1.31389 WP_000022509.1.31413 WP_000022509.1.31435 WP_000022509.1.31446 WP_000022509.1.31451 WP_000022509.1.31476 WP_000022509.1.31504 WP_000022509.1.31515 WP_000022509.1.31533 WP_000022509.1.31546 WP_000022509.1.31578 WP_000022509.1.31585 WP_000022509.1.31643 WP_000022509.1.31658 WP_000022509.1.31665 WP_000022509.1.3167 WP_000022509.1.3170 WP_000022509.1.31720 WP_000022509.1.31782 WP_000022509.1.31799 WP_000022509.1.31836 WP_000022509.1.31845 WP_000022509.1.3185 WP_000022509.1.31895 WP_000022509.1.31901 WP_000022509.1.31927 WP_000022509.1.31940 WP_000022509.1.31951 WP_000022509.1.31967 WP_000022509.1.31972 WP_000022509.1.32006 WP_000022509.1.32038 WP_000022509.1.32041 WP_000022509.1.32042 WP_000022509.1.32054 WP_000022509.1.32056 WP_000022509.1.3207 WP_000022509.1.32109 WP_000022509.1.32116 WP_000022509.1.32170 WP_000022509.1.32189 WP_000022509.1.32192 WP_000022509.1.32202 WP_000022509.1.32204 WP_000022509.1.32206 WP_000022509.1.32252 WP_000022509.1.32255 WP_000022509.1.32260 WP_000022509.1.32263 WP_000022509.1.32274 WP_000022509.1.32275 WP_000022509.1.32277 WP_000022509.1.32293 WP_000022509.1.32299 WP_000022509.1.32309 WP_000022509.1.32357 WP_000022509.1.32368 WP_000022509.1.32422 WP_000022509.1.32423 WP_000022509.1.32424 WP_000022509.1.32425 WP_000022509.1.32434 WP_000022509.1.32438 WP_000022509.1.32458 WP_000022509.1.32459 WP_000022509.1.32460 WP_000022509.1.32491 WP_000022509.1.32515 WP_000022509.1.32519 WP_000022509.1.32527 WP_000022509.1.32529 WP_000022509.1.32545 WP_000022509.1.32563 WP_000022509.1.32578 WP_000022509.1.32617 WP_000022509.1.32624 WP_000022509.1.32629 WP_000022509.1.32643 WP_000022509.1.32660 WP_000022509.1.32668 WP_000022509.1.3270 WP_000022509.1.32702 WP_000022509.1.32714 WP_000022509.1.32725 WP_000022509.1.32740 WP_000022509.1.32750 WP_000022509.1.3278 WP_000022509.1.32786 WP_000022509.1.32804 WP_000022509.1.32832 WP_000022509.1.32838 WP_000022509.1.32848 WP_000022509.1.32860 WP_000022509.1.32868 WP_000022509.1.32881 WP_000022509.1.32899 WP_000022509.1.329 WP_000022509.1.3290 WP_000022509.1.32900 WP_000022509.1.32902 WP_000022509.1.32907 WP_000022509.1.32930 WP_000022509.1.32940 WP_000022509.1.32941 WP_000022509.1.3296 WP_000022509.1.32961 WP_000022509.1.32966 WP_000022509.1.32977 WP_000022509.1.32985 WP_000022509.1.33010 WP_000022509.1.33030 WP_000022509.1.33037 WP_000022509.1.3304 WP_000022509.1.3305 WP_000022509.1.33051 WP_000022509.1.33065 WP_000022509.1.3310 WP_000022509.1.33106 WP_000022509.1.33114 WP_000022509.1.33122 WP_000022509.1.33127 WP_000022509.1.33143 WP_000022509.1.33144 WP_000022509.1.3315 WP_000022509.1.33208 WP_000022509.1.33214 WP_000022509.1.33247 WP_000022509.1.33248 WP_000022509.1.33253 WP_000022509.1.33261 WP_000022509.1.33270 WP_000022509.1.33280 WP_000022509.1.33283 WP_000022509.1.333 WP_000022509.1.33313 WP_000022509.1.33339 WP_000022509.1.33382 WP_000022509.1.33392 WP_000022509.1.33409 WP_000022509.1.33420 WP_000022509.1.33486 WP_000022509.1.33490 WP_000022509.1.33492 WP_000022509.1.33499 WP_000022509.1.335 WP_000022509.1.33501 WP_000022509.1.33504 WP_000022509.1.33529 WP_000022509.1.33553 WP_000022509.1.3356 WP_000022509.1.33580 WP_000022509.1.33586 WP_000022509.1.33592 WP_000022509.1.33629 WP_000022509.1.3364 WP_000022509.1.33659 WP_000022509.1.33689 WP_000022509.1.33693 WP_000022509.1.3370 WP_000022509.1.33730 WP_000022509.1.33741 WP_000022509.1.33817 WP_000022509.1.33825 WP_000022509.1.33840 WP_000022509.1.33870 WP_000022509.1.33894 WP_000022509.1.3392 WP_000022509.1.33926 WP_000022509.1.3394 WP_000022509.1.3395 WP_000022509.1.33957 WP_000022509.1.3396 WP_000022509.1.33969 WP_000022509.1.33986 WP_000022509.1.34 WP_000022509.1.34001 WP_000022509.1.34022 WP_000022509.1.34043 WP_000022509.1.34059 WP_000022509.1.34075 WP_000022509.1.34081 WP_000022509.1.34084 WP_000022509.1.34091 WP_000022509.1.34118 WP_000022509.1.34126 WP_000022509.1.34179 WP_000022509.1.34184 WP_000022509.1.34185 WP_000022509.1.34211 WP_000022509.1.34214 WP_000022509.1.34234 WP_000022509.1.34257 WP_000022509.1.34259 WP_000022509.1.34279 WP_000022509.1.34284 WP_000022509.1.34292 WP_000022509.1.34304 WP_000022509.1.34319 WP_000022509.1.34330 WP_000022509.1.34376 WP_000022509.1.3438 WP_000022509.1.34382 WP_000022509.1.34417 WP_000022509.1.34424 WP_000022509.1.34431 WP_000022509.1.3445 WP_000022509.1.34453 WP_000022509.1.34454 WP_000022509.1.34458 WP_000022509.1.34484 WP_000022509.1.34496 WP_000022509.1.34517 WP_000022509.1.34530 WP_000022509.1.34610 WP_000022509.1.34614 WP_000022509.1.34647 WP_000022509.1.34659 WP_000022509.1.34665 WP_000022509.1.34694 WP_000022509.1.34703 WP_000022509.1.34704 WP_000022509.1.34707 WP_000022509.1.34711 WP_000022509.1.34745 WP_000022509.1.34751 WP_000022509.1.3476 WP_000022509.1.34801 WP_000022509.1.34808 WP_000022509.1.34817 WP_000022509.1.34820 WP_000022509.1.34824 WP_000022509.1.34834 WP_000022509.1.34854 WP_000022509.1.34856 WP_000022509.1.34881 WP_000022509.1.3489 WP_000022509.1.34932 WP_000022509.1.34962 WP_000022509.1.34972 WP_000022509.1.34975 WP_000022509.1.34977 WP_000022509.1.35001 WP_000022509.1.35035 WP_000022509.1.35040 WP_000022509.1.35045 WP_000022509.1.35074 WP_000022509.1.35075 WP_000022509.1.35125 WP_000022509.1.35129 WP_000022509.1.35175 WP_000022509.1.35184 WP_000022509.1.35193 WP_000022509.1.35240 WP_000022509.1.35274 WP_000022509.1.35294 WP_000022509.1.35298 WP_000022509.1.35321 WP_000022509.1.35331 WP_000022509.1.35404 WP_000022509.1.35408 WP_000022509.1.35425 WP_000022509.1.35429 WP_000022509.1.35446 WP_000022509.1.35460 WP_000022509.1.35463 WP_000022509.1.35494 WP_000022509.1.35503 WP_000022509.1.35507 WP_000022509.1.35509 WP_000022509.1.35532 WP_000022509.1.3556 WP_000022509.1.35560 WP_000022509.1.35563 WP_000022509.1.3557 WP_000022509.1.35570 WP_000022509.1.35590 WP_000022509.1.35594 WP_000022509.1.35624 WP_000022509.1.35628 WP_000022509.1.3566 WP_000022509.1.3570 WP_000022509.1.35712 WP_000022509.1.35713 WP_000022509.1.35736 WP_000022509.1.35777 WP_000022509.1.35791 WP_000022509.1.35795 WP_000022509.1.35809 WP_000022509.1.35835 WP_000022509.1.35868 WP_000022509.1.35870 WP_000022509.1.35887 WP_000022509.1.35892 WP_000022509.1.35916 WP_000022509.1.35936 WP_000022509.1.35938 WP_000022509.1.35940 WP_000022509.1.35961 WP_000022509.1.35966 WP_000022509.1.35993 WP_000022509.1.36000 WP_000022509.1.36003 WP_000022509.1.3601 WP_000022509.1.36011 WP_000022509.1.36017 WP_000022509.1.36034 WP_000022509.1.36036 WP_000022509.1.36037 WP_000022509.1.36057 WP_000022509.1.36063 WP_000022509.1.36069 WP_000022509.1.3610 WP_000022509.1.36157 WP_000022509.1.36172 WP_000022509.1.36229 WP_000022509.1.36232 WP_000022509.1.36236 WP_000022509.1.36286 WP_000022509.1.36291 WP_000022509.1.36298 WP_000022509.1.36308 WP_000022509.1.36323 WP_000022509.1.36343 WP_000022509.1.36409 WP_000022509.1.36425 WP_000022509.1.36445 WP_000022509.1.36460 WP_000022509.1.3649 WP_000022509.1.36495 WP_000022509.1.36512 WP_000022509.1.36526 WP_000022509.1.36542 WP_000022509.1.36547 WP_000022509.1.36564 WP_000022509.1.36567 WP_000022509.1.36579 WP_000022509.1.36584 WP_000022509.1.36586 WP_000022509.1.36592 WP_000022509.1.36609 WP_000022509.1.36617 WP_000022509.1.36618 WP_000022509.1.36643 WP_000022509.1.36652 WP_000022509.1.36663 WP_000022509.1.36685 WP_000022509.1.36690 WP_000022509.1.3670 WP_000022509.1.36701 WP_000022509.1.36705 WP_000022509.1.36721 WP_000022509.1.36725 WP_000022509.1.36764 WP_000022509.1.36765 WP_000022509.1.36779 WP_000022509.1.36792 WP_000022509.1.36798 WP_000022509.1.36802 WP_000022509.1.36821 WP_000022509.1.36839 WP_000022509.1.36853 WP_000022509.1.36875 WP_000022509.1.3688 WP_000022509.1.36885 WP_000022509.1.36889 WP_000022509.1.36918 WP_000022509.1.36931 WP_000022509.1.36949 WP_000022509.1.36950 WP_000022509.1.36978 WP_000022509.1.37014 WP_000022509.1.37021 WP_000022509.1.37029 WP_000022509.1.37063 WP_000022509.1.37073 WP_000022509.1.37092 WP_000022509.1.37100 WP_000022509.1.37111 WP_000022509.1.37112 WP_000022509.1.37114 WP_000022509.1.37133 WP_000022509.1.37147 WP_000022509.1.37158 WP_000022509.1.37176 WP_000022509.1.37191 WP_000022509.1.37199 WP_000022509.1.37200 WP_000022509.1.37256 WP_000022509.1.37258 WP_000022509.1.37267 WP_000022509.1.3728 WP_000022509.1.37293 WP_000022509.1.37297 WP_000022509.1.37303 WP_000022509.1.37320 WP_000022509.1.37351 WP_000022509.1.37363 WP_000022509.1.37370 WP_000022509.1.37376 WP_000022509.1.37405 WP_000022509.1.3744 WP_000022509.1.37478 WP_000022509.1.3748 WP_000022509.1.37498 WP_000022509.1.37504 WP_000022509.1.3751 WP_000022509.1.37513 WP_000022509.1.37521 WP_000022509.1.37558 WP_000022509.1.37584 WP_000022509.1.37590 WP_000022509.1.37593 WP_000022509.1.37600 WP_000022509.1.37610 WP_000022509.1.37613 WP_000022509.1.37618 WP_000022509.1.37659 WP_000022509.1.37662 WP_000022509.1.37675 WP_000022509.1.37687 WP_000022509.1.37691 WP_000022509.1.3771 WP_000022509.1.37719 WP_000022509.1.37761 WP_000022509.1.37775 WP_000022509.1.37777 WP_000022509.1.3778 WP_000022509.1.378 WP_000022509.1.37808 WP_000022509.1.37848 WP_000022509.1.37864 WP_000022509.1.379 WP_000022509.1.3790 WP_000022509.1.37911 WP_000022509.1.37941 WP_000022509.1.37965 WP_000022509.1.37968 WP_000022509.1.37978 WP_000022509.1.37985 WP_000022509.1.38026 WP_000022509.1.38037 WP_000022509.1.38047 WP_000022509.1.38055 WP_000022509.1.38061 WP_000022509.1.38064 WP_000022509.1.38108 WP_000022509.1.38113 WP_000022509.1.38125 WP_000022509.1.38145 WP_000022509.1.3816 WP_000022509.1.38199 WP_000022509.1.38207 WP_000022509.1.38261 WP_000022509.1.38266 WP_000022509.1.38273 WP_000022509.1.3828 WP_000022509.1.383 WP_000022509.1.38310 WP_000022509.1.38322 WP_000022509.1.3834 WP_000022509.1.38341 WP_000022509.1.38344 WP_000022509.1.38349 WP_000022509.1.38351 WP_000022509.1.3838 WP_000022509.1.38381 WP_000022509.1.38408 WP_000022509.1.38440 WP_000022509.1.38452 WP_000022509.1.3848 WP_000022509.1.38486 WP_000022509.1.38512 WP_000022509.1.38515 WP_000022509.1.38569 WP_000022509.1.38595 WP_000022509.1.3860 WP_000022509.1.38609 WP_000022509.1.38613 WP_000022509.1.38620 WP_000022509.1.38622 WP_000022509.1.38642 WP_000022509.1.38673 WP_000022509.1.3869 WP_000022509.1.38693 WP_000022509.1.38734 WP_000022509.1.38740 WP_000022509.1.38773 WP_000022509.1.38781 WP_000022509.1.38797 WP_000022509.1.38830 WP_000022509.1.38857 WP_000022509.1.38877 WP_000022509.1.38881 WP_000022509.1.38882 WP_000022509.1.38895 WP_000022509.1.38898 WP_000022509.1.3891 WP_000022509.1.38913 WP_000022509.1.38942 WP_000022509.1.38983 WP_000022509.1.38995 WP_000022509.1.38996 WP_000022509.1.39003 WP_000022509.1.39038 WP_000022509.1.39048 WP_000022509.1.39055 WP_000022509.1.39056 WP_000022509.1.39059 WP_000022509.1.39065 WP_000022509.1.3907 WP_000022509.1.39075 WP_000022509.1.39082 WP_000022509.1.39105 WP_000022509.1.39112 WP_000022509.1.39128 WP_000022509.1.39136 WP_000022509.1.3914 WP_000022509.1.39140 WP_000022509.1.39146 WP_000022509.1.39147 WP_000022509.1.39161 WP_000022509.1.39183 WP_000022509.1.39197 WP_000022509.1.39210 WP_000022509.1.39229 WP_000022509.1.39235 WP_000022509.1.39265 WP_000022509.1.39275 WP_000022509.1.3931 WP_000022509.1.39311 WP_000022509.1.39312 WP_000022509.1.39395 WP_000022509.1.39405 WP_000022509.1.39420 WP_000022509.1.39435 WP_000022509.1.39449 WP_000022509.1.39466 WP_000022509.1.39497 WP_000022509.1.39502 WP_000022509.1.39503 WP_000022509.1.39512 WP_000022509.1.39530 WP_000022509.1.39556 WP_000022509.1.39576 WP_000022509.1.39584 WP_000022509.1.39609 WP_000022509.1.39619 WP_000022509.1.39620 WP_000022509.1.39624 WP_000022509.1.39629 WP_000022509.1.39632 WP_000022509.1.39659 WP_000022509.1.39667 WP_000022509.1.39722 WP_000022509.1.39723 WP_000022509.1.39724 WP_000022509.1.39763 WP_000022509.1.39775 WP_000022509.1.39808 WP_000022509.1.39862 WP_000022509.1.39879 WP_000022509.1.39890 WP_000022509.1.39921 WP_000022509.1.39923 WP_000022509.1.39941 WP_000022509.1.39945 WP_000022509.1.39947 WP_000022509.1.39953 WP_000022509.1.40008 WP_000022509.1.40017 WP_000022509.1.40025 WP_000022509.1.40031 WP_000022509.1.40072 WP_000022509.1.40073 WP_000022509.1.40081 WP_000022509.1.40095 WP_000022509.1.40097 WP_000022509.1.401 WP_000022509.1.4011 WP_000022509.1.40111 WP_000022509.1.40155 WP_000022509.1.40160 WP_000022509.1.40167 WP_000022509.1.40170 WP_000022509.1.40171 WP_000022509.1.40205 WP_000022509.1.40208 WP_000022509.1.40224 WP_000022509.1.40229 WP_000022509.1.40240 WP_000022509.1.40254 WP_000022509.1.40257 WP_000022509.1.40258 WP_000022509.1.40279 WP_000022509.1.40292 WP_000022509.1.40305 WP_000022509.1.40307 WP_000022509.1.40311 WP_000022509.1.40341 WP_000022509.1.40361 WP_000022509.1.40374 WP_000022509.1.40380 WP_000022509.1.40395 WP_000022509.1.4042 WP_000022509.1.40465 WP_000022509.1.40467 WP_000022509.1.40492 WP_000022509.1.40493 WP_000022509.1.40496 WP_000022509.1.40508 WP_000022509.1.40517 WP_000022509.1.40528 WP_000022509.1.40533 WP_000022509.1.4055 WP_000022509.1.40577 WP_000022509.1.40583 WP_000022509.1.40605 WP_000022509.1.40622 