SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450669|ref|YP_005238028.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450669|ref|YP_005238028.1|
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.35e-21
Family DnaQ-like 3'-5' exonuclease 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378450669|ref|YP_005238028.1|
Sequence length 189
Comment endodeoxyribonuclease [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNNLMIDLETMGKKPNAPVVSIGAVFFDPQSGEIGPEFYTAVSLESAMEQGAVPDGDTIL
WWLRQSPEARAAICADAVSVTTALIEFNDFITCHADDLKYLKVWGNGANFDNVILRGAFE
RASLPCLWNYRNDHDVRTMVTLGRAIGFDPKRDMPFEGDMHNALADARHQAKYVSAIWQK
LIPPTSNNI
Download sequence
Identical sequences A0A0D6FKE7 A0A0F6B343 A0A0F7JAT1 A0A0H3NEG6 A0A0U1FRU7 A0A0W4VGE5 A0A192Y6E0 A0A2D3AD98 A0A2H9YHV5 A0A2I6M6U1 Q8HAA8
gi|378989390|ref|YP_005252554.1| Q8HAA8_9CAUD gi|378450669|ref|YP_005238028.1| ABAO01000070|CDS_5836-6405 CP001363|CDS_2131783-2132352 FN424405|CDS_2103887-2104456 gi|378445437|ref|YP_005233069.1| gi|23505474|ref|NP_700403.1| NP_700403.1.3381 WP_001061334.1.100010 WP_001061334.1.100234 WP_001061334.1.100424 WP_001061334.1.100484 WP_001061334.1.100488 WP_001061334.1.100597 WP_001061334.1.100793 WP_001061334.1.100871 WP_001061334.1.101007 WP_001061334.1.101020 WP_001061334.1.101074 WP_001061334.1.101123 WP_001061334.1.101180 WP_001061334.1.101259 WP_001061334.1.101284 WP_001061334.1.101291 WP_001061334.1.101353 WP_001061334.1.101386 WP_001061334.1.101404 WP_001061334.1.101589 WP_001061334.1.101734 WP_001061334.1.101878 WP_001061334.1.101953 WP_001061334.1.10220 WP_001061334.1.10429 WP_001061334.1.10439 WP_001061334.1.10678 WP_001061334.1.10753 WP_001061334.1.11024 WP_001061334.1.11031 WP_001061334.1.11098 WP_001061334.1.11190 WP_001061334.1.11455 WP_001061334.1.11458 WP_001061334.1.11532 WP_001061334.1.11763 WP_001061334.1.12114 WP_001061334.1.12351 WP_001061334.1.12370 WP_001061334.1.12546 WP_001061334.1.12879 WP_001061334.1.12936 WP_001061334.1.12995 WP_001061334.1.13027 WP_001061334.1.13106 WP_001061334.1.13669 WP_001061334.1.13741 WP_001061334.1.13799 WP_001061334.1.1387 WP_001061334.1.13908 WP_001061334.1.13932 WP_001061334.1.13968 WP_001061334.1.14001 WP_001061334.1.14151 WP_001061334.1.14239 WP_001061334.1.14320 WP_001061334.1.14379 WP_001061334.1.14406 WP_001061334.1.14410 WP_001061334.1.14466 WP_001061334.1.14524 WP_001061334.1.14554 WP_001061334.1.14725 WP_001061334.1.1489 WP_001061334.1.14932 WP_001061334.1.14936 WP_001061334.1.15055 WP_001061334.1.15124 WP_001061334.1.15223 WP_001061334.1.15226 WP_001061334.1.15316 WP_001061334.1.15369 WP_001061334.1.1540 WP_001061334.1.15830 WP_001061334.1.16063 WP_001061334.1.16233 WP_001061334.1.16284 WP_001061334.1.16468 WP_001061334.1.16614 WP_001061334.1.16650 WP_001061334.1.16732 WP_001061334.1.16735 WP_001061334.1.16858 WP_001061334.1.16965 