SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450741|ref|YP_005238100.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450741|ref|YP_005238100.1|
Domain Number 1 Region: 10-475
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.93e-135
Family DnaQ-like 3'-5' exonuclease 0.0000000000000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450741|ref|YP_005238100.1|
Sequence length 476
Comment exonuclease I [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTVKNDSIQSTFLFHDYETFGTHPALDRPAQFAALRTDNDFNVIGEPEVFYCKPADDYLP
QPGAVLITGITPQEAREKGENEAAFARRIHALFTVPKTCVVGYNNVRFDDEVTRNIFYRN
FYDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTRANGIEHSN
AHDAMADVYATIAMAQLVKTRQPRLFDYLYSHRSKHKLAALIDVPQMKPLVHVSGMFGAW
RGNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKADLGDHAAVPVK
LVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKVLRENPQVRDKVVAIFAEAEPFAA
SDNVDAQLYDGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTL
DDAEQQRWLEHRRQVLTPEFLQQYANELQMLSQQYAEDKTKLGLLKSLWQYATEIV
Download sequence
Identical sequences A0A0D6FHQ4 A0A0F6B3B4 A0A0F7J7R5 A0A0H3ND89 A0A0M0PZ57 A0A0T9W8D3 A0A249UX89 A0A265B684 A0A2D3ADG7 A0A2H9YI33 Q8ZNR2
gi|525837793|ref|YP_008254678.1| gi|378699980|ref|YP_005181937.1| gi|482903884|ref|YP_007902444.1| gi|386591885|ref|YP_006088285.1| gi|549724733|ref|YP_008644923.1| gi|378450741|ref|YP_005238100.1| gi|525829850|ref|YP_008253035.1| gi|378445503|ref|YP_005233135.1| gi|526220660|ref|YP_008266318.1| gi|378984630|ref|YP_005247785.1| gi|16765397|ref|NP_461012.1| ABAO01000005|CDS_48047-49477 ABEL01000004|CDS_49959-51389 AE006468|CDS_2144261-2145691 CP001120|CDS_2191880-2193310 CP001363|CDS_2195813-2197243 FN424405|CDS_2167916-2169346 NP_461012.1.58477 WP_000216711.1.100010 WP_000216711.1.100234 WP_000216711.1.100258 WP_000216711.1.100376 WP_000216711.1.100424 WP_000216711.1.100436 WP_000216711.1.100484 WP_000216711.1.100488 WP_000216711.1.100650 WP_000216711.1.100730 WP_000216711.1.10076 WP_000216711.1.100781 WP_000216711.1.100793 WP_000216711.1.100869 WP_000216711.1.100871 WP_000216711.1.100882 WP_000216711.1.101007 WP_000216711.1.101020 WP_000216711.1.101074 WP_000216711.1.101078 WP_000216711.1.101180 WP_000216711.1.101259 WP_000216711.1.101284 WP_000216711.1.101291 WP_000216711.1.1013 WP_000216711.1.101320 WP_000216711.1.101353 WP_000216711.1.101386 WP_000216711.1.101404 WP_000216711.1.101420 WP_000216711.1.101589 WP_000216711.1.101707 WP_000216711.1.101734 WP_000216711.1.101878 WP_000216711.1.101953 WP_000216711.1.10220 WP_000216711.1.10231 WP_000216711.1.10266 WP_000216711.1.10429 WP_000216711.1.10439 WP_000216711.1.10566 WP_000216711.1.10678 WP_000216711.1.10753 WP_000216711.1.10992 WP_000216711.1.11000 WP_000216711.1.11024 WP_000216711.1.11031 WP_000216711.1.11098 WP_000216711.1.1110 WP_000216711.1.11156 WP_000216711.1.11168 WP_000216711.1.11190 WP_000216711.1.11295 WP_000216711.1.11455 WP_000216711.1.11458 WP_000216711.1.11518 WP_000216711.1.11532 WP_000216711.1.11543 WP_000216711.1.11588 WP_000216711.1.11677 WP_000216711.1.11687 WP_000216711.1.11735 WP_000216711.1.11763 