WP_000022509.1.40648 WP_000022509.1.40688 WP_000022509.1.40693 WP_000022509.1.40695 WP_000022509.1.40698 WP_000022509.1.40710 WP_000022509.1.40722 WP_000022509.1.40745 WP_000022509.1.4075 WP_000022509.1.40750 WP_000022509.1.40763 WP_000022509.1.40771 WP_000022509.1.40849 WP_000022509.1.40854 WP_000022509.1.4087 WP_000022509.1.40877 WP_000022509.1.4088 WP_000022509.1.4089 WP_000022509.1.40910 WP_000022509.1.40924 WP_000022509.1.40930 WP_000022509.1.40932 WP_000022509.1.40935 WP_000022509.1.40946 WP_000022509.1.40973 WP_000022509.1.40996 WP_000022509.1.41004 WP_000022509.1.41017 WP_000022509.1.41018 WP_000022509.1.41048 WP_000022509.1.41050 WP_000022509.1.4106 WP_000022509.1.41070 WP_000022509.1.41074 WP_000022509.1.41075 WP_000022509.1.41086 WP_000022509.1.4109 WP_000022509.1.41091 WP_000022509.1.41097 WP_000022509.1.41116 WP_000022509.1.41128 WP_000022509.1.41132 WP_000022509.1.41176 WP_000022509.1.41192 WP_000022509.1.4120 WP_000022509.1.41225 WP_000022509.1.41226 WP_000022509.1.41251 WP_000022509.1.41258 WP_000022509.1.41265 WP_000022509.1.41277 WP_000022509.1.41279 WP_000022509.1.41299 WP_000022509.1.41305 WP_000022509.1.41308 WP_000022509.1.41321 WP_000022509.1.41333 WP_000022509.1.41335 WP_000022509.1.41345 WP_000022509.1.4136 WP_000022509.1.41375 WP_000022509.1.41415 WP_000022509.1.41427 WP_000022509.1.41438 WP_000022509.1.41459 WP_000022509.1.41468 WP_000022509.1.41498 WP_000022509.1.41516 WP_000022509.1.41519 WP_000022509.1.41524 WP_000022509.1.41528 WP_000022509.1.41554 WP_000022509.1.41572 WP_000022509.1.41591 WP_000022509.1.41593 WP_000022509.1.41610 WP_000022509.1.41628 WP_000022509.1.41631 WP_000022509.1.41658 WP_000022509.1.41659 WP_000022509.1.41662 WP_000022509.1.41688 WP_000022509.1.41690 WP_000022509.1.41708 WP_000022509.1.41716 WP_000022509.1.41724 WP_000022509.1.41735 WP_000022509.1.41746 WP_000022509.1.41761 WP_000022509.1.4178 WP_000022509.1.41789 WP_000022509.1.41798 WP_000022509.1.41799 WP_000022509.1.41824 WP_000022509.1.41825 WP_000022509.1.41836 WP_000022509.1.4184 WP_000022509.1.41859 WP_000022509.1.41862 WP_000022509.1.41877 WP_000022509.1.41882 WP_000022509.1.41894 WP_000022509.1.41897 WP_000022509.1.41904 WP_000022509.1.41911 WP_000022509.1.41919 WP_000022509.1.41929 WP_000022509.1.41931 WP_000022509.1.41938 WP_000022509.1.4194 WP_000022509.1.41949 WP_000022509.1.41978 WP_000022509.1.41979 WP_000022509.1.41985 WP_000022509.1.41994 WP_000022509.1.41998 WP_000022509.1.42009 WP_000022509.1.42069 WP_000022509.1.42081 WP_000022509.1.42090 WP_000022509.1.42098 WP_000022509.1.42104 WP_000022509.1.42109 WP_000022509.1.42111 WP_000022509.1.42136 WP_000022509.1.42156 WP_000022509.1.42187 WP_000022509.1.422 WP_000022509.1.42200 WP_000022509.1.42219 WP_000022509.1.4222 WP_000022509.1.42238 WP_000022509.1.42243 WP_000022509.1.42244 WP_000022509.1.42248 WP_000022509.1.42257 WP_000022509.1.42261 WP_000022509.1.42262 WP_000022509.1.42263 WP_000022509.1.42276 WP_000022509.1.4229 WP_000022509.1.42320 WP_000022509.1.42322 WP_000022509.1.42328 WP_000022509.1.42342 WP_000022509.1.42349 WP_000022509.1.42356 WP_000022509.1.42364 WP_000022509.1.42371 WP_000022509.1.42372 WP_000022509.1.42379 WP_000022509.1.42391 WP_000022509.1.42392 WP_000022509.1.42399 WP_000022509.1.42404 WP_000022509.1.42422 WP_000022509.1.42433 WP_000022509.1.42444 WP_000022509.1.42453 WP_000022509.1.42489 WP_000022509.1.42491 WP_000022509.1.42539 WP_000022509.1.4257 WP_000022509.1.42603 WP_000022509.1.42605 WP_000022509.1.42650 WP_000022509.1.42655 WP_000022509.1.42666 WP_000022509.1.4267 WP_000022509.1.42675 WP_000022509.1.42676 WP_000022509.1.42683 WP_000022509.1.42685 WP_000022509.1.42701 WP_000022509.1.42734 WP_000022509.1.4276 WP_000022509.1.42767 WP_000022509.1.42794 WP_000022509.1.42797 WP_000022509.1.42805 WP_000022509.1.42815 WP_000022509.1.42829 WP_000022509.1.42859 WP_000022509.1.42861 WP_000022509.1.42864 WP_000022509.1.4288 WP_000022509.1.42887 WP_000022509.1.42892 WP_000022509.1.42923 WP_000022509.1.42932 WP_000022509.1.42978 WP_000022509.1.4298 WP_000022509.1.42981 WP_000022509.1.43008 WP_000022509.1.43016 WP_000022509.1.43018 WP_000022509.1.43019 WP_000022509.1.43041 WP_000022509.1.43065 WP_000022509.1.43068 WP_000022509.1.43069 WP_000022509.1.43070 WP_000022509.1.43077 WP_000022509.1.43086 WP_000022509.1.43089 WP_000022509.1.43126 WP_000022509.1.43128 WP_000022509.1.43141 WP_000022509.1.43149 WP_000022509.1.43157 WP_000022509.1.43160 WP_000022509.1.43161 WP_000022509.1.43190 WP_000022509.1.43198 WP_000022509.1.43201 WP_000022509.1.43244 WP_000022509.1.43258 WP_000022509.1.4326 WP_000022509.1.43272 WP_000022509.1.43276 WP_000022509.1.43290 WP_000022509.1.43292 WP_000022509.1.43299 WP_000022509.1.43307 WP_000022509.1.43312 WP_000022509.1.4332 WP_000022509.1.43334 WP_000022509.1.43339 WP_000022509.1.43351 WP_000022509.1.43371 WP_000022509.1.43437 WP_000022509.1.4344 WP_000022509.1.43441 WP_000022509.1.43476 WP_000022509.1.43508 WP_000022509.1.43513 WP_000022509.1.43520 WP_000022509.1.43522 WP_000022509.1.43535 WP_000022509.1.43606 WP_000022509.1.43613 WP_000022509.1.43633 WP_000022509.1.43637 WP_000022509.1.43651 WP_000022509.1.43654 WP_000022509.1.43668 WP_000022509.1.43676 WP_000022509.1.43685 WP_000022509.1.43711 WP_000022509.1.43722 WP_000022509.1.4373 WP_000022509.1.43763 WP_000022509.1.43778 WP_000022509.1.43782 WP_000022509.1.43785 WP_000022509.1.43801 WP_000022509.1.43812 WP_000022509.1.43828 WP_000022509.1.43839 WP_000022509.1.43864 WP_000022509.1.43873 WP_000022509.1.43875 WP_000022509.1.43878 WP_000022509.1.43886 WP_000022509.1.43888 WP_000022509.1.43919 WP_000022509.1.43951 WP_000022509.1.43954 WP_000022509.1.43974 WP_000022509.1.44005 WP_000022509.1.44010 WP_000022509.1.4404 WP_000022509.1.44043 WP_000022509.1.44049 WP_000022509.1.4405 WP_000022509.1.44063 WP_000022509.1.44099 WP_000022509.1.44101 WP_000022509.1.44113 WP_000022509.1.44121 WP_000022509.1.44132 WP_000022509.1.44144 WP_000022509.1.44160 WP_000022509.1.44180 WP_000022509.1.44191 WP_000022509.1.44196 WP_000022509.1.4422 WP_000022509.1.4423 WP_000022509.1.44248 WP_000022509.1.44262 WP_000022509.1.44268 WP_000022509.1.4427 WP_000022509.1.44291 WP_000022509.1.44296 WP_000022509.1.44300 WP_000022509.1.44310 WP_000022509.1.44337 WP_000022509.1.44339 WP_000022509.1.44343 WP_000022509.1.44351 WP_000022509.1.44359 WP_000022509.1.44360 WP_000022509.1.44380 WP_000022509.1.44386 WP_000022509.1.44416 WP_000022509.1.44431 WP_000022509.1.44433 WP_000022509.1.44437 WP_000022509.1.44438 WP_000022509.1.44440 WP_000022509.1.44443 WP_000022509.1.44453 WP_000022509.1.44474 WP_000022509.1.44479 WP_000022509.1.44546 WP_000022509.1.44549 WP_000022509.1.44578 WP_000022509.1.44593 WP_000022509.1.44606 WP_000022509.1.44633 WP_000022509.1.44636 WP_000022509.1.44640 WP_000022509.1.4467 WP_000022509.1.44678 WP_000022509.1.4468 WP_000022509.1.44687 WP_000022509.1.44702 WP_000022509.1.44705 WP_000022509.1.44747 WP_000022509.1.44762 WP_000022509.1.44781 WP_000022509.1.44791 WP_000022509.1.44795 WP_000022509.1.44815 WP_000022509.1.44828 WP_000022509.1.44831 WP_000022509.1.44833 WP_000022509.1.4485 WP_000022509.1.44877 WP_000022509.1.44879 WP_000022509.1.449 WP_000022509.1.44917 WP_000022509.1.44927 WP_000022509.1.44933 WP_000022509.1.44950 WP_000022509.1.44966 WP_000022509.1.44971 WP_000022509.1.44978 WP_000022509.1.44985 WP_000022509.1.44997 WP_000022509.1.44998 WP_000022509.1.4500 WP_000022509.1.4501 WP_000022509.1.45027 WP_000022509.1.45038 WP_000022509.1.45045 WP_000022509.1.4505 WP_000022509.1.45067 WP_000022509.1.45072 WP_000022509.1.45074 WP_000022509.1.45079 WP_000022509.1.45093 WP_000022509.1.45098 WP_000022509.1.45123 WP_000022509.1.45134 WP_000022509.1.45136 WP_000022509.1.45138 WP_000022509.1.45145 WP_000022509.1.45154 WP_000022509.1.45173 WP_000022509.1.45177 WP_000022509.1.45184 WP_000022509.1.45229 WP_000022509.1.45241 WP_000022509.1.45251 WP_000022509.1.45259 WP_000022509.1.45268 WP_000022509.1.45302 WP_000022509.1.4531 WP_000022509.1.45322 WP_000022509.1.45344 WP_000022509.1.45349 WP_000022509.1.45351 WP_000022509.1.45365 WP_000022509.1.4540 WP_000022509.1.45402 WP_000022509.1.45432 WP_000022509.1.45434 WP_000022509.1.45435 WP_000022509.1.45462 WP_000022509.1.45522 WP_000022509.1.45523 WP_000022509.1.45544 WP_000022509.1.45549 WP_000022509.1.45550 WP_000022509.1.45569 WP_000022509.1.45571 WP_000022509.1.45582 WP_000022509.1.45583 WP_000022509.1.45585 WP_000022509.1.45596 WP_000022509.1.45622 WP_000022509.1.45648 WP_000022509.1.45660 WP_000022509.1.45690 WP_000022509.1.45706 WP_000022509.1.45781 WP_000022509.1.45797 WP_000022509.1.458 WP_000022509.1.45829 WP_000022509.1.45844 WP_000022509.1.45848 WP_000022509.1.45871 WP_000022509.1.45906 WP_000022509.1.45918 WP_000022509.1.46011 WP_000022509.1.46030 WP_000022509.1.46069 WP_000022509.1.46077 WP_000022509.1.46091 WP_000022509.1.46112 WP_000022509.1.46124 WP_000022509.1.46169 WP_000022509.1.46173 WP_000022509.1.46174 WP_000022509.1.46187 WP_000022509.1.46205 WP_000022509.1.46215 WP_000022509.1.46225 WP_000022509.1.46241 WP_000022509.1.46243 WP_000022509.1.46250 WP_000022509.1.46278 WP_000022509.1.46299 WP_000022509.1.46303 WP_000022509.1.46307 WP_000022509.1.46322 WP_000022509.1.46323 WP_000022509.1.46345 WP_000022509.1.46355 WP_000022509.1.46358 WP_000022509.1.464 WP_000022509.1.46406 WP_000022509.1.46434 WP_000022509.1.46444 WP_000022509.1.46454 WP_000022509.1.46461 WP_000022509.1.46499 WP_000022509.1.46504 WP_000022509.1.46505 WP_000022509.1.46551 WP_000022509.1.46559 WP_000022509.1.46572 WP_000022509.1.46578 WP_000022509.1.46595 WP_000022509.1.46620 WP_000022509.1.46637 WP_000022509.1.46675 WP_000022509.1.46689 WP_000022509.1.46693 WP_000022509.1.46701 WP_000022509.1.4671 WP_000022509.1.46726 WP_000022509.1.46730 WP_000022509.1.4674 WP_000022509.1.46781 WP_000022509.1.46803 WP_000022509.1.46816 WP_000022509.1.46842 WP_000022509.1.4686 WP_000022509.1.4690 WP_000022509.1.46920 WP_000022509.1.46930 WP_000022509.1.46945 WP_000022509.1.46961 WP_000022509.1.46967 WP_000022509.1.46976 WP_000022509.1.47005 WP_000022509.1.47008 WP_000022509.1.47014 WP_000022509.1.47023 WP_000022509.1.47036 WP_000022509.1.47037 WP_000022509.1.47042 WP_000022509.1.47057 WP_000022509.1.47058 WP_000022509.1.47059 WP_000022509.1.47061 WP_000022509.1.47085 WP_000022509.1.47110 WP_000022509.1.47123 WP_000022509.1.47214 WP_000022509.1.47215 WP_000022509.1.47243 WP_000022509.1.47245 WP_000022509.1.47257 WP_000022509.1.47429 WP_000022509.1.47442 WP_000022509.1.47448 WP_000022509.1.47460 WP_000022509.1.4747 WP_000022509.1.47472 WP_000022509.1.47478 WP_000022509.1.47482 WP_000022509.1.47492 WP_000022509.1.47506 WP_000022509.1.47507 WP_000022509.1.47523 WP_000022509.1.47531 WP_000022509.1.47532 WP_000022509.1.47542 WP_000022509.1.47567 WP_000022509.1.47576 WP_000022509.1.47579 WP_000022509.1.4758 WP_000022509.1.47587 WP_000022509.1.47605 WP_000022509.1.47614 WP_000022509.1.47621 WP_000022509.1.47630 WP_000022509.1.47660 WP_000022509.1.4769 WP_000022509.1.4770 WP_000022509.1.47714 WP_000022509.1.4774 WP_000022509.1.47756 WP_000022509.1.47767 WP_000022509.1.47799 WP_000022509.1.4781 WP_000022509.1.47817 WP_000022509.1.47829 WP_000022509.1.47850 WP_000022509.1.47875 WP_000022509.1.47886 WP_000022509.1.47898 WP_000022509.1.47902 WP_000022509.1.47911 WP_000022509.1.47928 WP_000022509.1.4795 WP_000022509.1.47988 WP_000022509.1.47992 WP_000022509.1.48019 WP_000022509.1.48100 WP_000022509.1.48114 WP_000022509.1.48124 WP_000022509.1.48132 WP_000022509.1.48134 WP_000022509.1.48139 WP_000022509.1.48190 WP_000022509.1.48215 WP_000022509.1.48218 WP_000022509.1.48242 WP_000022509.1.48244 WP_000022509.1.48247 WP_000022509.1.48253 WP_000022509.1.48292 WP_000022509.1.483 WP_000022509.1.48324 WP_000022509.1.48367 WP_000022509.1.48377 WP_000022509.1.4839 WP_000022509.1.48399 WP_000022509.1.48426 WP_000022509.1.48430 WP_000022509.1.48436 WP_000022509.1.48455 WP_000022509.1.48493 WP_000022509.1.48510 WP_000022509.1.4853 WP_000022509.1.48586 WP_000022509.1.4859 WP_000022509.1.48591 WP_000022509.1.48610 WP_000022509.1.48631 WP_000022509.1.48647 WP_000022509.1.48651 WP_000022509.1.48663 WP_000022509.1.48690 WP_000022509.1.48734 WP_000022509.1.48751 WP_000022509.1.48755 WP_000022509.1.48756 WP_000022509.1.48768 WP_000022509.1.48774 WP_000022509.1.48778 WP_000022509.1.48788 WP_000022509.1.48797 WP_000022509.1.48841 WP_000022509.1.48849 WP_000022509.1.4885 WP_000022509.1.48855 WP_000022509.1.48876 WP_000022509.1.48894 WP_000022509.1.48896 WP_000022509.1.48908 WP_000022509.1.48918 WP_000022509.1.48919 WP_000022509.1.48931 WP_000022509.1.48955 WP_000022509.1.48963 WP_000022509.1.48973 WP_000022509.1.49004 WP_000022509.1.49005 WP_000022509.1.49012 WP_000022509.1.49084 WP_000022509.1.49090 WP_000022509.1.49102 WP_000022509.1.49106 WP_000022509.1.49113 WP_000022509.1.49117 WP_000022509.1.49121 WP_000022509.1.4914 WP_000022509.1.49140 WP_000022509.1.49153 WP_000022509.1.49155 WP_000022509.1.49162 WP_000022509.1.49166 WP_000022509.1.49175 