WP_001061334.1.17096 WP_001061334.1.17098 WP_001061334.1.17307 WP_001061334.1.174 WP_001061334.1.17480 WP_001061334.1.17546 WP_001061334.1.17702 WP_001061334.1.17705 WP_001061334.1.18019 WP_001061334.1.18163 WP_001061334.1.18265 WP_001061334.1.18468 WP_001061334.1.18607 WP_001061334.1.18715 WP_001061334.1.18776 WP_001061334.1.18822 WP_001061334.1.18940 WP_001061334.1.19320 WP_001061334.1.19458 WP_001061334.1.19460 WP_001061334.1.19461 WP_001061334.1.19614 WP_001061334.1.19706 WP_001061334.1.19724 WP_001061334.1.19749 WP_001061334.1.19784 WP_001061334.1.19802 WP_001061334.1.19867 WP_001061334.1.1998 WP_001061334.1.20 WP_001061334.1.2010 WP_001061334.1.20266 WP_001061334.1.20271 WP_001061334.1.20418 WP_001061334.1.20443 WP_001061334.1.20525 WP_001061334.1.2054 WP_001061334.1.20553 WP_001061334.1.20626 WP_001061334.1.20646 WP_001061334.1.20886 WP_001061334.1.20908 WP_001061334.1.21146 WP_001061334.1.21245 WP_001061334.1.21269 WP_001061334.1.21400 WP_001061334.1.21497 WP_001061334.1.21499 WP_001061334.1.21603 WP_001061334.1.22024 WP_001061334.1.22062 WP_001061334.1.22067 WP_001061334.1.22069 WP_001061334.1.2221 WP_001061334.1.22379 WP_001061334.1.22427 WP_001061334.1.2246 WP_001061334.1.22485 WP_001061334.1.22870 WP_001061334.1.23114 WP_001061334.1.2314 WP_001061334.1.23192 WP_001061334.1.23259 WP_001061334.1.23460 WP_001061334.1.23482 WP_001061334.1.23634 WP_001061334.1.2364 WP_001061334.1.24308 WP_001061334.1.24419 WP_001061334.1.24476 WP_001061334.1.24578 WP_001061334.1.24737 WP_001061334.1.24779 WP_001061334.1.25008 WP_001061334.1.25015 WP_001061334.1.25405 WP_001061334.1.25493 WP_001061334.1.25668 WP_001061334.1.25690 WP_001061334.1.25692 WP_001061334.1.2570 WP_001061334.1.25793 WP_001061334.1.25814 WP_001061334.1.25988 WP_001061334.1.26282 WP_001061334.1.26311 WP_001061334.1.26319 WP_001061334.1.26429 WP_001061334.1.26493 WP_001061334.1.26551 WP_001061334.1.26567 WP_001061334.1.27010 WP_001061334.1.27173 WP_001061334.1.27423 WP_001061334.1.27561 WP_001061334.1.2763 WP_001061334.1.27665 WP_001061334.1.27707 WP_001061334.1.27761 WP_001061334.1.28094 WP_001061334.1.28170 WP_001061334.1.28302 WP_001061334.1.2835 WP_001061334.1.28538 WP_001061334.1.28575 WP_001061334.1.28655 WP_001061334.1.28694 WP_001061334.1.2879 WP_001061334.1.2890 WP_001061334.1.28946 WP_001061334.1.2910 WP_001061334.1.29601 WP_001061334.1.29606 WP_001061334.1.29615 WP_001061334.1.29619 WP_001061334.1.29969 WP_001061334.1.30006 WP_001061334.1.30027 WP_001061334.1.30180 WP_001061334.1.30505 WP_001061334.1.30507 WP_001061334.1.30547 WP_001061334.1.30794 WP_001061334.1.30835 WP_001061334.1.30972 WP_001061334.1.31 WP_001061334.1.3113 WP_001061334.1.31190 WP_001061334.1.31195 WP_001061334.1.31196 WP_001061334.1.31281 WP_001061334.1.31504 WP_001061334.1.31515 WP_001061334.1.31658 WP_001061334.1.31940 