SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450623|ref|YP_005237982.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450623|ref|YP_005237982.1|
Domain Number 1 Region: 175-338
Classification Level Classification E-value
Superfamily Phage tail proteins 5.1e-55
Family Baseplate protein-like 0.00018
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Phage tail proteins 6.8e-51
Family Baseplate protein-like 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378450623|ref|YP_005237982.1|
Sequence length 352
Comment tail protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNNTVFLRVNGRDWGGWTSVRISAGIDRIARDFNVSITRQWPGGEDVPPVKNGDSVEVLI
GDDLVITGWVEALPLRYDAQTIMTGIVGRSKTADLIDCSASPAQHNGENLFLIASALARP
FGVDVVDAGAPAAAVIEAQPEHGETVVDCLNRLLGQAQALAYDDERGRLVLGRPGSMKAA
TALVLGENILSCDTERSVRERFSSYLVTGQRPGTDDDFGEATIAAIRQSTGDAGVTRYRP
HTIQQSGTATTDSCKSRCEFEARQRAAKTLETTYTVQGWRQGNGELWKPNQAVVVYDPLN
GFDNETLVIAEVTYSQDNNGTLTEIRVGPADAYLPEPFRPKAKKKVSEEADF
Download sequence
Identical sequences A0A0F6B2Z7 A0A0H3NI45 A0A0W4IQK3 A0A2H9YA17 E8XB28 Q8HAC0
CP001363|CDS_2101422-2100364 FN424405|CDS_2073525-2072467 gi|549724627|ref|YP_008644817.1| Q8HAC0_9CAUD gi|379701186|ref|YP_005242914.1| gi|23505462|ref|NP_700391.1| NP_700391.1.3381 WP_001066636.1.100484 WP_001066636.1.100488 WP_001066636.1.100871 WP_001066636.1.11098 WP_001066636.1.12370 WP_001066636.1.13106 WP_001066636.1.1387 WP_001066636.1.14239 WP_001066636.1.14379 WP_001066636.1.14466 WP_001066636.1.1489 WP_001066636.1.15124 WP_001066636.1.17307 WP_001066636.1.17480 WP_001066636.1.17705 WP_001066636.1.18776 WP_001066636.1.19320 WP_001066636.1.19749 WP_001066636.1.19802 WP_001066636.1.20 WP_001066636.1.20908 WP_001066636.1.21603 WP_001066636.1.23482 WP_001066636.1.24779 WP_001066636.1.25988 WP_001066636.1.26551 WP_001066636.1.27010 WP_001066636.1.27173 WP_001066636.1.2763 WP_001066636.1.28170 WP_001066636.1.29619 WP_001066636.1.30972 WP_001066636.1.31195 WP_001066636.1.31515 WP_001066636.1.32438 WP_001066636.1.33553 WP_001066636.1.34319 WP_001066636.1.34610 WP_001066636.1.34856 WP_001066636.1.35446 WP_001066636.1.35463 WP_001066636.1.35503 WP_001066636.1.37073 WP_001066636.1.37978 WP_001066636.1.38913 WP_001066636.1.39576 WP_001066636.1.39921 WP_001066636.1.39923 WP_001066636.1.4011 WP_001066636.1.40240 WP_001066636.1.40380 WP_001066636.1.41572 WP_001066636.1.41591 WP_001066636.1.42248 WP_001066636.1.42864 WP_001066636.1.42923 WP_001066636.1.43312 WP_001066636.1.43334 WP_001066636.1.44099 WP_001066636.1.44640 WP_001066636.1.4467 WP_001066636.1.45067 WP_001066636.1.45184 WP_001066636.1.46112 WP_001066636.1.46303 WP_001066636.1.47472 WP_001066636.1.47478 WP_001066636.1.4885 WP_001066636.1.49515 WP_001066636.1.50003 WP_001066636.1.50080 WP_001066636.1.51285 WP_001066636.1.51514 WP_001066636.1.52346 WP_001066636.1.52528 WP_001066636.1.52656 WP_001066636.1.53406 WP_001066636.1.53534 WP_001066636.1.54033 WP_001066636.1.54075 WP_001066636.1.55768 WP_001066636.1.56012 WP_001066636.1.56601 WP_001066636.1.57607 WP_001066636.1.57891 WP_001066636.1.58442 WP_001066636.1.58745 WP_001066636.1.5886 WP_001066636.1.59490 WP_001066636.1.60015 WP_001066636.1.61296 WP_001066636.1.61345 WP_001066636.1.61574 WP_001066636.1.61918 WP_001066636.1.62910 WP_001066636.1.63181 WP_001066636.1.63757 WP_001066636.1.63831 WP_001066636.1.6437 WP_001066636.1.66358 WP_001066636.1.67347 WP_001066636.1.67465 WP_001066636.1.67829 WP_001066636.1.68073 WP_001066636.1.70683 WP_001066636.1.71248 WP_001066636.1.71337 WP_001066636.1.71378 WP_001066636.1.71702 WP_001066636.1.71845 WP_001066636.1.72827 WP_001066636.1.7315 WP_001066636.1.7334 WP_001066636.1.73377 WP_001066636.1.73924 WP_001066636.1.74029 WP_001066636.1.7433 WP_001066636.1.74992 WP_001066636.1.75129 WP_001066636.1.75362 WP_001066636.1.77529 WP_001066636.1.77898 WP_001066636.1.77960 WP_001066636.1.78245 WP_001066636.1.79167 WP_001066636.1.79490 WP_001066636.1.79570 WP_001066636.1.79659 WP_001066636.1.80137 WP_001066636.1.81193 WP_001066636.1.81902 WP_001066636.1.82676 WP_001066636.1.82761 WP_001066636.1.83305 WP_001066636.1.8354 WP_001066636.1.84683 WP_001066636.1.85134 WP_001066636.1.85180 WP_001066636.1.85976 WP_001066636.1.87095 WP_001066636.1.87552 WP_001066636.1.87945 WP_001066636.1.88073 WP_001066636.1.89008 WP_001066636.1.89304 WP_001066636.1.89570 WP_001066636.1.90453 WP_001066636.1.90984 WP_001066636.1.91564 WP_001066636.1.91655 WP_001066636.1.92183 WP_001066636.1.92443 WP_001066636.1.92531 WP_001066636.1.93136 WP_001066636.1.93994 WP_001066636.1.94458 WP_001066636.1.94584 WP_001066636.1.95051 WP_001066636.1.95630 WP_001066636.1.96500 WP_001066636.1.97043 WP_001066636.1.97109 WP_001066636.1.97145 WP_001066636.1.98551 WP_001066636.1.98676 WP_001066636.1.98947 WP_001066636.1.9898 WP_001066636.1.99267 WP_001066636.1.99712 gi|378450623|ref|YP_005237982.1| gi|383496679|ref|YP_005397368.1| gi|378699874|ref|YP_005181831.1| gi|378445396|ref|YP_005233028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]