WP_000022509.1.49204 WP_000022509.1.49214 WP_000022509.1.49226 WP_000022509.1.49239 WP_000022509.1.49256 WP_000022509.1.49262 WP_000022509.1.49276 WP_000022509.1.49290 WP_000022509.1.49309 WP_000022509.1.49311 WP_000022509.1.49334 WP_000022509.1.49340 WP_000022509.1.49355 WP_000022509.1.49358 WP_000022509.1.49366 WP_000022509.1.49429 WP_000022509.1.49430 WP_000022509.1.49434 WP_000022509.1.49443 WP_000022509.1.49450 WP_000022509.1.49490 WP_000022509.1.49494 WP_000022509.1.495 WP_000022509.1.49515 WP_000022509.1.49545 WP_000022509.1.49550 WP_000022509.1.49572 WP_000022509.1.49574 WP_000022509.1.49590 WP_000022509.1.49595 WP_000022509.1.49602 WP_000022509.1.49630 WP_000022509.1.49647 WP_000022509.1.49650 WP_000022509.1.49686 WP_000022509.1.49703 WP_000022509.1.49769 WP_000022509.1.49770 WP_000022509.1.49778 WP_000022509.1.49780 WP_000022509.1.4979 WP_000022509.1.49790 WP_000022509.1.49803 WP_000022509.1.49805 WP_000022509.1.49827 WP_000022509.1.49846 WP_000022509.1.49848 WP_000022509.1.4991 WP_000022509.1.49929 WP_000022509.1.49931 WP_000022509.1.49947 WP_000022509.1.49959 WP_000022509.1.49997 WP_000022509.1.50 WP_000022509.1.50003 WP_000022509.1.50007 WP_000022509.1.50014 WP_000022509.1.50030 WP_000022509.1.50043 WP_000022509.1.50080 WP_000022509.1.5009 WP_000022509.1.50103 WP_000022509.1.50128 WP_000022509.1.50153 WP_000022509.1.50158 WP_000022509.1.50161 WP_000022509.1.50198 WP_000022509.1.50211 WP_000022509.1.50238 WP_000022509.1.50239 WP_000022509.1.50247 WP_000022509.1.50251 WP_000022509.1.50308 WP_000022509.1.50309 WP_000022509.1.50332 WP_000022509.1.50349 WP_000022509.1.50376 WP_000022509.1.50386 WP_000022509.1.50387 WP_000022509.1.50389 WP_000022509.1.50404 WP_000022509.1.50406 WP_000022509.1.50413 WP_000022509.1.50449 WP_000022509.1.50468 WP_000022509.1.50478 WP_000022509.1.50480 WP_000022509.1.5051 WP_000022509.1.50517 WP_000022509.1.50529 WP_000022509.1.50565 WP_000022509.1.50566 WP_000022509.1.50570 WP_000022509.1.50593 WP_000022509.1.50626 WP_000022509.1.50652 WP_000022509.1.50676 WP_000022509.1.50684 WP_000022509.1.50726 WP_000022509.1.50750 WP_000022509.1.50769 WP_000022509.1.50771 WP_000022509.1.50774 WP_000022509.1.50782 WP_000022509.1.50800 WP_000022509.1.50804 WP_000022509.1.50808 WP_000022509.1.50811 WP_000022509.1.50875 WP_000022509.1.5088 WP_000022509.1.50882 WP_000022509.1.50885 WP_000022509.1.50893 WP_000022509.1.509 WP_000022509.1.50908 WP_000022509.1.50918 WP_000022509.1.50929 WP_000022509.1.50941 WP_000022509.1.50954 WP_000022509.1.50960 WP_000022509.1.50970 WP_000022509.1.50999 WP_000022509.1.51014 WP_000022509.1.51022 WP_000022509.1.51025 WP_000022509.1.51036 WP_000022509.1.51040 WP_000022509.1.51048 WP_000022509.1.51066 WP_000022509.1.51100 WP_000022509.1.51131 WP_000022509.1.51134 WP_000022509.1.51139 WP_000022509.1.5114 WP_000022509.1.51162 WP_000022509.1.51178 WP_000022509.1.51179 WP_000022509.1.51182 WP_000022509.1.51186 WP_000022509.1.51224 WP_000022509.1.51227 WP_000022509.1.5125 WP_000022509.1.5127 WP_000022509.1.51285 WP_000022509.1.51305 WP_000022509.1.51308 WP_000022509.1.51315 WP_000022509.1.51331 WP_000022509.1.51338 WP_000022509.1.51356 WP_000022509.1.5136 WP_000022509.1.5138 WP_000022509.1.51412 WP_000022509.1.51414 WP_000022509.1.51419 WP_000022509.1.51451 WP_000022509.1.51464 WP_000022509.1.51474 WP_000022509.1.51487 WP_000022509.1.51488 WP_000022509.1.51502 WP_000022509.1.51506 WP_000022509.1.51514 WP_000022509.1.51519 WP_000022509.1.51555 WP_000022509.1.51594 WP_000022509.1.51598 WP_000022509.1.51611 WP_000022509.1.51615 WP_000022509.1.51634 WP_000022509.1.51642 WP_000022509.1.51644 WP_000022509.1.51649 WP_000022509.1.51686 WP_000022509.1.51704 WP_000022509.1.51724 WP_000022509.1.51734 WP_000022509.1.51756 WP_000022509.1.51764 WP_000022509.1.51810 WP_000022509.1.51831 WP_000022509.1.51838 WP_000022509.1.51841 WP_000022509.1.5185 WP_000022509.1.51863 WP_000022509.1.51868 WP_000022509.1.51900 WP_000022509.1.51910 WP_000022509.1.51911 WP_000022509.1.51914 WP_000022509.1.51930 WP_000022509.1.51932 WP_000022509.1.51935 WP_000022509.1.51989 WP_000022509.1.51994 WP_000022509.1.520 WP_000022509.1.52057 WP_000022509.1.52101 WP_000022509.1.5211 WP_000022509.1.52114 WP_000022509.1.52121 WP_000022509.1.52123 WP_000022509.1.52129 WP_000022509.1.52148 WP_000022509.1.52156 WP_000022509.1.5216 WP_000022509.1.52170 WP_000022509.1.52191 WP_000022509.1.52202 WP_000022509.1.52209 WP_000022509.1.52255 WP_000022509.1.52301 WP_000022509.1.52321 WP_000022509.1.52336 WP_000022509.1.52339 WP_000022509.1.52346 WP_000022509.1.52353 WP_000022509.1.52356 WP_000022509.1.52361 WP_000022509.1.52446 WP_000022509.1.52456 WP_000022509.1.52469 WP_000022509.1.52527 WP_000022509.1.52528 WP_000022509.1.52571 WP_000022509.1.52582 WP_000022509.1.52586 WP_000022509.1.526 WP_000022509.1.52608 WP_000022509.1.52637 WP_000022509.1.52647 WP_000022509.1.52653 WP_000022509.1.52656 WP_000022509.1.52675 WP_000022509.1.52692 WP_000022509.1.5273 WP_000022509.1.52738 WP_000022509.1.52742 WP_000022509.1.52743 WP_000022509.1.52744 WP_000022509.1.52773 WP_000022509.1.52795 WP_000022509.1.52807 WP_000022509.1.52824 WP_000022509.1.52833 WP_000022509.1.52851 WP_000022509.1.52857 WP_000022509.1.52858 WP_000022509.1.52866 WP_000022509.1.52887 WP_000022509.1.52898 WP_000022509.1.52915 WP_000022509.1.52924 WP_000022509.1.52949 WP_000022509.1.52985 WP_000022509.1.5301 WP_000022509.1.53016 WP_000022509.1.53092 WP_000022509.1.53100 WP_000022509.1.53107 WP_000022509.1.53119 WP_000022509.1.5313 WP_000022509.1.53141 WP_000022509.1.53151 WP_000022509.1.53154 WP_000022509.1.53158 WP_000022509.1.53159 WP_000022509.1.53179 WP_000022509.1.53190 WP_000022509.1.53198 WP_000022509.1.53203 WP_000022509.1.53210 WP_000022509.1.53233 WP_000022509.1.53234 WP_000022509.1.53272 WP_000022509.1.53274 WP_000022509.1.53286 WP_000022509.1.53307 WP_000022509.1.53315 WP_000022509.1.53316 WP_000022509.1.53321 WP_000022509.1.53328 WP_000022509.1.53362 WP_000022509.1.53368 WP_000022509.1.53375 WP_000022509.1.53385 WP_000022509.1.53406 WP_000022509.1.53436 WP_000022509.1.53450 WP_000022509.1.53454 WP_000022509.1.53466 WP_000022509.1.5349 WP_000022509.1.53529 WP_000022509.1.53534 WP_000022509.1.53540 WP_000022509.1.53543 WP_000022509.1.53555 WP_000022509.1.53559 WP_000022509.1.5356 WP_000022509.1.53567 WP_000022509.1.53571 WP_000022509.1.5358 WP_000022509.1.53664 WP_000022509.1.53675 WP_000022509.1.53688 WP_000022509.1.53692 WP_000022509.1.53694 WP_000022509.1.53696 WP_000022509.1.53723 WP_000022509.1.53731 WP_000022509.1.5374 WP_000022509.1.53750 WP_000022509.1.53757 WP_000022509.1.53772 WP_000022509.1.53778 WP_000022509.1.53781 WP_000022509.1.53790 WP_000022509.1.53800 WP_000022509.1.53812 WP_000022509.1.53814 WP_000022509.1.53815 WP_000022509.1.53839 WP_000022509.1.53892 WP_000022509.1.53896 WP_000022509.1.53898 WP_000022509.1.53902 WP_000022509.1.53905 WP_000022509.1.5392 WP_000022509.1.53958 WP_000022509.1.53961 WP_000022509.1.53981 WP_000022509.1.53984 WP_000022509.1.54033 WP_000022509.1.54061 WP_000022509.1.54075 WP_000022509.1.54082 WP_000022509.1.54085 WP_000022509.1.54132 WP_000022509.1.54136 WP_000022509.1.5415 WP_000022509.1.54159 WP_000022509.1.54170 WP_000022509.1.54175 WP_000022509.1.54196 WP_000022509.1.542 WP_000022509.1.54203 WP_000022509.1.54209 WP_000022509.1.54259 WP_000022509.1.54271 WP_000022509.1.54273 WP_000022509.1.54274 WP_000022509.1.54283 WP_000022509.1.5430 WP_000022509.1.54319 WP_000022509.1.54324 WP_000022509.1.54340 WP_000022509.1.54364 WP_000022509.1.54366 WP_000022509.1.54371 WP_000022509.1.54400 WP_000022509.1.54431 WP_000022509.1.54442 WP_000022509.1.54482 WP_000022509.1.54500 WP_000022509.1.54522 WP_000022509.1.54526 WP_000022509.1.54558 WP_000022509.1.5456 WP_000022509.1.54589 WP_000022509.1.5459 WP_000022509.1.54607 WP_000022509.1.54615 WP_000022509.1.5462 WP_000022509.1.54644 WP_000022509.1.54662 WP_000022509.1.54667 WP_000022509.1.54678 WP_000022509.1.54681 WP_000022509.1.54722 WP_000022509.1.54748 WP_000022509.1.54749 WP_000022509.1.54764 WP_000022509.1.54774 WP_000022509.1.5481 WP_000022509.1.54814 WP_000022509.1.54822 WP_000022509.1.54827 WP_000022509.1.54833 WP_000022509.1.54845 WP_000022509.1.5485 WP_000022509.1.54865 WP_000022509.1.54877 WP_000022509.1.5493 WP_000022509.1.54935 WP_000022509.1.54936 WP_000022509.1.54979 WP_000022509.1.54984 WP_000022509.1.54992 WP_000022509.1.55008 WP_000022509.1.55010 WP_000022509.1.55034 WP_000022509.1.55073 WP_000022509.1.55152 WP_000022509.1.55156 WP_000022509.1.55163 WP_000022509.1.55165 WP_000022509.1.55166 WP_000022509.1.5517 WP_000022509.1.55178 WP_000022509.1.55200 WP_000022509.1.55215 WP_000022509.1.55223 WP_000022509.1.55224 WP_000022509.1.5525 WP_000022509.1.55285 WP_000022509.1.55290 WP_000022509.1.55294 WP_000022509.1.55310 WP_000022509.1.55317 WP_000022509.1.55325 WP_000022509.1.55361 WP_000022509.1.55379 WP_000022509.1.5539 WP_000022509.1.55418 WP_000022509.1.55430 WP_000022509.1.55461 WP_000022509.1.55468 WP_000022509.1.55475 WP_000022509.1.55506 WP_000022509.1.5552 WP_000022509.1.55528 WP_000022509.1.55545 WP_000022509.1.55554 WP_000022509.1.55557 WP_000022509.1.55559 WP_000022509.1.5560 WP_000022509.1.55604 WP_000022509.1.55614 WP_000022509.1.55639 WP_000022509.1.55640 WP_000022509.1.55647 WP_000022509.1.55672 WP_000022509.1.55680 WP_000022509.1.55699 WP_000022509.1.55706 WP_000022509.1.5572 WP_000022509.1.55725 WP_000022509.1.55743 WP_000022509.1.55768 WP_000022509.1.5577 WP_000022509.1.55780 WP_000022509.1.55782 WP_000022509.1.55796 WP_000022509.1.55803 WP_000022509.1.55923 WP_000022509.1.55948 WP_000022509.1.55967 WP_000022509.1.55973 WP_000022509.1.55993 WP_000022509.1.55995 WP_000022509.1.56002 WP_000022509.1.56004 WP_000022509.1.56012 WP_000022509.1.56026 WP_000022509.1.56059 WP_000022509.1.56069 WP_000022509.1.56070 WP_000022509.1.56082 WP_000022509.1.56100 WP_000022509.1.56105 WP_000022509.1.56130 WP_000022509.1.56144 WP_000022509.1.56152 WP_000022509.1.56172 WP_000022509.1.5621 WP_000022509.1.56222 WP_000022509.1.56226 WP_000022509.1.56235 WP_000022509.1.56238 WP_000022509.1.56244 WP_000022509.1.56247 WP_000022509.1.56261 WP_000022509.1.56263 WP_000022509.1.56286 WP_000022509.1.56304 WP_000022509.1.56305 WP_000022509.1.56311 WP_000022509.1.5633 WP_000022509.1.56354 WP_000022509.1.56368 WP_000022509.1.56374 WP_000022509.1.56385 WP_000022509.1.56393 WP_000022509.1.56396 WP_000022509.1.56413 WP_000022509.1.56414 WP_000022509.1.56419 WP_000022509.1.56420 WP_000022509.1.56423 WP_000022509.1.56438 WP_000022509.1.56468 WP_000022509.1.56512 WP_000022509.1.56514 WP_000022509.1.56535 WP_000022509.1.56559 WP_000022509.1.56560 WP_000022509.1.56585 WP_000022509.1.56597 WP_000022509.1.56601 WP_000022509.1.56614 WP_000022509.1.56615 WP_000022509.1.56640 WP_000022509.1.56642 WP_000022509.1.56647 WP_000022509.1.56660 WP_000022509.1.56671 WP_000022509.1.5668 WP_000022509.1.56682 WP_000022509.1.56724 WP_000022509.1.56791 WP_000022509.1.56824 WP_000022509.1.56825 WP_000022509.1.56851 WP_000022509.1.56861 WP_000022509.1.56875 WP_000022509.1.56877 WP_000022509.1.56887 WP_000022509.1.56889 WP_000022509.1.56898 WP_000022509.1.56905 WP_000022509.1.56942 WP_000022509.1.56981 WP_000022509.1.57000 WP_000022509.1.57026 WP_000022509.1.57039 WP_000022509.1.57056 WP_000022509.1.57076 WP_000022509.1.57084 WP_000022509.1.57101 WP_000022509.1.5711 WP_000022509.1.57125 WP_000022509.1.57137 WP_000022509.1.57143 WP_000022509.1.57147 WP_000022509.1.57149 WP_000022509.1.57168 WP_000022509.1.57179 WP_000022509.1.57186 WP_000022509.1.57187 WP_000022509.1.57232 WP_000022509.1.57233 WP_000022509.1.57244 WP_000022509.1.57246 WP_000022509.1.57296 WP_000022509.1.57342 WP_000022509.1.57344 WP_000022509.1.57356 WP_000022509.1.57357 WP_000022509.1.57362 WP_000022509.1.57377 WP_000022509.1.57399 WP_000022509.1.57418 WP_000022509.1.57433 WP_000022509.1.57494 WP_000022509.1.57495 WP_000022509.1.57510 WP_000022509.1.57515 WP_000022509.1.57521 WP_000022509.1.57529 WP_000022509.1.5753 WP_000022509.1.57534 WP_000022509.1.57555 WP_000022509.1.57559 WP_000022509.1.57576 WP_000022509.1.57601 WP_000022509.1.57607 WP_000022509.1.5761 WP_000022509.1.57631 WP_000022509.1.57684 WP_000022509.1.57699 WP_000022509.1.57709 WP_000022509.1.57710 WP_000022509.1.57735 WP_000022509.1.5774 WP_000022509.1.57763 WP_000022509.1.57778 WP_000022509.1.57781 WP_000022509.1.57785 WP_000022509.1.57797 WP_000022509.1.57800 WP_000022509.1.5781 WP_000022509.1.57835 WP_000022509.1.57857 WP_000022509.1.57862 WP_000022509.1.57873 WP_000022509.1.57890 WP_000022509.1.57891 WP_000022509.1.57893 WP_000022509.1.57965 WP_000022509.1.57972 WP_000022509.1.57978 WP_000022509.1.58008 WP_000022509.1.5801 WP_000022509.1.58041 WP_000022509.1.58044 WP_000022509.1.58081 WP_000022509.1.5809 WP_000022509.1.58090 WP_000022509.1.58131 WP_000022509.1.58132 WP_000022509.1.58144 WP_000022509.1.58153 WP_000022509.1.58157 WP_000022509.1.58173 WP_000022509.1.58191 WP_000022509.1.58194 WP_000022509.1.58239 