WP_001061334.1.31967 WP_001061334.1.32192 WP_001061334.1.32206 WP_001061334.1.32438 WP_001061334.1.32702 WP_001061334.1.32714 WP_001061334.1.32786 WP_001061334.1.33030 WP_001061334.1.33127 WP_001061334.1.33143 WP_001061334.1.333 WP_001061334.1.33492 WP_001061334.1.33553 WP_001061334.1.33592 WP_001061334.1.33894 WP_001061334.1.34 WP_001061334.1.34043 WP_001061334.1.34075 WP_001061334.1.34257 WP_001061334.1.34279 WP_001061334.1.34319 WP_001061334.1.34610 WP_001061334.1.34856 WP_001061334.1.35045 WP_001061334.1.35129 WP_001061334.1.35184 WP_001061334.1.35404 WP_001061334.1.35408 WP_001061334.1.35446 WP_001061334.1.35463 WP_001061334.1.35503 WP_001061334.1.35509 WP_001061334.1.35590 WP_001061334.1.35940 WP_001061334.1.36003 WP_001061334.1.3601 WP_001061334.1.36609 WP_001061334.1.36690 WP_001061334.1.3670 WP_001061334.1.36705 WP_001061334.1.36918 WP_001061334.1.36931 WP_001061334.1.37073 WP_001061334.1.37256 WP_001061334.1.37293 WP_001061334.1.37370 WP_001061334.1.37376 WP_001061334.1.3744 WP_001061334.1.37498 WP_001061334.1.37504 WP_001061334.1.37618 WP_001061334.1.37968 WP_001061334.1.37978 WP_001061334.1.38125 WP_001061334.1.38145 WP_001061334.1.38393 WP_001061334.1.3848 WP_001061334.1.38613 WP_001061334.1.38673 WP_001061334.1.38693 WP_001061334.1.38913 WP_001061334.1.38942 WP_001061334.1.39082 WP_001061334.1.39136 WP_001061334.1.39197 WP_001061334.1.39229 WP_001061334.1.39385 WP_001061334.1.39405 WP_001061334.1.39512 WP_001061334.1.39576 WP_001061334.1.39629 WP_001061334.1.39763 WP_001061334.1.39862 WP_001061334.1.39921 WP_001061334.1.39923 WP_001061334.1.40017 WP_001061334.1.40072 WP_001061334.1.40073 WP_001061334.1.4011 WP_001061334.1.40208 WP_001061334.1.40240 WP_001061334.1.40257 WP_001061334.1.40305 WP_001061334.1.40311 WP_001061334.1.40380 WP_001061334.1.40395 WP_001061334.1.40710 WP_001061334.1.4087 WP_001061334.1.40877 WP_001061334.1.41017 WP_001061334.1.41086 WP_001061334.1.41091 WP_001061334.1.41279 WP_001061334.1.41516 WP_001061334.1.41572 WP_001061334.1.41591 WP_001061334.1.41761 WP_001061334.1.41882 WP_001061334.1.42248 WP_001061334.1.42320 WP_001061334.1.42422 WP_001061334.1.42864 WP_001061334.1.42923 WP_001061334.1.43018 WP_001061334.1.43041 WP_001061334.1.43244 WP_001061334.1.43312 WP_001061334.1.43334 WP_001061334.1.43437 WP_001061334.1.43522 WP_001061334.1.43668 WP_001061334.1.43886 WP_001061334.1.44005 WP_001061334.1.44043 WP_001061334.1.44099 WP_001061334.1.44121 WP_001061334.1.44291 WP_001061334.1.44310 WP_001061334.1.44479 WP_001061334.1.44633 WP_001061334.1.44640 WP_001061334.1.4467 WP_001061334.1.4485 WP_001061334.1.44877 WP_001061334.1.44927 WP_001061334.1.45067 WP_001061334.1.45074 WP_001061334.1.45079 WP_001061334.1.45154 WP_001061334.1.45177 WP_001061334.1.45184 WP_001061334.1.45251 WP_001061334.1.45259 WP_001061334.1.45349 