WP_000216711.1.11772 WP_000216711.1.11834 WP_000216711.1.11897 WP_000216711.1.12017 WP_000216711.1.12025 WP_000216711.1.12114 WP_000216711.1.12351 WP_000216711.1.12370 WP_000216711.1.1239 WP_000216711.1.12546 WP_000216711.1.1264 WP_000216711.1.12728 WP_000216711.1.12879 WP_000216711.1.12936 WP_000216711.1.12995 WP_000216711.1.13027 WP_000216711.1.13106 WP_000216711.1.13130 WP_000216711.1.13207 WP_000216711.1.13334 WP_000216711.1.13414 WP_000216711.1.13488 WP_000216711.1.13509 WP_000216711.1.13661 WP_000216711.1.13669 WP_000216711.1.13741 WP_000216711.1.1387 WP_000216711.1.13908 WP_000216711.1.13932 WP_000216711.1.13968 WP_000216711.1.14001 WP_000216711.1.14111 WP_000216711.1.14151 WP_000216711.1.14239 WP_000216711.1.14320 WP_000216711.1.14379 WP_000216711.1.14406 WP_000216711.1.14410 WP_000216711.1.14436 WP_000216711.1.14458 WP_000216711.1.14466 WP_000216711.1.14524 WP_000216711.1.14554 WP_000216711.1.14618 WP_000216711.1.14725 WP_000216711.1.14852 WP_000216711.1.1489 WP_000216711.1.14932 WP_000216711.1.15046 WP_000216711.1.15055 WP_000216711.1.15079 WP_000216711.1.15124 WP_000216711.1.15223 WP_000216711.1.15226 WP_000216711.1.15316 WP_000216711.1.15369 WP_000216711.1.1540 WP_000216711.1.15508 WP_000216711.1.15784 WP_000216711.1.15830 WP_000216711.1.15862 WP_000216711.1.15909 WP_000216711.1.15910 WP_000216711.1.15986 WP_000216711.1.16004 WP_000216711.1.16047 WP_000216711.1.16062 WP_000216711.1.16063 WP_000216711.1.16103 WP_000216711.1.16226 WP_000216711.1.16233 WP_000216711.1.16284 WP_000216711.1.1635 WP_000216711.1.16361 WP_000216711.1.16468 WP_000216711.1.16525 WP_000216711.1.16614 WP_000216711.1.16650 WP_000216711.1.16686 WP_000216711.1.16691 WP_000216711.1.167 WP_000216711.1.16732 WP_000216711.1.16735 WP_000216711.1.16786 WP_000216711.1.16858 WP_000216711.1.16873 WP_000216711.1.16896 WP_000216711.1.16903 WP_000216711.1.16916 WP_000216711.1.16944 WP_000216711.1.16965 WP_000216711.1.1700 WP_000216711.1.17093 WP_000216711.1.17307 WP_000216711.1.174 WP_000216711.1.17480 WP_000216711.1.17546 WP_000216711.1.17702 WP_000216711.1.17705 WP_000216711.1.17743 WP_000216711.1.17747 WP_000216711.1.17891 WP_000216711.1.1798 WP_000216711.1.18019 WP_000216711.1.18111 WP_000216711.1.18122 WP_000216711.1.18163 WP_000216711.1.1818 WP_000216711.1.18254 WP_000216711.1.18265 WP_000216711.1.18267 WP_000216711.1.18282 WP_000216711.1.18468 WP_000216711.1.18607 WP_000216711.1.18705 WP_000216711.1.18715 WP_000216711.1.18776 WP_000216711.1.18822 WP_000216711.1.18881 WP_000216711.1.18940 WP_000216711.1.18949 WP_000216711.1.19053 WP_000216711.1.19273 WP_000216711.1.19320 WP_000216711.1.19458 WP_000216711.1.19460 WP_000216711.1.19461 WP_000216711.1.19588 WP_000216711.1.19614 WP_000216711.1.19616 WP_000216711.1.19642 WP_000216711.1.19702 WP_000216711.1.19706 WP_000216711.1.19724 WP_000216711.1.19749 WP_000216711.1.19784 WP_000216711.1.19793 WP_000216711.1.19802 WP_000216711.1.19809 WP_000216711.1.19867 WP_000216711.1.19975 WP_000216711.1.1998 WP_000216711.1.20 WP_000216711.1.2010 WP_000216711.1.20212 WP_000216711.1.20266 