WP_000022509.1.58249 WP_000022509.1.58251 WP_000022509.1.58252 WP_000022509.1.58261 WP_000022509.1.58274 WP_000022509.1.5828 WP_000022509.1.58282 WP_000022509.1.58290 WP_000022509.1.58301 WP_000022509.1.58324 WP_000022509.1.58326 WP_000022509.1.58334 WP_000022509.1.58357 WP_000022509.1.58358 WP_000022509.1.5836 WP_000022509.1.58372 WP_000022509.1.58407 WP_000022509.1.58416 WP_000022509.1.58418 WP_000022509.1.58443 WP_000022509.1.58451 WP_000022509.1.5846 WP_000022509.1.58467 WP_000022509.1.58485 WP_000022509.1.58486 WP_000022509.1.58489 WP_000022509.1.58537 WP_000022509.1.5854 WP_000022509.1.58548 WP_000022509.1.58564 WP_000022509.1.58568 WP_000022509.1.5858 WP_000022509.1.58583 WP_000022509.1.58604 WP_000022509.1.58633 WP_000022509.1.58652 WP_000022509.1.58662 WP_000022509.1.58663 WP_000022509.1.58669 WP_000022509.1.58675 WP_000022509.1.58698 WP_000022509.1.587 WP_000022509.1.58724 WP_000022509.1.58729 WP_000022509.1.58744 WP_000022509.1.58745 WP_000022509.1.5875 WP_000022509.1.5878 WP_000022509.1.58796 WP_000022509.1.58803 WP_000022509.1.58807 WP_000022509.1.58831 WP_000022509.1.58834 WP_000022509.1.58847 WP_000022509.1.5886 WP_000022509.1.58861 WP_000022509.1.58883 WP_000022509.1.58884 WP_000022509.1.58898 WP_000022509.1.58926 WP_000022509.1.58949 WP_000022509.1.58963 WP_000022509.1.58970 WP_000022509.1.58974 WP_000022509.1.59006 WP_000022509.1.59012 WP_000022509.1.59020 WP_000022509.1.59043 WP_000022509.1.59056 WP_000022509.1.59061 WP_000022509.1.59064 WP_000022509.1.59068 WP_000022509.1.59084 WP_000022509.1.59094 WP_000022509.1.59097 WP_000022509.1.59125 WP_000022509.1.59142 WP_000022509.1.59148 WP_000022509.1.59163 WP_000022509.1.59224 WP_000022509.1.59236 WP_000022509.1.59276 WP_000022509.1.59282 WP_000022509.1.5929 WP_000022509.1.59294 WP_000022509.1.59295 WP_000022509.1.59299 WP_000022509.1.59313 WP_000022509.1.59321 WP_000022509.1.59375 WP_000022509.1.59412 WP_000022509.1.59420 WP_000022509.1.59427 WP_000022509.1.59439 WP_000022509.1.59458 WP_000022509.1.59486 WP_000022509.1.5949 WP_000022509.1.59490 WP_000022509.1.59501 WP_000022509.1.59508 WP_000022509.1.59510 WP_000022509.1.59512 WP_000022509.1.59521 WP_000022509.1.5953 WP_000022509.1.59538 WP_000022509.1.59548 WP_000022509.1.59562 WP_000022509.1.59587 WP_000022509.1.59604 WP_000022509.1.59636 WP_000022509.1.59646 WP_000022509.1.59648 WP_000022509.1.59684 WP_000022509.1.5969 WP_000022509.1.59694 WP_000022509.1.59709 WP_000022509.1.59751 WP_000022509.1.59755 WP_000022509.1.59771 WP_000022509.1.5979 WP_000022509.1.59827 WP_000022509.1.59829 WP_000022509.1.59847 WP_000022509.1.59848 WP_000022509.1.59863 WP_000022509.1.59928 WP_000022509.1.5993 WP_000022509.1.59933 WP_000022509.1.59953 WP_000022509.1.59969 WP_000022509.1.59979 WP_000022509.1.59994 WP_000022509.1.60008 WP_000022509.1.60015 WP_000022509.1.60021 WP_000022509.1.60045 WP_000022509.1.60052 WP_000022509.1.60069 WP_000022509.1.60076 WP_000022509.1.60106 WP_000022509.1.60114 WP_000022509.1.60126 WP_000022509.1.60137 WP_000022509.1.60140 WP_000022509.1.60154 WP_000022509.1.60155 WP_000022509.1.60168 WP_000022509.1.60192 WP_000022509.1.60199 WP_000022509.1.60209 WP_000022509.1.60212 WP_000022509.1.60213 WP_000022509.1.60231 WP_000022509.1.60253 WP_000022509.1.60285 WP_000022509.1.60320 WP_000022509.1.60322 WP_000022509.1.60324 WP_000022509.1.6033 WP_000022509.1.60330 WP_000022509.1.60356 WP_000022509.1.60379 WP_000022509.1.6038 WP_000022509.1.60380 WP_000022509.1.6041 WP_000022509.1.60424 WP_000022509.1.60425 WP_000022509.1.60464 WP_000022509.1.60469 WP_000022509.1.60481 WP_000022509.1.605 WP_000022509.1.60503 WP_000022509.1.60507 WP_000022509.1.6052 WP_000022509.1.60545 WP_000022509.1.60560 WP_000022509.1.60561 WP_000022509.1.6058 WP_000022509.1.60584 WP_000022509.1.60597 WP_000022509.1.6060 WP_000022509.1.60608 WP_000022509.1.60622 WP_000022509.1.60643 WP_000022509.1.60661 WP_000022509.1.60676 WP_000022509.1.60708 WP_000022509.1.60713 WP_000022509.1.60725 WP_000022509.1.60746 WP_000022509.1.60760 WP_000022509.1.60772 WP_000022509.1.60783 WP_000022509.1.60792 WP_000022509.1.608 WP_000022509.1.60807 WP_000022509.1.60809 WP_000022509.1.60838 WP_000022509.1.60851 WP_000022509.1.60855 WP_000022509.1.60857 WP_000022509.1.6086 WP_000022509.1.60863 WP_000022509.1.60866 WP_000022509.1.60874 WP_000022509.1.60882 WP_000022509.1.60889 WP_000022509.1.60897 WP_000022509.1.6090 WP_000022509.1.60926 WP_000022509.1.60941 WP_000022509.1.60950 WP_000022509.1.60976 WP_000022509.1.60988 WP_000022509.1.60990 WP_000022509.1.6104 WP_000022509.1.61044 WP_000022509.1.61045 WP_000022509.1.61076 WP_000022509.1.61078 WP_000022509.1.6108 WP_000022509.1.61087 WP_000022509.1.61114 WP_000022509.1.61123 WP_000022509.1.6114 WP_000022509.1.61146 WP_000022509.1.61147 WP_000022509.1.61168 WP_000022509.1.61184 WP_000022509.1.61200 WP_000022509.1.61210 WP_000022509.1.61218 WP_000022509.1.61232 WP_000022509.1.61233 WP_000022509.1.6129 WP_000022509.1.61296 WP_000022509.1.61309 WP_000022509.1.61345 WP_000022509.1.61356 WP_000022509.1.61357 WP_000022509.1.61381 WP_000022509.1.61417 WP_000022509.1.6143 WP_000022509.1.61434 WP_000022509.1.61501 WP_000022509.1.61509 WP_000022509.1.61511 WP_000022509.1.61519 WP_000022509.1.61539 WP_000022509.1.61542 WP_000022509.1.61553 WP_000022509.1.61574 WP_000022509.1.61582 WP_000022509.1.61594 WP_000022509.1.61595 WP_000022509.1.61609 WP_000022509.1.61649 WP_000022509.1.61652 WP_000022509.1.61667 WP_000022509.1.61671 WP_000022509.1.61694 WP_000022509.1.61697 WP_000022509.1.61712 WP_000022509.1.61714 WP_000022509.1.61730 WP_000022509.1.61732 WP_000022509.1.61737 WP_000022509.1.61743 WP_000022509.1.61783 WP_000022509.1.61809 WP_000022509.1.61857 WP_000022509.1.61877 WP_000022509.1.6190 WP_000022509.1.61908 WP_000022509.1.61918 WP_000022509.1.61920 WP_000022509.1.61924 WP_000022509.1.61952 WP_000022509.1.61968 WP_000022509.1.62007 WP_000022509.1.62020 WP_000022509.1.62025 WP_000022509.1.62063 WP_000022509.1.6209 WP_000022509.1.6210 WP_000022509.1.62108 WP_000022509.1.62120 WP_000022509.1.62122 WP_000022509.1.62124 WP_000022509.1.62142 WP_000022509.1.62144 WP_000022509.1.62158 WP_000022509.1.62184 WP_000022509.1.62195 WP_000022509.1.62199 WP_000022509.1.62201 WP_000022509.1.62204 WP_000022509.1.62210 WP_000022509.1.62222 WP_000022509.1.62223 WP_000022509.1.62257 WP_000022509.1.62271 WP_000022509.1.62302 WP_000022509.1.62304 WP_000022509.1.62310 WP_000022509.1.62314 WP_000022509.1.62323 WP_000022509.1.62333 WP_000022509.1.62338 WP_000022509.1.62339 WP_000022509.1.62344 WP_000022509.1.62361 WP_000022509.1.62364 WP_000022509.1.62374 WP_000022509.1.62380 WP_000022509.1.62403 WP_000022509.1.62404 WP_000022509.1.62411 WP_000022509.1.62412 WP_000022509.1.62436 WP_000022509.1.62475 WP_000022509.1.62486 WP_000022509.1.62488 WP_000022509.1.62504 WP_000022509.1.62522 WP_000022509.1.6253 WP_000022509.1.62536 WP_000022509.1.62564 WP_000022509.1.62570 WP_000022509.1.62619 WP_000022509.1.62640 WP_000022509.1.62648 WP_000022509.1.62677 WP_000022509.1.62686 WP_000022509.1.62693 WP_000022509.1.627 WP_000022509.1.62725 WP_000022509.1.62745 WP_000022509.1.62751 WP_000022509.1.62757 WP_000022509.1.62825 WP_000022509.1.62828 WP_000022509.1.62853 WP_000022509.1.62903 WP_000022509.1.62910 WP_000022509.1.62913 WP_000022509.1.6292 WP_000022509.1.62932 WP_000022509.1.62955 WP_000022509.1.62960 WP_000022509.1.62976 WP_000022509.1.62983 WP_000022509.1.62988 WP_000022509.1.63016 WP_000022509.1.63025 WP_000022509.1.63043 WP_000022509.1.63045 WP_000022509.1.63063 WP_000022509.1.63069 WP_000022509.1.63087 WP_000022509.1.63102 WP_000022509.1.63169 WP_000022509.1.63181 WP_000022509.1.63186 WP_000022509.1.63203 WP_000022509.1.63229 WP_000022509.1.63234 WP_000022509.1.63250 WP_000022509.1.63256 WP_000022509.1.63290 WP_000022509.1.63297 WP_000022509.1.63358 WP_000022509.1.63382 WP_000022509.1.63422 WP_000022509.1.63432 WP_000022509.1.63448 WP_000022509.1.63455 WP_000022509.1.63461 WP_000022509.1.63479 WP_000022509.1.63497 WP_000022509.1.63499 WP_000022509.1.63509 WP_000022509.1.63513 WP_000022509.1.63514 WP_000022509.1.63525 WP_000022509.1.63529 WP_000022509.1.6357 WP_000022509.1.63577 WP_000022509.1.63583 WP_000022509.1.63585 WP_000022509.1.63592 WP_000022509.1.63603 WP_000022509.1.63633 WP_000022509.1.63663 WP_000022509.1.63664 WP_000022509.1.6367 WP_000022509.1.63677 WP_000022509.1.63690 WP_000022509.1.6370 WP_000022509.1.63718 WP_000022509.1.63731 WP_000022509.1.63736 WP_000022509.1.63748 WP_000022509.1.6375 WP_000022509.1.63757 WP_000022509.1.63766 WP_000022509.1.63782 WP_000022509.1.63797 WP_000022509.1.63816 WP_000022509.1.63824 WP_000022509.1.63831 WP_000022509.1.63834 WP_000022509.1.63851 WP_000022509.1.63860 WP_000022509.1.63863 WP_000022509.1.63864 WP_000022509.1.63866 WP_000022509.1.63876 WP_000022509.1.6389 WP_000022509.1.63901 WP_000022509.1.63903 WP_000022509.1.63912 WP_000022509.1.63955 WP_000022509.1.63958 WP_000022509.1.63963 WP_000022509.1.63977 WP_000022509.1.63992 WP_000022509.1.64010 WP_000022509.1.64018 WP_000022509.1.64032 WP_000022509.1.64034 WP_000022509.1.64046 WP_000022509.1.64072 WP_000022509.1.64085 WP_000022509.1.64087 WP_000022509.1.64109 WP_000022509.1.6415 WP_000022509.1.64157 WP_000022509.1.64217 WP_000022509.1.64229 WP_000022509.1.6423 WP_000022509.1.64242 WP_000022509.1.64244 WP_000022509.1.64266 WP_000022509.1.64293 WP_000022509.1.64294 WP_000022509.1.64332 WP_000022509.1.64350 WP_000022509.1.6437 WP_000022509.1.64376 WP_000022509.1.64385 WP_000022509.1.64387 WP_000022509.1.64389 WP_000022509.1.644 WP_000022509.1.64403 WP_000022509.1.64462 WP_000022509.1.64471 WP_000022509.1.64500 WP_000022509.1.64501 WP_000022509.1.6451 WP_000022509.1.64538 WP_000022509.1.64569 WP_000022509.1.64597 WP_000022509.1.64632 WP_000022509.1.64648 WP_000022509.1.64649 WP_000022509.1.64654 WP_000022509.1.64662 WP_000022509.1.64663 WP_000022509.1.64667 WP_000022509.1.64674 WP_000022509.1.64690 WP_000022509.1.64702 WP_000022509.1.64709 WP_000022509.1.64710 WP_000022509.1.64711 WP_000022509.1.64744 WP_000022509.1.64757 WP_000022509.1.64758 WP_000022509.1.64763 WP_000022509.1.64781 WP_000022509.1.64798 WP_000022509.1.64817 WP_000022509.1.64831 WP_000022509.1.64847 WP_000022509.1.6487 WP_000022509.1.6489 WP_000022509.1.64891 WP_000022509.1.64894 WP_000022509.1.64919 WP_000022509.1.64944 WP_000022509.1.64972 WP_000022509.1.64974 WP_000022509.1.64977 WP_000022509.1.65011 WP_000022509.1.65018 WP_000022509.1.65022 WP_000022509.1.65028 WP_000022509.1.65052 WP_000022509.1.65054 WP_000022509.1.65075 WP_000022509.1.6514 WP_000022509.1.65163 WP_000022509.1.65171 WP_000022509.1.65172 WP_000022509.1.65185 WP_000022509.1.65191 WP_000022509.1.65200 WP_000022509.1.65211 WP_000022509.1.65218 WP_000022509.1.65226 WP_000022509.1.65248 WP_000022509.1.65249 WP_000022509.1.6525 WP_000022509.1.65266 WP_000022509.1.65269 WP_000022509.1.65295 WP_000022509.1.65348 WP_000022509.1.6535 WP_000022509.1.65357 WP_000022509.1.65363 WP_000022509.1.65394 WP_000022509.1.65395 WP_000022509.1.65437 WP_000022509.1.65459 WP_000022509.1.65463 WP_000022509.1.65474 WP_000022509.1.65475 WP_000022509.1.65487 WP_000022509.1.6549 WP_000022509.1.65499 WP_000022509.1.6550 WP_000022509.1.65508 WP_000022509.1.65538 WP_000022509.1.6554 WP_000022509.1.65558 WP_000022509.1.65572 WP_000022509.1.6560 WP_000022509.1.65601 WP_000022509.1.6561 WP_000022509.1.65633 WP_000022509.1.6565 WP_000022509.1.65650 WP_000022509.1.65687 WP_000022509.1.65696 WP_000022509.1.65697 WP_000022509.1.65698 WP_000022509.1.65699 WP_000022509.1.6572 WP_000022509.1.65737 WP_000022509.1.6575 WP_000022509.1.65755 WP_000022509.1.65771 WP_000022509.1.65782 WP_000022509.1.65790 WP_000022509.1.65795 WP_000022509.1.65812 WP_000022509.1.65818 WP_000022509.1.65838 WP_000022509.1.65846 WP_000022509.1.65849 WP_000022509.1.65863 WP_000022509.1.65876 WP_000022509.1.65881 WP_000022509.1.65883 WP_000022509.1.65901 WP_000022509.1.6594 WP_000022509.1.65940 WP_000022509.1.65945 WP_000022509.1.6595 WP_000022509.1.65956 WP_000022509.1.65968 WP_000022509.1.65985 WP_000022509.1.66021 WP_000022509.1.66031 WP_000022509.1.66049 WP_000022509.1.66052 WP_000022509.1.66064 WP_000022509.1.66074 WP_000022509.1.66082 WP_000022509.1.66085 WP_000022509.1.66109 WP_000022509.1.66145 WP_000022509.1.66167 WP_000022509.1.66171 WP_000022509.1.66183 WP_000022509.1.6620 WP_000022509.1.66216 WP_000022509.1.66234 WP_000022509.1.66235 WP_000022509.1.66250 WP_000022509.1.66270 WP_000022509.1.66272 WP_000022509.1.66273 WP_000022509.1.6630 WP_000022509.1.66314 WP_000022509.1.66315 WP_000022509.1.66324 WP_000022509.1.66330 WP_000022509.1.6634 WP_000022509.1.66358 WP_000022509.1.66361 WP_000022509.1.66362 WP_000022509.1.66368 WP_000022509.1.6638 WP_000022509.1.66385 WP_000022509.1.6640 WP_000022509.1.66400 WP_000022509.1.66428 WP_000022509.1.66446 WP_000022509.1.66462 WP_000022509.1.6647 WP_000022509.1.66480 WP_000022509.1.66506 WP_000022509.1.66534 WP_000022509.1.66539 WP_000022509.1.66600 WP_000022509.1.66630 