WP_001061334.1.45365 WP_001061334.1.45585 WP_001061334.1.45660 WP_001061334.1.45690 WP_001061334.1.46011 WP_001061334.1.46069 WP_001061334.1.46112 WP_001061334.1.46173 WP_001061334.1.46174 WP_001061334.1.46303 WP_001061334.1.46444 WP_001061334.1.46595 WP_001061334.1.46730 WP_001061334.1.47057 WP_001061334.1.47214 WP_001061334.1.4747 WP_001061334.1.47472 WP_001061334.1.47478 WP_001061334.1.47621 WP_001061334.1.47799 WP_001061334.1.48342 WP_001061334.1.48367 WP_001061334.1.48377 WP_001061334.1.4853 WP_001061334.1.48788 WP_001061334.1.4885 WP_001061334.1.48876 WP_001061334.1.48894 WP_001061334.1.48919 WP_001061334.1.49084 WP_001061334.1.49162 WP_001061334.1.49239 WP_001061334.1.49256 WP_001061334.1.49290 WP_001061334.1.49340 WP_001061334.1.49366 WP_001061334.1.49490 WP_001061334.1.49515 WP_001061334.1.49550 WP_001061334.1.49572 WP_001061334.1.4979 WP_001061334.1.49803 WP_001061334.1.49929 WP_001061334.1.50003 WP_001061334.1.50080 WP_001061334.1.50161 WP_001061334.1.50211 WP_001061334.1.50376 WP_001061334.1.50389 WP_001061334.1.50676 WP_001061334.1.50804 WP_001061334.1.50808 WP_001061334.1.5088 WP_001061334.1.50941 WP_001061334.1.51186 WP_001061334.1.51285 WP_001061334.1.51487 WP_001061334.1.51488 WP_001061334.1.51514 WP_001061334.1.51634 WP_001061334.1.51649 WP_001061334.1.51686 WP_001061334.1.51911 WP_001061334.1.51932 WP_001061334.1.51989 WP_001061334.1.52121 WP_001061334.1.52346 WP_001061334.1.52353 WP_001061334.1.52361 WP_001061334.1.52528 WP_001061334.1.52653 WP_001061334.1.52656 WP_001061334.1.52743 WP_001061334.1.52857 WP_001061334.1.53190 WP_001061334.1.53198 WP_001061334.1.53406 WP_001061334.1.53466 WP_001061334.1.53534 WP_001061334.1.53543 WP_001061334.1.53757 WP_001061334.1.53812 WP_001061334.1.54033 WP_001061334.1.54075 WP_001061334.1.54274 WP_001061334.1.54319 WP_001061334.1.54364 WP_001061334.1.54400 WP_001061334.1.54662 WP_001061334.1.54722 WP_001061334.1.54764 WP_001061334.1.55008 WP_001061334.1.55152 WP_001061334.1.55156 WP_001061334.1.55285 WP_001061334.1.55475 WP_001061334.1.55545 WP_001061334.1.55647 WP_001061334.1.55743 WP_001061334.1.55768 WP_001061334.1.55796 WP_001061334.1.56002 WP_001061334.1.56012 WP_001061334.1.56286 WP_001061334.1.56304 WP_001061334.1.56438 WP_001061334.1.56560 WP_001061334.1.56601 WP_001061334.1.56614 WP_001061334.1.56671 WP_001061334.1.56877 WP_001061334.1.57168 WP_001061334.1.57187 WP_001061334.1.57377 WP_001061334.1.57418 WP_001061334.1.57510 WP_001061334.1.57529 WP_001061334.1.57576 WP_001061334.1.57601 WP_001061334.1.57607 WP_001061334.1.57891 WP_001061334.1.57978 WP_001061334.1.58041 WP_001061334.1.5858 WP_001061334.1.58662 WP_001061334.1.58669 WP_001061334.1.58745 WP_001061334.1.58803 WP_001061334.1.5886 WP_001061334.1.59094 WP_001061334.1.59321 WP_001061334.1.59375 WP_001061334.1.59490 WP_001061334.1.59684 WP_001061334.1.59694 