WP_000216711.1.20271 WP_000216711.1.20330 WP_000216711.1.20362 WP_000216711.1.20418 WP_000216711.1.20443 WP_000216711.1.20446 WP_000216711.1.20525 WP_000216711.1.2054 WP_000216711.1.20614 WP_000216711.1.20626 WP_000216711.1.20646 WP_000216711.1.20886 WP_000216711.1.20908 WP_000216711.1.21049 WP_000216711.1.21136 WP_000216711.1.21245 WP_000216711.1.21246 WP_000216711.1.21269 WP_000216711.1.21351 WP_000216711.1.21400 WP_000216711.1.21497 WP_000216711.1.21499 WP_000216711.1.21548 WP_000216711.1.21603 WP_000216711.1.21751 WP_000216711.1.21757 WP_000216711.1.21991 WP_000216711.1.22024 WP_000216711.1.2205 WP_000216711.1.22062 WP_000216711.1.22067 WP_000216711.1.2221 WP_000216711.1.22235 WP_000216711.1.2235 WP_000216711.1.22379 WP_000216711.1.22427 WP_000216711.1.2246 WP_000216711.1.22485 WP_000216711.1.22537 WP_000216711.1.22620 WP_000216711.1.22692 WP_000216711.1.22758 WP_000216711.1.22864 WP_000216711.1.22870 WP_000216711.1.22979 WP_000216711.1.23102 WP_000216711.1.23114 WP_000216711.1.2314 WP_000216711.1.23192 WP_000216711.1.23259 WP_000216711.1.23379 WP_000216711.1.23460 WP_000216711.1.23472 WP_000216711.1.23509 WP_000216711.1.23634 WP_000216711.1.2364 WP_000216711.1.23932 WP_000216711.1.23959 WP_000216711.1.24017 WP_000216711.1.24082 WP_000216711.1.24206 WP_000216711.1.24308 WP_000216711.1.24578 WP_000216711.1.24737 WP_000216711.1.24779 WP_000216711.1.25008 WP_000216711.1.25015 WP_000216711.1.25119 WP_000216711.1.25206 WP_000216711.1.25405 WP_000216711.1.25454 WP_000216711.1.25493 WP_000216711.1.25668 WP_000216711.1.25690 WP_000216711.1.2570 WP_000216711.1.25740 WP_000216711.1.25814 WP_000216711.1.25988 WP_000216711.1.26282 WP_000216711.1.26311 WP_000216711.1.26319 WP_000216711.1.26429 WP_000216711.1.26440 WP_000216711.1.26493 WP_000216711.1.26551 WP_000216711.1.26567 WP_000216711.1.26741 WP_000216711.1.26919 WP_000216711.1.27010 WP_000216711.1.27084 WP_000216711.1.27173 WP_000216711.1.27206 WP_000216711.1.27223 WP_000216711.1.27423 WP_000216711.1.27544 WP_000216711.1.27561 WP_000216711.1.2763 WP_000216711.1.27707 WP_000216711.1.27761 WP_000216711.1.2777 WP_000216711.1.27857 WP_000216711.1.27977 WP_000216711.1.28032 WP_000216711.1.28094 WP_000216711.1.28126 WP_000216711.1.28170 WP_000216711.1.28302 WP_000216711.1.2835 WP_000216711.1.28370 WP_000216711.1.28538 WP_000216711.1.28575 WP_000216711.1.28625 WP_000216711.1.28655 WP_000216711.1.28694 WP_000216711.1.2879 WP_000216711.1.2890 WP_000216711.1.28938 WP_000216711.1.28946 WP_000216711.1.29006 WP_000216711.1.29010 WP_000216711.1.2910 WP_000216711.1.29113 WP_000216711.1.29509 WP_000216711.1.29588 WP_000216711.1.29601 WP_000216711.1.29606 WP_000216711.1.29615 WP_000216711.1.29619 WP_000216711.1.29704 WP_000216711.1.29827 WP_000216711.1.29969 WP_000216711.1.29990 WP_000216711.1.30006 WP_000216711.1.30022 WP_000216711.1.30027 WP_000216711.1.30180 WP_000216711.1.30202 WP_000216711.1.30469 WP_000216711.1.30505 WP_000216711.1.30507 WP_000216711.1.30535 WP_000216711.1.30547 WP_000216711.1.30794 WP_000216711.1.30833 WP_000216711.1.30835 WP_000216711.1.30972 