WP_000022509.1.66665 WP_000022509.1.66678 WP_000022509.1.66681 WP_000022509.1.66684 WP_000022509.1.66698 WP_000022509.1.66702 WP_000022509.1.66733 WP_000022509.1.66755 WP_000022509.1.66759 WP_000022509.1.66779 WP_000022509.1.6680 WP_000022509.1.66800 WP_000022509.1.66801 WP_000022509.1.66820 WP_000022509.1.66824 WP_000022509.1.66825 WP_000022509.1.66834 WP_000022509.1.66860 WP_000022509.1.66876 WP_000022509.1.66901 WP_000022509.1.66953 WP_000022509.1.66955 WP_000022509.1.66959 WP_000022509.1.66962 WP_000022509.1.66981 WP_000022509.1.67 WP_000022509.1.67024 WP_000022509.1.67037 WP_000022509.1.67042 WP_000022509.1.67045 WP_000022509.1.67075 WP_000022509.1.6710 WP_000022509.1.67100 WP_000022509.1.67101 WP_000022509.1.67143 WP_000022509.1.67173 WP_000022509.1.67175 WP_000022509.1.67181 WP_000022509.1.67184 WP_000022509.1.67201 WP_000022509.1.67211 WP_000022509.1.67228 WP_000022509.1.67235 WP_000022509.1.67237 WP_000022509.1.67268 WP_000022509.1.67279 WP_000022509.1.67336 WP_000022509.1.67339 WP_000022509.1.67347 WP_000022509.1.67374 WP_000022509.1.67387 WP_000022509.1.6739 WP_000022509.1.67394 WP_000022509.1.67397 WP_000022509.1.67403 WP_000022509.1.67405 WP_000022509.1.67424 WP_000022509.1.67430 WP_000022509.1.67442 WP_000022509.1.67465 WP_000022509.1.67539 WP_000022509.1.67552 WP_000022509.1.67556 WP_000022509.1.67576 WP_000022509.1.6760 WP_000022509.1.67603 WP_000022509.1.67604 WP_000022509.1.67617 WP_000022509.1.67619 WP_000022509.1.67625 WP_000022509.1.67627 WP_000022509.1.67633 WP_000022509.1.67641 WP_000022509.1.67657 WP_000022509.1.67673 WP_000022509.1.67682 WP_000022509.1.67700 WP_000022509.1.67707 WP_000022509.1.67718 WP_000022509.1.67729 WP_000022509.1.67731 WP_000022509.1.67772 WP_000022509.1.67774 WP_000022509.1.67776 WP_000022509.1.67803 WP_000022509.1.67814 WP_000022509.1.6782 WP_000022509.1.67820 WP_000022509.1.67825 WP_000022509.1.67827 WP_000022509.1.67829 WP_000022509.1.6785 WP_000022509.1.67887 WP_000022509.1.67910 WP_000022509.1.67924 WP_000022509.1.67932 WP_000022509.1.67954 WP_000022509.1.67969 WP_000022509.1.67970 WP_000022509.1.67977 WP_000022509.1.67988 WP_000022509.1.68 WP_000022509.1.68043 WP_000022509.1.68073 WP_000022509.1.68075 WP_000022509.1.6809 WP_000022509.1.68105 WP_000022509.1.68113 WP_000022509.1.68115 WP_000022509.1.68131 WP_000022509.1.68140 WP_000022509.1.68147 WP_000022509.1.68159 WP_000022509.1.68167 WP_000022509.1.68182 WP_000022509.1.6819 WP_000022509.1.68201 WP_000022509.1.68206 WP_000022509.1.68210 WP_000022509.1.6827 WP_000022509.1.68275 WP_000022509.1.68285 WP_000022509.1.6833 WP_000022509.1.68359 WP_000022509.1.68401 WP_000022509.1.68420 WP_000022509.1.68477 WP_000022509.1.68478 WP_000022509.1.6849 WP_000022509.1.685 WP_000022509.1.68514 WP_000022509.1.68547 WP_000022509.1.68564 WP_000022509.1.6857 WP_000022509.1.68589 WP_000022509.1.68629 WP_000022509.1.68652 WP_000022509.1.68655 WP_000022509.1.68656 WP_000022509.1.68658 WP_000022509.1.68677 WP_000022509.1.6869 WP_000022509.1.68690 WP_000022509.1.68742 WP_000022509.1.6875 WP_000022509.1.68770 WP_000022509.1.68778 WP_000022509.1.68787 WP_000022509.1.6879 WP_000022509.1.68809 WP_000022509.1.68816 WP_000022509.1.6882 WP_000022509.1.6883 WP_000022509.1.68893 WP_000022509.1.68894 WP_000022509.1.68895 WP_000022509.1.68914 WP_000022509.1.68928 WP_000022509.1.68958 WP_000022509.1.68966 WP_000022509.1.68975 WP_000022509.1.68999 WP_000022509.1.69001 WP_000022509.1.69006 WP_000022509.1.69011 WP_000022509.1.69029 WP_000022509.1.6904 WP_000022509.1.6905 WP_000022509.1.69053 WP_000022509.1.69058 WP_000022509.1.69080 WP_000022509.1.69086 WP_000022509.1.6913 WP_000022509.1.69131 WP_000022509.1.69139 WP_000022509.1.69146 WP_000022509.1.69151 WP_000022509.1.69170 WP_000022509.1.69210 WP_000022509.1.69236 WP_000022509.1.69255 WP_000022509.1.69270 WP_000022509.1.69273 WP_000022509.1.69282 WP_000022509.1.69288 WP_000022509.1.69346 WP_000022509.1.69357 WP_000022509.1.69359 WP_000022509.1.69371 WP_000022509.1.69376 WP_000022509.1.69385 WP_000022509.1.69396 WP_000022509.1.69397 WP_000022509.1.69433 WP_000022509.1.69465 WP_000022509.1.69466 WP_000022509.1.69485 WP_000022509.1.69515 WP_000022509.1.6954 WP_000022509.1.69554 WP_000022509.1.69564 WP_000022509.1.69575 WP_000022509.1.69588 WP_000022509.1.69592 WP_000022509.1.69597 WP_000022509.1.69611 WP_000022509.1.69616 WP_000022509.1.69642 WP_000022509.1.69644 WP_000022509.1.69656 WP_000022509.1.69657 WP_000022509.1.69690 WP_000022509.1.69696 WP_000022509.1.69704 WP_000022509.1.69710 WP_000022509.1.69754 WP_000022509.1.69758 WP_000022509.1.69760 WP_000022509.1.69767 WP_000022509.1.69785 WP_000022509.1.69787 WP_000022509.1.69790 WP_000022509.1.69808 WP_000022509.1.69817 WP_000022509.1.69839 WP_000022509.1.69848 WP_000022509.1.69923 WP_000022509.1.69948 WP_000022509.1.69953 WP_000022509.1.69965 WP_000022509.1.69975 WP_000022509.1.69977 WP_000022509.1.69982 WP_000022509.1.70003 WP_000022509.1.70010 WP_000022509.1.70028 WP_000022509.1.70047 WP_000022509.1.70049 WP_000022509.1.70058 WP_000022509.1.70061 WP_000022509.1.70087 WP_000022509.1.70088 WP_000022509.1.7010 WP_000022509.1.7014 WP_000022509.1.7016 WP_000022509.1.70169 WP_000022509.1.70183 WP_000022509.1.70205 WP_000022509.1.7021 WP_000022509.1.70240 WP_000022509.1.70241 WP_000022509.1.70249 WP_000022509.1.70261 WP_000022509.1.70269 WP_000022509.1.70272 WP_000022509.1.70281 WP_000022509.1.70289 WP_000022509.1.70314 WP_000022509.1.70326 WP_000022509.1.70327 WP_000022509.1.7033 WP_000022509.1.70355 WP_000022509.1.70427 WP_000022509.1.70433 WP_000022509.1.7044 WP_000022509.1.70440 WP_000022509.1.70447 WP_000022509.1.70485 WP_000022509.1.70491 WP_000022509.1.70523 WP_000022509.1.70531 WP_000022509.1.70545 WP_000022509.1.70547 WP_000022509.1.7055 WP_000022509.1.70596 WP_000022509.1.7060 WP_000022509.1.70623 WP_000022509.1.70643 WP_000022509.1.70644 WP_000022509.1.70662 WP_000022509.1.70671 WP_000022509.1.70678 WP_000022509.1.70679 WP_000022509.1.70683 WP_000022509.1.70685 WP_000022509.1.70708 WP_000022509.1.70712 WP_000022509.1.70717 WP_000022509.1.70731 WP_000022509.1.70732 WP_000022509.1.70733 WP_000022509.1.70761 WP_000022509.1.70772 WP_000022509.1.70785 WP_000022509.1.70792 WP_000022509.1.70797 WP_000022509.1.70837 WP_000022509.1.70845 WP_000022509.1.70846 WP_000022509.1.70869 WP_000022509.1.70883 WP_000022509.1.70899 WP_000022509.1.70922 WP_000022509.1.7093 WP_000022509.1.70948 WP_000022509.1.70957 WP_000022509.1.70959 WP_000022509.1.70969 WP_000022509.1.70981 WP_000022509.1.70985 WP_000022509.1.70986 WP_000022509.1.70995 WP_000022509.1.71007 WP_000022509.1.71023 WP_000022509.1.71039 WP_000022509.1.71057 WP_000022509.1.71069 WP_000022509.1.71081 WP_000022509.1.71088 WP_000022509.1.71116 WP_000022509.1.71117 WP_000022509.1.71120 WP_000022509.1.71146 WP_000022509.1.71150 WP_000022509.1.71165 WP_000022509.1.71172 WP_000022509.1.71184 WP_000022509.1.71186 WP_000022509.1.71188 WP_000022509.1.71201 WP_000022509.1.71202 WP_000022509.1.71243 WP_000022509.1.71268 WP_000022509.1.71299 WP_000022509.1.71305 WP_000022509.1.71306 WP_000022509.1.71337 WP_000022509.1.71363 WP_000022509.1.71378 WP_000022509.1.714 WP_000022509.1.71401 WP_000022509.1.71407 WP_000022509.1.7142 WP_000022509.1.71450 WP_000022509.1.71452 WP_000022509.1.71455 WP_000022509.1.71456 WP_000022509.1.71481 WP_000022509.1.71487 WP_000022509.1.71500 WP_000022509.1.71523 WP_000022509.1.71542 WP_000022509.1.71566 WP_000022509.1.71583 WP_000022509.1.71626 WP_000022509.1.71636 WP_000022509.1.71640 WP_000022509.1.71649 WP_000022509.1.71651 WP_000022509.1.71653 WP_000022509.1.71656 WP_000022509.1.71667 WP_000022509.1.71691 WP_000022509.1.71702 WP_000022509.1.71716 WP_000022509.1.71746 WP_000022509.1.71750 WP_000022509.1.71798 WP_000022509.1.71845 WP_000022509.1.71848 WP_000022509.1.71872 WP_000022509.1.71881 WP_000022509.1.71908 WP_000022509.1.71923 WP_000022509.1.71941 WP_000022509.1.71950 WP_000022509.1.71952 WP_000022509.1.71954 WP_000022509.1.71973 WP_000022509.1.71979 WP_000022509.1.71984 WP_000022509.1.71985 WP_000022509.1.720 WP_000022509.1.72003 WP_000022509.1.72065 WP_000022509.1.72068 WP_000022509.1.72073 WP_000022509.1.72100 WP_000022509.1.72105 WP_000022509.1.72107 WP_000022509.1.72119 WP_000022509.1.72121 WP_000022509.1.72188 WP_000022509.1.72190 WP_000022509.1.72203 WP_000022509.1.72221 WP_000022509.1.72234 WP_000022509.1.72243 WP_000022509.1.72254 WP_000022509.1.72269 WP_000022509.1.72277 WP_000022509.1.72281 WP_000022509.1.72283 WP_000022509.1.72300 WP_000022509.1.72307 WP_000022509.1.72325 WP_000022509.1.72339 WP_000022509.1.72350 WP_000022509.1.72351 WP_000022509.1.72372 WP_000022509.1.72376 WP_000022509.1.72382 WP_000022509.1.72383 WP_000022509.1.72403 WP_000022509.1.72412 WP_000022509.1.7243 WP_000022509.1.72438 WP_000022509.1.72461 WP_000022509.1.72527 WP_000022509.1.72532 WP_000022509.1.7255 WP_000022509.1.72594 WP_000022509.1.72602 WP_000022509.1.72629 WP_000022509.1.72631 WP_000022509.1.72638 WP_000022509.1.72642 WP_000022509.1.72667 WP_000022509.1.72671 WP_000022509.1.72674 WP_000022509.1.72716 WP_000022509.1.72718 WP_000022509.1.72724 WP_000022509.1.72728 WP_000022509.1.72789 WP_000022509.1.72793 WP_000022509.1.72797 WP_000022509.1.72827 WP_000022509.1.72828 WP_000022509.1.72843 WP_000022509.1.72850 WP_000022509.1.72865 WP_000022509.1.72871 WP_000022509.1.72872 WP_000022509.1.72887 WP_000022509.1.72892 WP_000022509.1.72894 WP_000022509.1.72896 WP_000022509.1.72897 WP_000022509.1.72944 WP_000022509.1.72946 WP_000022509.1.7295 WP_000022509.1.72969 WP_000022509.1.72975 WP_000022509.1.72987 WP_000022509.1.7304 WP_000022509.1.73052 WP_000022509.1.73062 WP_000022509.1.73068 WP_000022509.1.73102 WP_000022509.1.7311 WP_000022509.1.73114 WP_000022509.1.73125 WP_000022509.1.73144 WP_000022509.1.7315 WP_000022509.1.7316 WP_000022509.1.73164 WP_000022509.1.73177 WP_000022509.1.73180 WP_000022509.1.73200 WP_000022509.1.73258 WP_000022509.1.73270 WP_000022509.1.73285 WP_000022509.1.7332 WP_000022509.1.73328 WP_000022509.1.7333 WP_000022509.1.7334 WP_000022509.1.73352 WP_000022509.1.73362 WP_000022509.1.73377 WP_000022509.1.73379 WP_000022509.1.73389 WP_000022509.1.7341 WP_000022509.1.73425 WP_000022509.1.73461 WP_000022509.1.73481 WP_000022509.1.73488 WP_000022509.1.73504 WP_000022509.1.73512 WP_000022509.1.7353 WP_000022509.1.73535 WP_000022509.1.73544 WP_000022509.1.7356 WP_000022509.1.73561 WP_000022509.1.73581 WP_000022509.1.73598 WP_000022509.1.7361 WP_000022509.1.73617 WP_000022509.1.73648 WP_000022509.1.73667 WP_000022509.1.73701 WP_000022509.1.73708 WP_000022509.1.7374 WP_000022509.1.73753 WP_000022509.1.73758 WP_000022509.1.73768 WP_000022509.1.73794 WP_000022509.1.73804 WP_000022509.1.73847 WP_000022509.1.73849 WP_000022509.1.7386 WP_000022509.1.7387 WP_000022509.1.73924 WP_000022509.1.73926 WP_000022509.1.7394 WP_000022509.1.73945 WP_000022509.1.73948 WP_000022509.1.73958 WP_000022509.1.73965 WP_000022509.1.73999 WP_000022509.1.74024 WP_000022509.1.74028 WP_000022509.1.74029 WP_000022509.1.74030 WP_000022509.1.74038 WP_000022509.1.74040 WP_000022509.1.74043 WP_000022509.1.74049 WP_000022509.1.7405 WP_000022509.1.74058 WP_000022509.1.74070 WP_000022509.1.74077 WP_000022509.1.74089 WP_000022509.1.74117 WP_000022509.1.74135 WP_000022509.1.74174 WP_000022509.1.74181 WP_000022509.1.74191 WP_000022509.1.74207 WP_000022509.1.74214 WP_000022509.1.74228 WP_000022509.1.74241 WP_000022509.1.74248 WP_000022509.1.74285 WP_000022509.1.743 WP_000022509.1.7430 WP_000022509.1.74300 WP_000022509.1.74317 WP_000022509.1.7433 WP_000022509.1.74379 WP_000022509.1.74410 WP_000022509.1.74414 WP_000022509.1.74415 WP_000022509.1.74418 WP_000022509.1.74428 WP_000022509.1.74454 WP_000022509.1.74466 WP_000022509.1.74469 WP_000022509.1.74481 WP_000022509.1.745 WP_000022509.1.74500 WP_000022509.1.74529 WP_000022509.1.74545 WP_000022509.1.74570 WP_000022509.1.74578 WP_000022509.1.7458 WP_000022509.1.74616 WP_000022509.1.74620 WP_000022509.1.74621 WP_000022509.1.74632 WP_000022509.1.74639 WP_000022509.1.74644 WP_000022509.1.74647 WP_000022509.1.74661 WP_000022509.1.74677 WP_000022509.1.74699 WP_000022509.1.74702 WP_000022509.1.74741 WP_000022509.1.74745 WP_000022509.1.74757 WP_000022509.1.74806 WP_000022509.1.74807 WP_000022509.1.74826 WP_000022509.1.74831 WP_000022509.1.74876 WP_000022509.1.74894 WP_000022509.1.7491 WP_000022509.1.74929 WP_000022509.1.74939 WP_000022509.1.74946 WP_000022509.1.74972 WP_000022509.1.74973 WP_000022509.1.74992 WP_000022509.1.74996 WP_000022509.1.75009 WP_000022509.1.75051 WP_000022509.1.75056 WP_000022509.1.75058 WP_000022509.1.7507 WP_000022509.1.75089 WP_000022509.1.75114 WP_000022509.1.75116 WP_000022509.1.75129 WP_000022509.1.75134 WP_000022509.1.75148 WP_000022509.1.75159 WP_000022509.1.75168 WP_000022509.1.75177 WP_000022509.1.75180 WP_000022509.1.75187 WP_000022509.1.75237 WP_000022509.1.75273 WP_000022509.1.75288 WP_000022509.1.75296 WP_000022509.1.75301 WP_000022509.1.7531 WP_000022509.1.75334 