WP_001061334.1.59771 WP_001061334.1.60008 WP_001061334.1.60015 WP_001061334.1.60379 WP_001061334.1.60464 WP_001061334.1.61078 WP_001061334.1.6129 WP_001061334.1.61296 WP_001061334.1.61345 WP_001061334.1.61417 WP_001061334.1.61574 WP_001061334.1.61712 WP_001061334.1.61730 WP_001061334.1.61857 WP_001061334.1.61918 WP_001061334.1.62007 WP_001061334.1.62025 WP_001061334.1.62108 WP_001061334.1.62204 WP_001061334.1.62304 WP_001061334.1.62364 WP_001061334.1.62374 WP_001061334.1.62403 WP_001061334.1.6253 WP_001061334.1.62853 WP_001061334.1.62903 WP_001061334.1.62910 WP_001061334.1.63181 WP_001061334.1.63203 WP_001061334.1.63256 WP_001061334.1.63290 WP_001061334.1.63382 WP_001061334.1.63432 WP_001061334.1.63461 WP_001061334.1.63479 WP_001061334.1.63577 WP_001061334.1.63718 WP_001061334.1.6375 WP_001061334.1.63757 WP_001061334.1.63831 WP_001061334.1.63834 WP_001061334.1.64046 WP_001061334.1.6437 WP_001061334.1.64403 WP_001061334.1.64649 WP_001061334.1.64781 WP_001061334.1.64831 WP_001061334.1.6489 WP_001061334.1.65018 WP_001061334.1.65028 WP_001061334.1.65171 WP_001061334.1.65185 WP_001061334.1.65248 WP_001061334.1.6535 WP_001061334.1.65474 WP_001061334.1.65633 WP_001061334.1.65696 WP_001061334.1.6575 WP_001061334.1.65782 WP_001061334.1.65876 WP_001061334.1.6630 WP_001061334.1.66314 WP_001061334.1.66358 WP_001061334.1.6638 WP_001061334.1.6640 WP_001061334.1.66698 WP_001061334.1.6680 WP_001061334.1.66834 WP_001061334.1.67037 WP_001061334.1.67045 WP_001061334.1.67181 WP_001061334.1.67268 WP_001061334.1.67347 WP_001061334.1.67465 WP_001061334.1.67552 WP_001061334.1.67829 WP_001061334.1.67887 WP_001061334.1.68073 WP_001061334.1.68201 WP_001061334.1.68206 WP_001061334.1.6827 WP_001061334.1.68547 WP_001061334.1.68589 WP_001061334.1.68655 WP_001061334.1.68778 WP_001061334.1.68787 WP_001061334.1.68894 WP_001061334.1.68928 WP_001061334.1.68975 WP_001061334.1.69006 WP_001061334.1.69058 WP_001061334.1.6913 WP_001061334.1.69397 WP_001061334.1.69564 WP_001061334.1.69644 WP_001061334.1.70183 WP_001061334.1.7021 WP_001061334.1.70241 WP_001061334.1.70269 WP_001061334.1.70447 WP_001061334.1.70485 WP_001061334.1.70643 WP_001061334.1.70683 WP_001061334.1.70948 WP_001061334.1.71165 WP_001061334.1.71248 WP_001061334.1.71306 WP_001061334.1.71337 WP_001061334.1.71378 WP_001061334.1.71401 WP_001061334.1.71583 WP_001061334.1.71702 WP_001061334.1.71750 WP_001061334.1.71845 WP_001061334.1.71881 WP_001061334.1.71908 WP_001061334.1.71952 WP_001061334.1.71973 WP_001061334.1.72105 WP_001061334.1.72376 WP_001061334.1.72438 WP_001061334.1.72594 WP_001061334.1.72827 WP_001061334.1.72975 WP_001061334.1.7315 WP_001061334.1.7334 WP_001061334.1.73377 WP_001061334.1.7356 WP_001061334.1.73617 WP_001061334.1.73758 WP_001061334.1.73794 WP_001061334.1.7387 WP_001061334.1.73924 WP_001061334.1.74029 