WP_000216711.1.31 WP_000216711.1.31092 WP_000216711.1.31122 WP_000216711.1.3113 WP_000216711.1.31185 WP_000216711.1.3119 WP_000216711.1.31190 WP_000216711.1.31195 WP_000216711.1.31196 WP_000216711.1.31219 WP_000216711.1.31281 WP_000216711.1.31362 WP_000216711.1.31451 WP_000216711.1.31504 WP_000216711.1.31515 WP_000216711.1.31578 WP_000216711.1.31658 WP_000216711.1.31940 WP_000216711.1.31967 WP_000216711.1.31972 WP_000216711.1.32192 WP_000216711.1.32206 WP_000216711.1.32260 WP_000216711.1.32515 WP_000216711.1.32527 WP_000216711.1.32660 WP_000216711.1.32702 WP_000216711.1.32714 WP_000216711.1.32786 WP_000216711.1.32804 WP_000216711.1.32860 WP_000216711.1.32907 WP_000216711.1.33030 WP_000216711.1.33127 WP_000216711.1.33143 WP_000216711.1.33248 WP_000216711.1.33261 WP_000216711.1.333 WP_000216711.1.33492 WP_000216711.1.33553 WP_000216711.1.33580 WP_000216711.1.33592 WP_000216711.1.33894 WP_000216711.1.3394 WP_000216711.1.34043 WP_000216711.1.34075 WP_000216711.1.34257 WP_000216711.1.34279 WP_000216711.1.34319 WP_000216711.1.34417 WP_000216711.1.34453 WP_000216711.1.34610 WP_000216711.1.34856 WP_000216711.1.34975 WP_000216711.1.34977 WP_000216711.1.35045 WP_000216711.1.35129 WP_000216711.1.35184 WP_000216711.1.35193 WP_000216711.1.35404 WP_000216711.1.35408 WP_000216711.1.35425 WP_000216711.1.35429 WP_000216711.1.35446 WP_000216711.1.35463 WP_000216711.1.35509 WP_000216711.1.35590 WP_000216711.1.35892 WP_000216711.1.35940 WP_000216711.1.36003 WP_000216711.1.3601 WP_000216711.1.36017 WP_000216711.1.36547 WP_000216711.1.36609 WP_000216711.1.36690 WP_000216711.1.3670 WP_000216711.1.36705 WP_000216711.1.36918 WP_000216711.1.36931 WP_000216711.1.37073 WP_000216711.1.37111 WP_000216711.1.37112 WP_000216711.1.37256 WP_000216711.1.37293 WP_000216711.1.37370 WP_000216711.1.37376 WP_000216711.1.3744 WP_000216711.1.37498 WP_000216711.1.37504 WP_000216711.1.37618 WP_000216711.1.37687 WP_000216711.1.37968 WP_000216711.1.37978 WP_000216711.1.38125 WP_000216711.1.38145 WP_000216711.1.383 WP_000216711.1.3848 WP_000216711.1.38569 WP_000216711.1.38613 WP_000216711.1.38673 WP_000216711.1.3869 WP_000216711.1.38693 WP_000216711.1.38773 WP_000216711.1.38781 WP_000216711.1.38882 WP_000216711.1.38913 WP_000216711.1.39003 WP_000216711.1.39136 WP_000216711.1.39197 WP_000216711.1.39229 WP_000216711.1.39265 WP_000216711.1.39405 WP_000216711.1.39420 WP_000216711.1.39449 WP_000216711.1.39512 WP_000216711.1.39556 WP_000216711.1.39584 WP_000216711.1.39629 WP_000216711.1.39724 WP_000216711.1.39763 WP_000216711.1.39862 WP_000216711.1.39921 WP_000216711.1.39923 WP_000216711.1.40017 WP_000216711.1.40072 WP_000216711.1.40073 WP_000216711.1.4011 WP_000216711.1.40208 WP_000216711.1.40240 WP_000216711.1.40257 WP_000216711.1.40292 WP_000216711.1.40305 WP_000216711.1.40311 WP_000216711.1.40341 WP_000216711.1.40380 WP_000216711.1.40395 WP_000216711.1.40465 WP_000216711.1.40508 WP_000216711.1.40710 WP_000216711.1.4075 WP_000216711.1.4087 WP_000216711.1.40877 WP_000216711.1.40996 WP_000216711.1.41017 WP_000216711.1.41018 WP_000216711.1.41086 