WP_000022509.1.75362 WP_000022509.1.75371 WP_000022509.1.75385 WP_000022509.1.75392 WP_000022509.1.75400 WP_000022509.1.75413 WP_000022509.1.7543 WP_000022509.1.75433 WP_000022509.1.75450 WP_000022509.1.75494 WP_000022509.1.75532 WP_000022509.1.75565 WP_000022509.1.7558 WP_000022509.1.75585 WP_000022509.1.75593 WP_000022509.1.75607 WP_000022509.1.75609 WP_000022509.1.75610 WP_000022509.1.75626 WP_000022509.1.75633 WP_000022509.1.75664 WP_000022509.1.75703 WP_000022509.1.75716 WP_000022509.1.75718 WP_000022509.1.75740 WP_000022509.1.75745 WP_000022509.1.75751 WP_000022509.1.75760 WP_000022509.1.75764 WP_000022509.1.75793 WP_000022509.1.75794 WP_000022509.1.75810 WP_000022509.1.75828 WP_000022509.1.75837 WP_000022509.1.75844 WP_000022509.1.75863 WP_000022509.1.75873 WP_000022509.1.75874 WP_000022509.1.75886 WP_000022509.1.75898 WP_000022509.1.75902 WP_000022509.1.75945 WP_000022509.1.76 WP_000022509.1.76020 WP_000022509.1.76081 WP_000022509.1.76102 WP_000022509.1.76108 WP_000022509.1.76115 WP_000022509.1.76116 WP_000022509.1.76122 WP_000022509.1.76137 WP_000022509.1.76156 WP_000022509.1.76164 WP_000022509.1.76170 WP_000022509.1.76186 WP_000022509.1.76197 WP_000022509.1.76208 WP_000022509.1.76252 WP_000022509.1.76256 WP_000022509.1.7629 WP_000022509.1.76301 WP_000022509.1.76327 WP_000022509.1.7633 WP_000022509.1.76339 WP_000022509.1.7634 WP_000022509.1.76345 WP_000022509.1.76346 WP_000022509.1.76366 WP_000022509.1.76417 WP_000022509.1.76445 WP_000022509.1.76451 WP_000022509.1.7646 WP_000022509.1.76471 WP_000022509.1.76495 WP_000022509.1.76510 WP_000022509.1.76529 WP_000022509.1.76532 WP_000022509.1.76548 WP_000022509.1.7655 WP_000022509.1.76558 WP_000022509.1.7657 WP_000022509.1.76572 WP_000022509.1.76576 WP_000022509.1.7660 WP_000022509.1.76611 WP_000022509.1.76641 WP_000022509.1.76651 WP_000022509.1.76653 WP_000022509.1.76673 WP_000022509.1.76706 WP_000022509.1.7672 WP_000022509.1.76721 WP_000022509.1.76738 WP_000022509.1.76756 WP_000022509.1.76760 WP_000022509.1.76776 WP_000022509.1.76788 WP_000022509.1.76799 WP_000022509.1.7684 WP_000022509.1.76854 WP_000022509.1.76866 WP_000022509.1.76875 WP_000022509.1.76880 WP_000022509.1.76899 WP_000022509.1.76913 WP_000022509.1.76916 WP_000022509.1.76932 WP_000022509.1.76968 WP_000022509.1.76973 WP_000022509.1.76988 WP_000022509.1.77016 WP_000022509.1.77017 WP_000022509.1.77033 WP_000022509.1.77038 WP_000022509.1.77047 WP_000022509.1.77080 WP_000022509.1.77087 WP_000022509.1.77090 WP_000022509.1.77111 WP_000022509.1.7712 WP_000022509.1.77177 WP_000022509.1.77180 WP_000022509.1.77241 WP_000022509.1.77244 WP_000022509.1.77267 WP_000022509.1.77271 WP_000022509.1.77292 WP_000022509.1.77299 WP_000022509.1.77306 WP_000022509.1.77313 WP_000022509.1.77349 WP_000022509.1.77356 WP_000022509.1.77384 WP_000022509.1.77390 WP_000022509.1.77431 WP_000022509.1.77436 WP_000022509.1.77440 WP_000022509.1.77475 WP_000022509.1.77496 WP_000022509.1.77501 WP_000022509.1.77512 WP_000022509.1.77513 WP_000022509.1.77514 WP_000022509.1.77529 WP_000022509.1.77543 WP_000022509.1.77549 WP_000022509.1.77555 WP_000022509.1.77563 WP_000022509.1.77575 WP_000022509.1.77596 WP_000022509.1.77629 WP_000022509.1.77646 WP_000022509.1.77653 WP_000022509.1.77692 WP_000022509.1.77702 WP_000022509.1.77710 WP_000022509.1.77713 WP_000022509.1.7772 WP_000022509.1.77729 WP_000022509.1.77754 WP_000022509.1.77761 WP_000022509.1.7782 WP_000022509.1.77825 WP_000022509.1.77837 WP_000022509.1.7784 WP_000022509.1.77846 WP_000022509.1.77851 WP_000022509.1.77871 WP_000022509.1.77898 WP_000022509.1.77900 WP_000022509.1.77918 WP_000022509.1.7792 WP_000022509.1.77923 WP_000022509.1.7793 WP_000022509.1.77960 WP_000022509.1.77975 WP_000022509.1.77983 WP_000022509.1.77987 WP_000022509.1.77989 WP_000022509.1.78 WP_000022509.1.78016 WP_000022509.1.7802 WP_000022509.1.78026 WP_000022509.1.78033 WP_000022509.1.78035 WP_000022509.1.78048 WP_000022509.1.78051 WP_000022509.1.78053 WP_000022509.1.78076 WP_000022509.1.78096 WP_000022509.1.78100 WP_000022509.1.78107 WP_000022509.1.78110 WP_000022509.1.78120 WP_000022509.1.7814 WP_000022509.1.78166 WP_000022509.1.78168 WP_000022509.1.78180 WP_000022509.1.78192 WP_000022509.1.78195 WP_000022509.1.78245 WP_000022509.1.78259 WP_000022509.1.78291 WP_000022509.1.78301 WP_000022509.1.78309 WP_000022509.1.78320 WP_000022509.1.78339 WP_000022509.1.78352 WP_000022509.1.78366 WP_000022509.1.78372 WP_000022509.1.78382 WP_000022509.1.78383 WP_000022509.1.78388 WP_000022509.1.78407 WP_000022509.1.78410 WP_000022509.1.78443 WP_000022509.1.78495 WP_000022509.1.78496 WP_000022509.1.78501 WP_000022509.1.78502 WP_000022509.1.78602 WP_000022509.1.78603 WP_000022509.1.7861 WP_000022509.1.78618 WP_000022509.1.7862 WP_000022509.1.78626 WP_000022509.1.78632 WP_000022509.1.78658 WP_000022509.1.78661 WP_000022509.1.78673 WP_000022509.1.78674 WP_000022509.1.78676 WP_000022509.1.78697 WP_000022509.1.78734 WP_000022509.1.78735 WP_000022509.1.78738 WP_000022509.1.78761 WP_000022509.1.7877 WP_000022509.1.78771 WP_000022509.1.78789 WP_000022509.1.78802 WP_000022509.1.78815 WP_000022509.1.78830 WP_000022509.1.78835 WP_000022509.1.78838 WP_000022509.1.78871 WP_000022509.1.78874 WP_000022509.1.78877 WP_000022509.1.78881 WP_000022509.1.78896 WP_000022509.1.789 WP_000022509.1.78913 WP_000022509.1.78918 WP_000022509.1.7893 WP_000022509.1.78930 WP_000022509.1.78951 WP_000022509.1.78959 WP_000022509.1.78993 WP_000022509.1.79011 WP_000022509.1.79012 WP_000022509.1.79032 WP_000022509.1.79069 WP_000022509.1.79074 WP_000022509.1.79081 WP_000022509.1.79098 WP_000022509.1.79099 WP_000022509.1.79140 WP_000022509.1.79151 WP_000022509.1.79155 WP_000022509.1.79164 WP_000022509.1.79167 WP_000022509.1.79189 WP_000022509.1.79203 WP_000022509.1.79204 WP_000022509.1.79235 WP_000022509.1.79280 WP_000022509.1.79289 WP_000022509.1.79297 WP_000022509.1.79302 WP_000022509.1.79335 WP_000022509.1.79397 WP_000022509.1.794 WP_000022509.1.79427 WP_000022509.1.79456 WP_000022509.1.79462 WP_000022509.1.79466 WP_000022509.1.79468 WP_000022509.1.79472 WP_000022509.1.79490 WP_000022509.1.79495 WP_000022509.1.79529 WP_000022509.1.79531 WP_000022509.1.79532 WP_000022509.1.79547 WP_000022509.1.7956 WP_000022509.1.79570 WP_000022509.1.79580 WP_000022509.1.79586 WP_000022509.1.79635 WP_000022509.1.7964 WP_000022509.1.79645 WP_000022509.1.79654 WP_000022509.1.79659 WP_000022509.1.79668 WP_000022509.1.7970 WP_000022509.1.79708 WP_000022509.1.7972 WP_000022509.1.79722 WP_000022509.1.79734 WP_000022509.1.79738 WP_000022509.1.79772 WP_000022509.1.79778 WP_000022509.1.7979 WP_000022509.1.7982 WP_000022509.1.79845 WP_000022509.1.79867 WP_000022509.1.79880 WP_000022509.1.79892 WP_000022509.1.7991 WP_000022509.1.79914 WP_000022509.1.79916 WP_000022509.1.79929 WP_000022509.1.79934 WP_000022509.1.7994 WP_000022509.1.79942 WP_000022509.1.79945 WP_000022509.1.79951 WP_000022509.1.79966 WP_000022509.1.79977 WP_000022509.1.79996 WP_000022509.1.80065 WP_000022509.1.80077 WP_000022509.1.80103 WP_000022509.1.80137 WP_000022509.1.80149 WP_000022509.1.80182 WP_000022509.1.80229 WP_000022509.1.80236 WP_000022509.1.8024 WP_000022509.1.80249 WP_000022509.1.80250 WP_000022509.1.80254 WP_000022509.1.80273 WP_000022509.1.80282 WP_000022509.1.80293 WP_000022509.1.80296 WP_000022509.1.80307 WP_000022509.1.80333 WP_000022509.1.80354 WP_000022509.1.80366 WP_000022509.1.80368 WP_000022509.1.80380 WP_000022509.1.80386 WP_000022509.1.80400 WP_000022509.1.80441 WP_000022509.1.80462 WP_000022509.1.80473 WP_000022509.1.80479 WP_000022509.1.80480 WP_000022509.1.8049 WP_000022509.1.80492 WP_000022509.1.80496 WP_000022509.1.80569 WP_000022509.1.80629 WP_000022509.1.80638 WP_000022509.1.80651 WP_000022509.1.80664 WP_000022509.1.80667 WP_000022509.1.80674 WP_000022509.1.80696 WP_000022509.1.80707 WP_000022509.1.80723 WP_000022509.1.80725 WP_000022509.1.80741 WP_000022509.1.80750 WP_000022509.1.80757 WP_000022509.1.80760 WP_000022509.1.80780 WP_000022509.1.80803 WP_000022509.1.80819 WP_000022509.1.80827 WP_000022509.1.80831 WP_000022509.1.80840 WP_000022509.1.80850 WP_000022509.1.80857 WP_000022509.1.80868 WP_000022509.1.80874 WP_000022509.1.80876 WP_000022509.1.80881 WP_000022509.1.80913 WP_000022509.1.80927 WP_000022509.1.80939 WP_000022509.1.80959 WP_000022509.1.8096 WP_000022509.1.80973 WP_000022509.1.80984 WP_000022509.1.81037 WP_000022509.1.81041 WP_000022509.1.8106 WP_000022509.1.81062 WP_000022509.1.81067 WP_000022509.1.81069 WP_000022509.1.81084 WP_000022509.1.81109 WP_000022509.1.81110 WP_000022509.1.81118 WP_000022509.1.81131 WP_000022509.1.81149 WP_000022509.1.81175 WP_000022509.1.81187 WP_000022509.1.8119 WP_000022509.1.81193 WP_000022509.1.81197 WP_000022509.1.81225 WP_000022509.1.81231 WP_000022509.1.81262 WP_000022509.1.81268 WP_000022509.1.81269 WP_000022509.1.8127 WP_000022509.1.81271 WP_000022509.1.81275 WP_000022509.1.8130 WP_000022509.1.81302 WP_000022509.1.81305 WP_000022509.1.8131 WP_000022509.1.81320 WP_000022509.1.81321 WP_000022509.1.81328 WP_000022509.1.81333 WP_000022509.1.8134 WP_000022509.1.81342 WP_000022509.1.81354 WP_000022509.1.81364 WP_000022509.1.81388 WP_000022509.1.81404 WP_000022509.1.81409 WP_000022509.1.81410 WP_000022509.1.81425 WP_000022509.1.81472 WP_000022509.1.81494 WP_000022509.1.81504 WP_000022509.1.81528 WP_000022509.1.81548 WP_000022509.1.81557 WP_000022509.1.81568 WP_000022509.1.81667 WP_000022509.1.81668 WP_000022509.1.81676 WP_000022509.1.8168 WP_000022509.1.81681 WP_000022509.1.8170 WP_000022509.1.81727 WP_000022509.1.81735 WP_000022509.1.81736 WP_000022509.1.81743 WP_000022509.1.81746 WP_000022509.1.81750 WP_000022509.1.81760 WP_000022509.1.81763 WP_000022509.1.81768 WP_000022509.1.81785 WP_000022509.1.81798 WP_000022509.1.81855 WP_000022509.1.81902 WP_000022509.1.81921 WP_000022509.1.81931 WP_000022509.1.81936 WP_000022509.1.81941 WP_000022509.1.81949 WP_000022509.1.8196 WP_000022509.1.81965 WP_000022509.1.81974 WP_000022509.1.81977 WP_000022509.1.81995 WP_000022509.1.82037 WP_000022509.1.82070 WP_000022509.1.82076 WP_000022509.1.82131 WP_000022509.1.82141 WP_000022509.1.82144 WP_000022509.1.82149 WP_000022509.1.82156 WP_000022509.1.8218 WP_000022509.1.82180 WP_000022509.1.82192 WP_000022509.1.82201 WP_000022509.1.82214 WP_000022509.1.82225 WP_000022509.1.82232 WP_000022509.1.82258 WP_000022509.1.82269 WP_000022509.1.82337 WP_000022509.1.82347 WP_000022509.1.82352 WP_000022509.1.8236 WP_000022509.1.82369 WP_000022509.1.8240 WP_000022509.1.82401 WP_000022509.1.82408 WP_000022509.1.82416 WP_000022509.1.8242 WP_000022509.1.82420 WP_000022509.1.82434 WP_000022509.1.82456 WP_000022509.1.82464 WP_000022509.1.82465 WP_000022509.1.8247 WP_000022509.1.82473 WP_000022509.1.82474 WP_000022509.1.82479 WP_000022509.1.82503 WP_000022509.1.82515 WP_000022509.1.82530 WP_000022509.1.82553 WP_000022509.1.82562 WP_000022509.1.82569 WP_000022509.1.82570 WP_000022509.1.82584 WP_000022509.1.82636 WP_000022509.1.82637 WP_000022509.1.82646 WP_000022509.1.82648 WP_000022509.1.82670 WP_000022509.1.82676 WP_000022509.1.82692 WP_000022509.1.82731 WP_000022509.1.82761 WP_000022509.1.82763 WP_000022509.1.82812 WP_000022509.1.8282 WP_000022509.1.82843 WP_000022509.1.82850 WP_000022509.1.82867 WP_000022509.1.82872 WP_000022509.1.82886 WP_000022509.1.82895 WP_000022509.1.82899 WP_000022509.1.82937 WP_000022509.1.8294 WP_000022509.1.82944 WP_000022509.1.82946 WP_000022509.1.82956 WP_000022509.1.82959 WP_000022509.1.82964 WP_000022509.1.82992 WP_000022509.1.83005 WP_000022509.1.83006 WP_000022509.1.83007 WP_000022509.1.8304 WP_000022509.1.83061 WP_000022509.1.83092 WP_000022509.1.83119 WP_000022509.1.83128 WP_000022509.1.83139 WP_000022509.1.83150 WP_000022509.1.83163 WP_000022509.1.83180 WP_000022509.1.83204 WP_000022509.1.8322 WP_000022509.1.83221 WP_000022509.1.83229 WP_000022509.1.83235 WP_000022509.1.83247 WP_000022509.1.83252 WP_000022509.1.83258 WP_000022509.1.83280 WP_000022509.1.83290 WP_000022509.1.83301 WP_000022509.1.83305 WP_000022509.1.83331 WP_000022509.1.83333 WP_000022509.1.83354 WP_000022509.1.83356 WP_000022509.1.83360 WP_000022509.1.83365 WP_000022509.1.83378 WP_000022509.1.83382 WP_000022509.1.83388 WP_000022509.1.83413 WP_000022509.1.83491 WP_000022509.1.83510 WP_000022509.1.83516 WP_000022509.1.83523 WP_000022509.1.8354 WP_000022509.1.83558 WP_000022509.1.83572 WP_000022509.1.83598 WP_000022509.1.83651 WP_000022509.1.83657 WP_000022509.1.83677 WP_000022509.1.83710 WP_000022509.1.83721 WP_000022509.1.8375 WP_000022509.1.83759 WP_000022509.1.83760 WP_000022509.1.83806 WP_000022509.1.83897 WP_000022509.1.83923 WP_000022509.1.83960 WP_000022509.1.8399 WP_000022509.1.83994 WP_000022509.1.83995 WP_000022509.1.84 WP_000022509.1.84000 WP_000022509.1.84011 WP_000022509.1.84031 WP_000022509.1.8406 WP_000022509.1.84076 WP_000022509.1.84083 WP_000022509.1.84086 WP_000022509.1.84103 WP_000022509.1.84106 WP_000022509.1.84110 WP_000022509.1.84115 WP_000022509.1.84127 WP_000022509.1.84150 WP_000022509.1.84154 WP_000022509.1.84168 