WP_001061334.1.74181 WP_001061334.1.74228 WP_001061334.1.7433 WP_001061334.1.74466 WP_001061334.1.74545 WP_001061334.1.74745 WP_001061334.1.74992 WP_001061334.1.75129 WP_001061334.1.75187 WP_001061334.1.75334 WP_001061334.1.75362 WP_001061334.1.75385 WP_001061334.1.75392 WP_001061334.1.75760 WP_001061334.1.75764 WP_001061334.1.75837 WP_001061334.1.75874 WP_001061334.1.76020 WP_001061334.1.76252 WP_001061334.1.76445 WP_001061334.1.76706 WP_001061334.1.76721 WP_001061334.1.76756 WP_001061334.1.76760 WP_001061334.1.76875 WP_001061334.1.76880 WP_001061334.1.76899 WP_001061334.1.77038 WP_001061334.1.7712 WP_001061334.1.77180 WP_001061334.1.77244 WP_001061334.1.77292 WP_001061334.1.77514 WP_001061334.1.77529 WP_001061334.1.77549 WP_001061334.1.77692 WP_001061334.1.77898 WP_001061334.1.77918 WP_001061334.1.77960 WP_001061334.1.78076 WP_001061334.1.78096 WP_001061334.1.78100 WP_001061334.1.78120 WP_001061334.1.78245 WP_001061334.1.78383 WP_001061334.1.78407 WP_001061334.1.78618 WP_001061334.1.78802 WP_001061334.1.78830 WP_001061334.1.78871 WP_001061334.1.78918 WP_001061334.1.78930 WP_001061334.1.79151 WP_001061334.1.79167 WP_001061334.1.79462 WP_001061334.1.79490 WP_001061334.1.79495 WP_001061334.1.79529 WP_001061334.1.79570 WP_001061334.1.7964 WP_001061334.1.79659 WP_001061334.1.79668 WP_001061334.1.79708 WP_001061334.1.80077 WP_001061334.1.80137 WP_001061334.1.80296 WP_001061334.1.80366 WP_001061334.1.80780 WP_001061334.1.80850 WP_001061334.1.80881 WP_001061334.1.8096 WP_001061334.1.81037 WP_001061334.1.81069 WP_001061334.1.81149 WP_001061334.1.81175 WP_001061334.1.8119 WP_001061334.1.81193 WP_001061334.1.81354 WP_001061334.1.81425 WP_001061334.1.81902 WP_001061334.1.82395 WP_001061334.1.82479 WP_001061334.1.82503 WP_001061334.1.82515 WP_001061334.1.82676 WP_001061334.1.82761 WP_001061334.1.82944 WP_001061334.1.82956 WP_001061334.1.83305 WP_001061334.1.83413 WP_001061334.1.83491 WP_001061334.1.8354 WP_001061334.1.83760 WP_001061334.1.83995 WP_001061334.1.84283 WP_001061334.1.84392 WP_001061334.1.84403 WP_001061334.1.8441 WP_001061334.1.84532 WP_001061334.1.84554 WP_001061334.1.84659 WP_001061334.1.84683 WP_001061334.1.84899 WP_001061334.1.8497 WP_001061334.1.85134 WP_001061334.1.85180 WP_001061334.1.85190 WP_001061334.1.85541 WP_001061334.1.8556 WP_001061334.1.85615 WP_001061334.1.85617 WP_001061334.1.85663 WP_001061334.1.85671 WP_001061334.1.85886 WP_001061334.1.85904 WP_001061334.1.85976 WP_001061334.1.85982 WP_001061334.1.86092 WP_001061334.1.86306 WP_001061334.1.86356 WP_001061334.1.86450 WP_001061334.1.86469 WP_001061334.1.86580 WP_001061334.1.86588 WP_001061334.1.86601 WP_001061334.1.86661 WP_001061334.1.86810 WP_001061334.1.86895 WP_001061334.1.86906 WP_001061334.1.86982 WP_001061334.1.87095 WP_001061334.1.8736 WP_001061334.1.87460 WP_001061334.1.87552 WP_001061334.1.87779 