WP_000022509.1.84179 WP_000022509.1.84198 WP_000022509.1.84205 WP_000022509.1.84209 WP_000022509.1.84229 WP_000022509.1.84230 WP_000022509.1.84252 WP_000022509.1.84283 WP_000022509.1.84291 WP_000022509.1.84300 WP_000022509.1.8431 WP_000022509.1.84325 WP_000022509.1.84345 WP_000022509.1.84359 WP_000022509.1.84369 WP_000022509.1.84373 WP_000022509.1.84392 WP_000022509.1.84397 WP_000022509.1.84401 WP_000022509.1.84403 WP_000022509.1.8441 WP_000022509.1.84435 WP_000022509.1.84459 WP_000022509.1.84461 WP_000022509.1.84475 WP_000022509.1.84497 WP_000022509.1.84515 WP_000022509.1.84523 WP_000022509.1.84532 WP_000022509.1.84551 WP_000022509.1.84554 WP_000022509.1.84567 WP_000022509.1.84572 WP_000022509.1.84598 WP_000022509.1.84631 WP_000022509.1.84644 WP_000022509.1.84659 WP_000022509.1.84683 WP_000022509.1.84693 WP_000022509.1.84711 WP_000022509.1.84721 WP_000022509.1.84727 WP_000022509.1.84744 WP_000022509.1.84745 WP_000022509.1.84773 WP_000022509.1.84814 WP_000022509.1.84872 WP_000022509.1.84876 WP_000022509.1.84879 WP_000022509.1.84899 WP_000022509.1.849 WP_000022509.1.84945 WP_000022509.1.84967 WP_000022509.1.8497 WP_000022509.1.84983 WP_000022509.1.850 WP_000022509.1.85004 WP_000022509.1.85014 WP_000022509.1.8502 WP_000022509.1.85031 WP_000022509.1.85039 WP_000022509.1.85040 WP_000022509.1.85079 WP_000022509.1.85094 WP_000022509.1.85120 WP_000022509.1.85134 WP_000022509.1.85147 WP_000022509.1.85153 WP_000022509.1.85178 WP_000022509.1.85180 WP_000022509.1.85190 WP_000022509.1.85192 WP_000022509.1.85217 WP_000022509.1.8526 WP_000022509.1.85271 WP_000022509.1.85273 WP_000022509.1.85301 WP_000022509.1.8533 WP_000022509.1.85338 WP_000022509.1.85339 WP_000022509.1.8537 WP_000022509.1.85408 WP_000022509.1.85433 WP_000022509.1.8545 WP_000022509.1.85456 WP_000022509.1.85469 WP_000022509.1.85481 WP_000022509.1.85483 WP_000022509.1.85511 WP_000022509.1.85512 WP_000022509.1.8552 WP_000022509.1.85541 WP_000022509.1.8556 WP_000022509.1.85568 WP_000022509.1.8557 WP_000022509.1.85606 WP_000022509.1.85615 WP_000022509.1.85617 WP_000022509.1.85635 WP_000022509.1.85646 WP_000022509.1.85654 WP_000022509.1.85663 WP_000022509.1.85665 WP_000022509.1.85669 WP_000022509.1.85671 WP_000022509.1.85672 WP_000022509.1.85675 WP_000022509.1.85688 WP_000022509.1.85703 WP_000022509.1.85723 WP_000022509.1.85728 WP_000022509.1.85742 WP_000022509.1.85746 WP_000022509.1.85759 WP_000022509.1.85777 WP_000022509.1.85780 WP_000022509.1.85784 WP_000022509.1.85797 WP_000022509.1.85811 WP_000022509.1.85854 WP_000022509.1.85855 WP_000022509.1.85864 WP_000022509.1.85886 WP_000022509.1.859 WP_000022509.1.85900 WP_000022509.1.85904 WP_000022509.1.8591 WP_000022509.1.85917 WP_000022509.1.8594 WP_000022509.1.85943 WP_000022509.1.85976 WP_000022509.1.85977 WP_000022509.1.85982 WP_000022509.1.860 WP_000022509.1.86007 WP_000022509.1.86010 WP_000022509.1.86017 WP_000022509.1.86043 WP_000022509.1.8605 WP_000022509.1.86084 WP_000022509.1.86092 WP_000022509.1.8610 WP_000022509.1.86120 WP_000022509.1.86126 WP_000022509.1.86138 WP_000022509.1.8614 WP_000022509.1.86156 WP_000022509.1.86157 WP_000022509.1.8616 WP_000022509.1.86173 WP_000022509.1.86206 WP_000022509.1.86224 WP_000022509.1.86259 WP_000022509.1.86284 WP_000022509.1.86306 WP_000022509.1.86310 WP_000022509.1.86323 WP_000022509.1.86335 WP_000022509.1.86342 WP_000022509.1.86347 WP_000022509.1.86356 WP_000022509.1.86380 WP_000022509.1.86389 WP_000022509.1.8640 WP_000022509.1.8642 WP_000022509.1.86426 WP_000022509.1.86442 WP_000022509.1.86450 WP_000022509.1.86466 WP_000022509.1.86469 WP_000022509.1.8647 WP_000022509.1.86489 WP_000022509.1.86514 WP_000022509.1.86530 WP_000022509.1.86580 WP_000022509.1.86588 WP_000022509.1.86593 WP_000022509.1.86601 WP_000022509.1.86610 WP_000022509.1.86611 WP_000022509.1.86634 WP_000022509.1.86656 WP_000022509.1.86658 WP_000022509.1.86661 WP_000022509.1.86663 WP_000022509.1.86676 WP_000022509.1.86699 WP_000022509.1.8671 WP_000022509.1.8672 WP_000022509.1.86735 WP_000022509.1.86744 WP_000022509.1.86770 WP_000022509.1.8678 WP_000022509.1.86794 WP_000022509.1.86800 WP_000022509.1.86807 WP_000022509.1.86810 WP_000022509.1.86811 WP_000022509.1.86815 WP_000022509.1.8684 WP_000022509.1.86859 WP_000022509.1.86860 WP_000022509.1.86895 WP_000022509.1.86902 WP_000022509.1.86906 WP_000022509.1.8691 WP_000022509.1.86915 WP_000022509.1.86921 WP_000022509.1.86945 WP_000022509.1.86982 WP_000022509.1.86989 WP_000022509.1.87023 WP_000022509.1.87034 WP_000022509.1.87038 WP_000022509.1.87041 WP_000022509.1.87095 WP_000022509.1.87136 WP_000022509.1.87143 WP_000022509.1.87148 WP_000022509.1.87155 WP_000022509.1.87187 WP_000022509.1.87219 WP_000022509.1.8722 WP_000022509.1.87220 WP_000022509.1.87258 WP_000022509.1.87265 WP_000022509.1.87276 WP_000022509.1.87282 WP_000022509.1.87283 WP_000022509.1.87293 WP_000022509.1.87323 WP_000022509.1.87346 WP_000022509.1.8736 WP_000022509.1.87365 WP_000022509.1.87370 WP_000022509.1.87376 WP_000022509.1.87420 WP_000022509.1.87460 WP_000022509.1.87484 WP_000022509.1.87500 WP_000022509.1.87528 WP_000022509.1.87552 WP_000022509.1.87560 WP_000022509.1.87583 WP_000022509.1.87584 WP_000022509.1.8760 WP_000022509.1.87600 WP_000022509.1.87609 WP_000022509.1.87612 WP_000022509.1.87615 WP_000022509.1.87618 WP_000022509.1.87626 WP_000022509.1.87651 WP_000022509.1.87653 WP_000022509.1.87659 WP_000022509.1.8767 WP_000022509.1.87687 WP_000022509.1.87695 WP_000022509.1.87698 WP_000022509.1.87706 WP_000022509.1.87712 WP_000022509.1.87739 WP_000022509.1.87741 WP_000022509.1.87742 WP_000022509.1.87779 WP_000022509.1.87813 WP_000022509.1.87852 WP_000022509.1.87891 WP_000022509.1.87899 WP_000022509.1.87905 WP_000022509.1.8792 WP_000022509.1.87933 WP_000022509.1.87945 WP_000022509.1.87949 WP_000022509.1.87999 WP_000022509.1.8800 WP_000022509.1.88014 WP_000022509.1.88019 WP_000022509.1.88025 WP_000022509.1.88026 WP_000022509.1.8805 WP_000022509.1.88052 WP_000022509.1.8806 WP_000022509.1.88073 WP_000022509.1.8809 WP_000022509.1.88092 WP_000022509.1.881 WP_000022509.1.88136 WP_000022509.1.88145 WP_000022509.1.88165 WP_000022509.1.88174 WP_000022509.1.88185 WP_000022509.1.88199 WP_000022509.1.88214 WP_000022509.1.88222 WP_000022509.1.88244 WP_000022509.1.88264 WP_000022509.1.88275 WP_000022509.1.88291 WP_000022509.1.88293 WP_000022509.1.88299 WP_000022509.1.88313 WP_000022509.1.88356 WP_000022509.1.88359 WP_000022509.1.8837 WP_000022509.1.88393 WP_000022509.1.88407 WP_000022509.1.88414 WP_000022509.1.88423 WP_000022509.1.88444 WP_000022509.1.88446 WP_000022509.1.88458 WP_000022509.1.88474 WP_000022509.1.88483 WP_000022509.1.8849 WP_000022509.1.88501 WP_000022509.1.88508 WP_000022509.1.88538 WP_000022509.1.88547 WP_000022509.1.88597 WP_000022509.1.886 WP_000022509.1.88609 WP_000022509.1.88620 WP_000022509.1.88647 WP_000022509.1.88648 WP_000022509.1.88651 WP_000022509.1.88675 WP_000022509.1.88683 WP_000022509.1.88692 WP_000022509.1.88698 WP_000022509.1.88703 WP_000022509.1.88707 WP_000022509.1.88727 WP_000022509.1.88731 WP_000022509.1.88762 WP_000022509.1.88772 WP_000022509.1.88792 WP_000022509.1.88817 WP_000022509.1.88845 WP_000022509.1.88850 WP_000022509.1.88854 WP_000022509.1.8889 WP_000022509.1.88892 WP_000022509.1.88894 WP_000022509.1.88902 WP_000022509.1.8891 WP_000022509.1.88942 WP_000022509.1.88957 WP_000022509.1.88966 WP_000022509.1.88968 WP_000022509.1.88970 WP_000022509.1.88980 WP_000022509.1.88981 WP_000022509.1.88995 WP_000022509.1.88998 WP_000022509.1.89008 WP_000022509.1.89054 WP_000022509.1.89114 WP_000022509.1.89116 WP_000022509.1.89119 WP_000022509.1.89120 WP_000022509.1.89138 WP_000022509.1.89174 WP_000022509.1.89177 WP_000022509.1.89182 WP_000022509.1.89188 WP_000022509.1.89215 WP_000022509.1.89221 WP_000022509.1.89298 WP_000022509.1.89304 WP_000022509.1.89308 WP_000022509.1.89311 WP_000022509.1.89314 WP_000022509.1.89328 WP_000022509.1.89332 WP_000022509.1.89343 WP_000022509.1.89354 WP_000022509.1.89355 WP_000022509.1.89362 WP_000022509.1.89395 WP_000022509.1.8940 WP_000022509.1.89408 WP_000022509.1.89425 WP_000022509.1.89449 WP_000022509.1.89452 WP_000022509.1.89462 WP_000022509.1.8947 WP_000022509.1.89503 WP_000022509.1.89512 WP_000022509.1.89527 WP_000022509.1.89570 WP_000022509.1.8958 WP_000022509.1.89580 WP_000022509.1.89591 WP_000022509.1.89604 WP_000022509.1.89606 WP_000022509.1.8961 WP_000022509.1.89612 WP_000022509.1.89622 WP_000022509.1.89632 WP_000022509.1.89634 WP_000022509.1.89647 WP_000022509.1.89657 WP_000022509.1.89659 WP_000022509.1.89668 WP_000022509.1.89680 WP_000022509.1.89706 WP_000022509.1.89713 WP_000022509.1.89733 WP_000022509.1.89746 WP_000022509.1.89764 WP_000022509.1.89765 WP_000022509.1.89777 WP_000022509.1.89789 WP_000022509.1.89796 WP_000022509.1.89804 WP_000022509.1.89817 WP_000022509.1.89832 WP_000022509.1.89845 WP_000022509.1.89870 WP_000022509.1.89888 WP_000022509.1.89902 WP_000022509.1.89911 WP_000022509.1.89914 WP_000022509.1.89940 WP_000022509.1.8995 WP_000022509.1.89952 WP_000022509.1.8996 WP_000022509.1.89965 WP_000022509.1.89975 WP_000022509.1.90007 WP_000022509.1.9003 WP_000022509.1.90033 WP_000022509.1.90084 WP_000022509.1.90097 WP_000022509.1.90108 WP_000022509.1.9011 WP_000022509.1.90193 WP_000022509.1.90196 WP_000022509.1.90211 WP_000022509.1.90220 WP_000022509.1.90240 WP_000022509.1.90252 WP_000022509.1.90274 WP_000022509.1.90280 WP_000022509.1.90293 WP_000022509.1.90330 WP_000022509.1.90338 WP_000022509.1.90348 WP_000022509.1.90363 WP_000022509.1.90365 WP_000022509.1.90409 WP_000022509.1.90417 WP_000022509.1.90421 WP_000022509.1.90428 WP_000022509.1.90453 WP_000022509.1.90458 WP_000022509.1.90472 WP_000022509.1.90489 WP_000022509.1.90513 WP_000022509.1.90521 WP_000022509.1.90522 WP_000022509.1.90540 WP_000022509.1.90557 WP_000022509.1.90563 WP_000022509.1.90566 WP_000022509.1.90582 WP_000022509.1.90585 WP_000022509.1.90620 WP_000022509.1.90625 WP_000022509.1.90641 WP_000022509.1.90686 WP_000022509.1.90713 WP_000022509.1.90734 WP_000022509.1.90748 WP_000022509.1.90759 WP_000022509.1.90792 WP_000022509.1.90794 WP_000022509.1.90796 WP_000022509.1.90811 WP_000022509.1.90814 WP_000022509.1.90859 WP_000022509.1.90866 WP_000022509.1.90876 WP_000022509.1.9089 WP_000022509.1.9091 WP_000022509.1.9093 WP_000022509.1.90959 WP_000022509.1.90973 WP_000022509.1.90984 WP_000022509.1.90991 WP_000022509.1.91003 WP_000022509.1.91023 WP_000022509.1.91042 WP_000022509.1.91049 WP_000022509.1.91056 WP_000022509.1.91067 WP_000022509.1.91069 WP_000022509.1.91107 WP_000022509.1.91156 WP_000022509.1.91164 WP_000022509.1.91179 WP_000022509.1.91189 WP_000022509.1.91205 WP_000022509.1.91215 WP_000022509.1.91239 WP_000022509.1.91278 WP_000022509.1.91282 WP_000022509.1.91291 WP_000022509.1.9131 WP_000022509.1.91312 WP_000022509.1.91313 WP_000022509.1.91331 WP_000022509.1.91334 WP_000022509.1.9135 WP_000022509.1.9137 WP_000022509.1.91372 WP_000022509.1.91381 WP_000022509.1.91405 WP_000022509.1.91424 WP_000022509.1.91453 WP_000022509.1.91459 WP_000022509.1.91473 WP_000022509.1.91474 WP_000022509.1.91493 WP_000022509.1.91505 WP_000022509.1.91506 WP_000022509.1.91512 WP_000022509.1.91524 WP_000022509.1.91528 WP_000022509.1.91557 WP_000022509.1.91564 WP_000022509.1.91579 WP_000022509.1.91580 WP_000022509.1.91597 WP_000022509.1.91621 WP_000022509.1.91625 WP_000022509.1.91628 WP_000022509.1.91655 WP_000022509.1.9166 WP_000022509.1.91702 WP_000022509.1.91715 WP_000022509.1.91724 WP_000022509.1.91732 WP_000022509.1.91736 WP_000022509.1.91742 WP_000022509.1.91772 WP_000022509.1.91776 WP_000022509.1.91788 WP_000022509.1.91795 WP_000022509.1.91806 WP_000022509.1.91864 WP_000022509.1.9187 WP_000022509.1.91870 WP_000022509.1.91880 WP_000022509.1.91898 WP_000022509.1.91904 WP_000022509.1.91914 WP_000022509.1.91974 WP_000022509.1.91984 WP_000022509.1.92013 WP_000022509.1.92018 WP_000022509.1.92039 WP_000022509.1.92044 WP_000022509.1.92047 WP_000022509.1.92060 WP_000022509.1.92067 WP_000022509.1.92068 WP_000022509.1.92082 WP_000022509.1.92087 WP_000022509.1.92093 WP_000022509.1.92098 WP_000022509.1.92099 WP_000022509.1.92108 WP_000022509.1.92122 WP_000022509.1.92129 WP_000022509.1.92149 WP_000022509.1.92156 WP_000022509.1.92165 WP_000022509.1.92171 WP_000022509.1.92172 WP_000022509.1.92183 WP_000022509.1.92208 WP_000022509.1.92213 WP_000022509.1.9222 WP_000022509.1.92240 WP_000022509.1.92243 WP_000022509.1.92268 WP_000022509.1.92270 WP_000022509.1.92299 WP_000022509.1.92310 WP_000022509.1.92318 WP_000022509.1.92327 WP_000022509.1.92375 WP_000022509.1.92394 WP_000022509.1.92399 WP_000022509.1.92408 WP_000022509.1.92411 WP_000022509.1.92439 WP_000022509.1.92443 WP_000022509.1.92452 WP_000022509.1.92470 WP_000022509.1.92477 WP_000022509.1.92482 WP_000022509.1.92529 WP_000022509.1.9253 WP_000022509.1.92531 WP_000022509.1.92545 WP_000022509.1.92557 WP_000022509.1.92562 WP_000022509.1.92570 WP_000022509.1.92575 WP_000022509.1.92588 WP_000022509.1.926 WP_000022509.1.92628 WP_000022509.1.92633 WP_000022509.1.92646 WP_000022509.1.92649 WP_000022509.1.92659 WP_000022509.1.92669 WP_000022509.1.92671 WP_000022509.1.92676 WP_000022509.1.92705 WP_000022509.1.9271 WP_000022509.1.92734 WP_000022509.1.92738 WP_000022509.1.92758 WP_000022509.1.92786 WP_000022509.1.92806 WP_000022509.1.92810 WP_000022509.1.92823 WP_000022509.1.92827 WP_000022509.1.92832 WP_000022509.1.92836 WP_000022509.1.92842 WP_000022509.1.92843 WP_000022509.1.92875 WP_000022509.1.92879 WP_000022509.1.92883 WP_000022509.1.92890 WP_000022509.1.92893 WP_000022509.1.92926 WP_000022509.1.92929 WP_000022509.1.92936 WP_000022509.1.92939 WP_000022509.1.92947 WP_000022509.1.92987 WP_000022509.1.92988 WP_000022509.1.93007 WP_000022509.1.93022 WP_000022509.1.93059 WP_000022509.1.93076 WP_000022509.1.93086 WP_000022509.1.93101 WP_000022509.1.93103 WP_000022509.1.93105 WP_000022509.1.93111 WP_000022509.1.93118 WP_000022509.1.93121 WP_000022509.1.93136 WP_000022509.1.93155 WP_000022509.1.93168 WP_000022509.1.93184 WP_000022509.1.93213 WP_000022509.1.93215 WP_000022509.1.93221 WP_000022509.1.93223 WP_000022509.1.93239 WP_000022509.1.93275 WP_000022509.1.93302 WP_000022509.1.93322 WP_000022509.1.93339 WP_000022509.1.93350 WP_000022509.1.9336 WP_000022509.1.93365 WP_000022509.1.93376 WP_000022509.1.93387 WP_000022509.1.93469 WP_000022509.1.93511 WP_000022509.1.93512 WP_000022509.1.93524 WP_000022509.1.93543 WP_000022509.1.93577 WP_000022509.1.93596 WP_000022509.1.93604 WP_000022509.1.93635 WP_000022509.1.93648 WP_000022509.1.93650 WP_000022509.1.93656 WP_000022509.1.93657 WP_000022509.1.93662 WP_000022509.1.93671 WP_000022509.1.93691 WP_000022509.1.937 WP_000022509.1.93705 WP_000022509.1.9374 WP_000022509.1.9375 WP_000022509.1.93754 WP_000022509.1.93761 WP_000022509.1.93767 WP_000022509.1.93780 WP_000022509.1.9380 WP_000022509.1.93804 WP_000022509.1.93809 WP_000022509.1.93828 WP_000022509.1.93837 WP_000022509.1.93842 WP_000022509.1.93843 WP_000022509.1.93875 WP_000022509.1.9389 WP_000022509.1.93909 WP_000022509.1.93919 WP_000022509.1.93937 WP_000022509.1.93938 WP_000022509.1.93956 WP_000022509.1.93984 WP_000022509.1.93986 WP_000022509.1.9399 WP_000022509.1.93994 WP_000022509.1.94017 WP_000022509.1.94039 WP_000022509.1.94056 WP_000022509.1.94064 WP_000022509.1.94070 WP_000022509.1.94071 WP_000022509.1.94072 WP_000022509.1.94079 WP_000022509.1.94097 WP_000022509.1.94107 WP_000022509.1.94132 WP_000022509.1.94142 WP_000022509.1.94162 WP_000022509.1.94167 WP_000022509.1.94168 WP_000022509.1.94181 WP_000022509.1.94198 WP_000022509.1.94215 WP_000022509.1.94303 WP_000022509.1.9432 WP_000022509.1.94354 WP_000022509.1.94365 WP_000022509.1.94379 WP_000022509.1.94380 WP_000022509.1.94383 WP_000022509.1.94390 WP_000022509.1.9440 WP_000022509.1.94415 WP_000022509.1.94458 WP_000022509.1.94473 WP_000022509.1.94492 WP_000022509.1.94510 WP_000022509.1.94527 WP_000022509.1.94557 WP_000022509.1.94562 WP_000022509.1.94565 WP_000022509.1.94573 WP_000022509.1.94579 WP_000022509.1.94584 WP_000022509.1.94586 WP_000022509.1.94588 WP_000022509.1.94593 WP_000022509.1.94598 WP_000022509.1.94622 WP_000022509.1.9463 WP_000022509.1.94649 WP_000022509.1.94650 WP_000022509.1.94655 WP_000022509.1.94659 WP_000022509.1.94662 WP_000022509.1.94669 WP_000022509.1.94670 WP_000022509.1.94674 WP_000022509.1.94700 WP_000022509.1.94717 WP_000022509.1.94722 WP_000022509.1.94745 WP_000022509.1.94782 WP_000022509.1.94785 WP_000022509.1.94796 WP_000022509.1.94798 WP_000022509.1.9481 WP_000022509.1.94815 WP_000022509.1.94820 WP_000022509.1.94835 WP_000022509.1.94849 WP_000022509.1.94850 WP_000022509.1.94851 WP_000022509.1.94862 WP_000022509.1.94864 WP_000022509.1.94947 WP_000022509.1.94952 WP_000022509.1.94959 WP_000022509.1.94971 WP_000022509.1.94982 WP_000022509.1.94986 WP_000022509.1.95006 WP_000022509.1.9503 WP_000022509.1.95051 WP_000022509.1.95055 WP_000022509.1.95076 WP_000022509.1.95085 WP_000022509.1.95094 WP_000022509.1.95099 WP_000022509.1.95121 WP_000022509.1.95133 WP_000022509.1.95136 WP_000022509.1.95152 WP_000022509.1.9516 WP_000022509.1.95165 WP_000022509.1.95171 WP_000022509.1.95235 WP_000022509.1.95239 WP_000022509.1.95246 WP_000022509.1.95248 WP_000022509.1.9525 WP_000022509.1.95255 WP_000022509.1.95265 WP_000022509.1.9527 WP_000022509.1.95277 WP_000022509.1.95282 WP_000022509.1.95289 WP_000022509.1.95298 WP_000022509.1.9530 WP_000022509.1.95320 WP_000022509.1.95338 WP_000022509.1.95388 WP_000022509.1.95404 WP_000022509.1.95412 WP_000022509.1.95434 WP_000022509.1.95447 WP_000022509.1.95456 WP_000022509.1.95465 WP_000022509.1.95546 WP_000022509.1.95547 WP_000022509.1.95579 WP_000022509.1.95590 WP_000022509.1.95607 WP_000022509.1.95623 WP_000022509.1.95625 WP_000022509.1.95630 WP_000022509.1.95641 WP_000022509.1.95656 WP_000022509.1.95670 WP_000022509.1.95675 WP_000022509.1.95691 WP_000022509.1.95701 WP_000022509.1.95703 WP_000022509.1.95716 WP_000022509.1.95729 WP_000022509.1.9574 WP_000022509.1.95757 WP_000022509.1.95776 WP_000022509.1.95803 WP_000022509.1.95805 WP_000022509.1.95826 WP_000022509.1.95840 WP_000022509.1.9586 WP_000022509.1.95866 WP_000022509.1.95884 WP_000022509.1.95890 WP_000022509.1.95901 WP_000022509.1.95906 WP_000022509.1.95911 WP_000022509.1.95939 WP_000022509.1.95940 WP_000022509.1.95963 WP_000022509.1.96004 WP_000022509.1.96025 WP_000022509.1.96042 WP_000022509.1.96044 WP_000022509.1.96045 WP_000022509.1.96054 WP_000022509.1.9609 WP_000022509.1.96094 WP_000022509.1.96107 WP_000022509.1.96127 WP_000022509.1.96139 WP_000022509.1.96141 WP_000022509.1.96144 WP_000022509.1.96162 WP_000022509.1.96172 WP_000022509.1.96188 WP_000022509.1.96190 WP_000022509.1.96203 WP_000022509.1.96211 WP_000022509.1.96212 WP_000022509.1.9624 WP_000022509.1.96260 WP_000022509.1.9627 WP_000022509.1.96317 WP_000022509.1.96319 WP_000022509.1.9633 WP_000022509.1.96340 WP_000022509.1.96343 WP_000022509.1.96348 WP_000022509.1.96349 WP_000022509.1.96359 WP_000022509.1.96380 WP_000022509.1.96404 WP_000022509.1.96429 WP_000022509.1.9644 WP_000022509.1.96469 WP_000022509.1.96497 WP_000022509.1.96500 WP_000022509.1.96521 WP_000022509.1.96533 WP_000022509.1.96537 WP_000022509.1.96539 WP_000022509.1.96552 WP_000022509.1.96555 WP_000022509.1.96563 WP_000022509.1.96588 WP_000022509.1.96590 WP_000022509.1.96600 WP_000022509.1.96610 WP_000022509.1.96625 WP_000022509.1.96635 WP_000022509.1.9664 WP_000022509.1.96640 WP_000022509.1.96642 WP_000022509.1.96662 WP_000022509.1.96675 WP_000022509.1.9670 WP_000022509.1.96731 WP_000022509.1.96732 WP_000022509.1.96735 WP_000022509.1.9674 WP_000022509.1.96750 WP_000022509.1.96758 WP_000022509.1.96761 WP_000022509.1.96771 WP_000022509.1.96792 WP_000022509.1.96798 WP_000022509.1.96801 WP_000022509.1.96803 WP_000022509.1.96810 WP_000022509.1.9686 WP_000022509.1.96876 WP_000022509.1.96890 WP_000022509.1.96917 WP_000022509.1.96925 WP_000022509.1.96938 WP_000022509.1.96946 WP_000022509.1.96957 WP_000022509.1.96978 WP_000022509.1.96993 WP_000022509.1.97005 WP_000022509.1.97015 WP_000022509.1.97026 WP_000022509.1.97028 WP_000022509.1.97043 WP_000022509.1.97047 WP_000022509.1.97079 WP_000022509.1.97089 WP_000022509.1.97103 WP_000022509.1.97109 WP_000022509.1.97143 WP_000022509.1.97145 WP_000022509.1.97154 WP_000022509.1.97184 WP_000022509.1.97185 WP_000022509.1.97190 WP_000022509.1.97224 WP_000022509.1.97260 WP_000022509.1.97287 WP_000022509.1.97291 WP_000022509.1.97297 WP_000022509.1.97318 WP_000022509.1.97322 WP_000022509.1.97328 WP_000022509.1.97337 WP_000022509.1.97368 WP_000022509.1.97386 WP_000022509.1.97413 WP_000022509.1.97422 WP_000022509.1.97441 WP_000022509.1.97477 WP_000022509.1.97480 WP_000022509.1.97487 WP_000022509.1.97496 WP_000022509.1.97497 WP_000022509.1.97505 WP_000022509.1.97534 WP_000022509.1.97547 WP_000022509.1.97594 WP_000022509.1.97597 WP_000022509.1.97599 WP_000022509.1.97606 WP_000022509.1.97613 WP_000022509.1.97615 WP_000022509.1.97620 WP_000022509.1.97626 WP_000022509.1.97628 WP_000022509.1.97631 WP_000022509.1.97640 WP_000022509.1.97646 WP_000022509.1.97648 WP_000022509.1.97656 WP_000022509.1.97690 WP_000022509.1.97691 WP_000022509.1.97693 WP_000022509.1.97704 WP_000022509.1.97725 WP_000022509.1.97726 WP_000022509.1.97727 WP_000022509.1.97732 WP_000022509.1.97736 WP_000022509.1.9774 WP_000022509.1.9775 WP_000022509.1.97768 WP_000022509.1.97772 WP_000022509.1.97819 WP_000022509.1.97840 WP_000022509.1.97846 WP_000022509.1.97873 WP_000022509.1.9793 WP_000022509.1.97938 WP_000022509.1.97981 WP_000022509.1.97983 WP_000022509.1.97986 WP_000022509.1.9799 WP_000022509.1.97991 WP_000022509.1.98006 WP_000022509.1.98019 WP_000022509.1.98022 WP_000022509.1.98036 WP_000022509.1.9805 WP_000022509.1.98080 WP_000022509.1.98086 WP_000022509.1.98107 WP_000022509.1.9811 WP_000022509.1.98110 WP_000022509.1.98119 WP_000022509.1.98124 WP_000022509.1.98146 WP_000022509.1.98158 WP_000022509.1.98170 WP_000022509.1.98201 WP_000022509.1.98219 WP_000022509.1.98236 WP_000022509.1.98250 WP_000022509.1.9826 WP_000022509.1.98263 WP_000022509.1.98338 WP_000022509.1.98392 WP_000022509.1.98403 WP_000022509.1.9841 WP_000022509.1.98418 WP_000022509.1.98438 WP_000022509.1.98440 WP_000022509.1.98448 WP_000022509.1.98457 WP_000022509.1.98472 WP_000022509.1.98483 WP_000022509.1.98495 WP_000022509.1.9850 WP_000022509.1.98502 WP_000022509.1.98513 WP_000022509.1.98531 WP_000022509.1.98551 WP_000022509.1.98570 WP_000022509.1.98577 WP_000022509.1.98607 WP_000022509.1.98608 WP_000022509.1.98627 WP_000022509.1.9863 WP_000022509.1.98634 WP_000022509.1.98676 WP_000022509.1.98677 WP_000022509.1.98726 WP_000022509.1.98731 WP_000022509.1.98751 WP_000022509.1.98760 WP_000022509.1.98762 WP_000022509.1.98763 WP_000022509.1.9877 WP_000022509.1.98779 WP_000022509.1.98801 WP_000022509.1.98818 WP_000022509.1.98843 WP_000022509.1.9887 WP_000022509.1.98931 WP_000022509.1.98947 WP_000022509.1.9898 WP_000022509.1.9899 WP_000022509.1.99057 WP_000022509.1.99058 WP_000022509.1.99071 WP_000022509.1.99072 WP_000022509.1.99073 WP_000022509.1.99083 WP_000022509.1.99097 WP_000022509.1.99098 WP_000022509.1.99107 WP_000022509.1.99163 WP_000022509.1.99164 WP_000022509.1.99184 WP_000022509.1.9919 WP_000022509.1.99197 WP_000022509.1.99198 WP_000022509.1.99215 WP_000022509.1.99219 WP_000022509.1.99255 WP_000022509.1.99267 WP_000022509.1.99276 WP_000022509.1.99278 WP_000022509.1.99327 WP_000022509.1.99335 WP_000022509.1.99339 WP_000022509.1.99350 WP_000022509.1.99360 WP_000022509.1.99363 WP_000022509.1.99369 WP_000022509.1.99370 WP_000022509.1.99388 WP_000022509.1.99397 WP_000022509.1.99456 WP_000022509.1.99463 WP_000022509.1.99469 WP_000022509.1.99483 WP_000022509.1.99490 WP_000022509.1.99493 WP_000022509.1.99531 WP_000022509.1.9954 WP_000022509.1.99546 WP_000022509.1.99561 WP_000022509.1.99579 WP_000022509.1.99595 WP_000022509.1.99613 WP_000022509.1.99626 WP_000022509.1.99630 WP_000022509.1.99637 WP_000022509.1.99646 WP_000022509.1.99657 WP_000022509.1.99660 WP_000022509.1.99676 WP_000022509.1.99712 WP_000022509.1.99725 WP_000022509.1.99747 WP_000022509.1.99764 WP_000022509.1.99783 WP_000022509.1.99813 WP_000022509.1.99829 WP_000022509.1.99837 WP_000022509.1.99841 WP_000022509.1.99858 WP_000022509.1.99889 WP_000022509.1.9992 WP_000022509.1.99924 WP_000022509.1.99958 WP_000022509.1.99961 WP_000022509.1.99996 ABAK02000001|CDS_1373838-1373317 ABAM02000001|CDS_2453676-2453155 ABAO01000035|CDS_9484-8963 ABEH02000011|CDS_58967-58446 ABEI01000024|CDS_41486-42007 ABEJ01000019|CDS_57500-56979 ABEL01000002|CDS_579646-579125 ABEW01000001|CDS_89787-90308 ABFF01000008|CDS_177926-177405 AE006468|CDS_1993749-1993228 AE014613|CDS_1067773-1068294 AL513382|CDS_1958708-1958187 AM933172|CDS_1201315-1201836 AM933173|CDS_1237799-1238320 CP000026|CDS_1044036-1044557 CP001113|CDS_1998691-1998170 CP001120|CDS_2042089-2041568 CP001127|CDS_1971629-1971108 CP001138|CDS_1210852-1211373 CP001363|CDS_2005153-2004632 FM200053|CDS_1038046-1038567 FN424405|CDS_1977259-1976738 NZ_ACBF01000010|CDS_40246-40767 gi|16760848|ref|NP_456465.1| 209261.t0979 220341.STY2106 295319.SPA0971 423368.SNSL254_A2057 439843.SeSA_A2052 454166.SeAg_B1225 454169.SeHA_C2112 550537.SEN1105 550538.SG1154 554290.SSPA0905 99287.STM1898 gi|56413183|ref|YP_150258.1| gi|29141460|ref|NP_804802.1| gi|482903719|ref|YP_007902279.1| gi|525857925|ref|YP_008261098.1| gi|194448512|ref|YP_002045951.1| gi|378959136|ref|YP_005216622.1| gi|525829989|ref|YP_008253197.1| gi|550901297|ref|YP_008670389.1| gi|549724523|ref|YP_008644713.1| gi|205352396|ref|YP_002226197.1| gi|16765240|ref|NP_460855.1| gi|378445289|ref|YP_005232921.1| gi|383496577|ref|YP_005397266.1| gi|488653515|ref|YP_007925318.1| gi|194736889|ref|YP_002114933.1| 2036002670 gi|197249729|ref|YP_002146124.1| gi|525837979|ref|YP_008254895.1| gi|549479628|ref|YP_008613681.1| gi|378989244|ref|YP_005252408.1| gi|378699770|ref|YP_005181727.1| gi|409249656|ref|YP_006885478.1| gi|194444872|ref|YP_002041163.1| gi|526220476|ref|YP_008266106.1| gi|386591735|ref|YP_006088135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]