WP_001061334.1.87945 WP_001061334.1.88019 WP_001061334.1.88073 WP_001061334.1.8809 WP_001061334.1.88291 WP_001061334.1.88293 WP_001061334.1.88393 WP_001061334.1.88703 WP_001061334.1.88792 WP_001061334.1.88902 WP_001061334.1.8891 WP_001061334.1.88981 WP_001061334.1.89008 WP_001061334.1.89116 WP_001061334.1.89138 WP_001061334.1.89304 WP_001061334.1.89527 WP_001061334.1.89570 WP_001061334.1.89634 WP_001061334.1.89659 WP_001061334.1.8996 WP_001061334.1.90097 WP_001061334.1.90417 WP_001061334.1.90453 WP_001061334.1.90521 WP_001061334.1.90585 WP_001061334.1.90641 WP_001061334.1.90984 WP_001061334.1.91003 WP_001061334.1.91069 WP_001061334.1.91278 WP_001061334.1.91512 WP_001061334.1.91564 WP_001061334.1.91655 WP_001061334.1.91724 WP_001061334.1.91732 WP_001061334.1.91788 WP_001061334.1.92013 WP_001061334.1.92093 WP_001061334.1.92183 WP_001061334.1.92208 WP_001061334.1.92310 WP_001061334.1.92375 WP_001061334.1.92443 WP_001061334.1.92482 WP_001061334.1.92531 WP_001061334.1.92669 WP_001061334.1.92836 WP_001061334.1.93086 WP_001061334.1.93101 WP_001061334.1.93136 WP_001061334.1.93543 WP_001061334.1.93662 WP_001061334.1.937 WP_001061334.1.93804 WP_001061334.1.9389 WP_001061334.1.93994 WP_001061334.1.94162 WP_001061334.1.94168 WP_001061334.1.94198 WP_001061334.1.94354 WP_001061334.1.94380 WP_001061334.1.94458 WP_001061334.1.94565 WP_001061334.1.94584 WP_001061334.1.94674 WP_001061334.1.94796 WP_001061334.1.95051 WP_001061334.1.95085 WP_001061334.1.95121 WP_001061334.1.95282 WP_001061334.1.95546 WP_001061334.1.95630 WP_001061334.1.95911 WP_001061334.1.96317 WP_001061334.1.96343 WP_001061334.1.9644 WP_001061334.1.96469 WP_001061334.1.96500 WP_001061334.1.96555 WP_001061334.1.96588 WP_001061334.1.96590 WP_001061334.1.96732 WP_001061334.1.96771 WP_001061334.1.97043 WP_001061334.1.97109 WP_001061334.1.97145 WP_001061334.1.97190 WP_001061334.1.97318 WP_001061334.1.97496 WP_001061334.1.97594 WP_001061334.1.97613 WP_001061334.1.97620 WP_001061334.1.97732 WP_001061334.1.9775 WP_001061334.1.97846 WP_001061334.1.98019 WP_001061334.1.98022 WP_001061334.1.98110 WP_001061334.1.98219 WP_001061334.1.9841 WP_001061334.1.98495 WP_001061334.1.98531 WP_001061334.1.98551 WP_001061334.1.98676 WP_001061334.1.98677 WP_001061334.1.98760 WP_001061334.1.98843 WP_001061334.1.98947 WP_001061334.1.9898 WP_001061334.1.99040 WP_001061334.1.99184 WP_001061334.1.99267 WP_001061334.1.99276 WP_001061334.1.99646 WP_001061334.1.99657 WP_001061334.1.99660 WP_001061334.1.99712 WP_001061334.1.99813 WP_001061334.1.99858 WP_001061334.1.99889 WP_001061334.1.99958 YP_009324753.1.54916 YP_009324818.1.54916 gi|525837850|ref|YP_008254745.1| gi|378699912|ref|YP_005181869.1| gi|550901441|ref|YP_008670533.1| gi|549724664|ref|YP_008644854.1| gi|526220603|ref|YP_008266251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]