WP_000216711.1.41091 WP_000216711.1.41226 WP_000216711.1.41279 WP_000216711.1.41516 WP_000216711.1.41554 WP_000216711.1.41572 WP_000216711.1.41591 WP_000216711.1.41662 WP_000216711.1.41708 WP_000216711.1.41761 WP_000216711.1.41859 WP_000216711.1.41882 WP_000216711.1.41979 WP_000216711.1.41985 WP_000216711.1.42104 WP_000216711.1.42156 WP_000216711.1.4222 WP_000216711.1.42243 WP_000216711.1.42320 WP_000216711.1.42342 WP_000216711.1.42422 WP_000216711.1.42444 WP_000216711.1.42676 WP_000216711.1.4276 WP_000216711.1.42864 WP_000216711.1.4288 WP_000216711.1.43018 WP_000216711.1.43041 WP_000216711.1.43077 WP_000216711.1.43086 WP_000216711.1.43244 WP_000216711.1.43312 WP_000216711.1.43334 WP_000216711.1.43339 WP_000216711.1.43351 WP_000216711.1.43371 WP_000216711.1.43437 WP_000216711.1.43522 WP_000216711.1.43613 WP_000216711.1.43668 WP_000216711.1.43778 WP_000216711.1.43886 WP_000216711.1.43951 WP_000216711.1.44043 WP_000216711.1.44099 WP_000216711.1.44121 WP_000216711.1.44291 WP_000216711.1.44300 WP_000216711.1.44310 WP_000216711.1.44433 WP_000216711.1.44479 WP_000216711.1.44640 WP_000216711.1.4467 WP_000216711.1.44747 WP_000216711.1.4485 WP_000216711.1.44877 WP_000216711.1.44927 WP_000216711.1.44933 WP_000216711.1.44971 WP_000216711.1.45067 WP_000216711.1.45074 WP_000216711.1.45079 WP_000216711.1.45098 WP_000216711.1.45145 WP_000216711.1.45177 WP_000216711.1.45184 WP_000216711.1.45259 WP_000216711.1.45349 WP_000216711.1.45365 WP_000216711.1.45434 WP_000216711.1.45550 WP_000216711.1.45582 WP_000216711.1.45585 WP_000216711.1.45622 WP_000216711.1.45660 WP_000216711.1.45690 WP_000216711.1.45797 WP_000216711.1.458 WP_000216711.1.45848 WP_000216711.1.46011 WP_000216711.1.46069 WP_000216711.1.46173 WP_000216711.1.46174 WP_000216711.1.46187 WP_000216711.1.46278 WP_000216711.1.46303 WP_000216711.1.46434 WP_000216711.1.46595 WP_000216711.1.46675 WP_000216711.1.46930 WP_000216711.1.47008 WP_000216711.1.47057 WP_000216711.1.47214 WP_000216711.1.47429 WP_000216711.1.47448 WP_000216711.1.4747 WP_000216711.1.47472 WP_000216711.1.47478 WP_000216711.1.47579 WP_000216711.1.47621 WP_000216711.1.47799 WP_000216711.1.47928 WP_000216711.1.48242 WP_000216711.1.48253 WP_000216711.1.483 WP_000216711.1.48367 WP_000216711.1.48377 WP_000216711.1.4853 WP_000216711.1.48788 WP_000216711.1.4885 WP_000216711.1.48894 WP_000216711.1.48919 WP_000216711.1.49084 WP_000216711.1.49113 WP_000216711.1.49155 WP_000216711.1.49204 WP_000216711.1.49239 WP_000216711.1.49256 WP_000216711.1.49290 WP_000216711.1.49340 WP_000216711.1.49366 WP_000216711.1.49490 WP_000216711.1.49515 WP_000216711.1.49572 WP_000216711.1.49686 WP_000216711.1.4979 WP_000216711.1.49803 WP_000216711.1.49805 WP_000216711.1.49929 WP_000216711.1.50080 WP_000216711.1.50161 WP_000216711.1.50211 WP_000216711.1.50376 WP_000216711.1.50389 WP_000216711.1.50404 WP_000216711.1.50676 WP_000216711.1.50774 WP_000216711.1.50804 WP_000216711.1.50808 WP_000216711.1.5088 WP_000216711.1.50908 WP_000216711.1.50941 WP_000216711.1.50999 WP_000216711.1.51014 WP_000216711.1.51066 WP_000216711.1.51179 WP_000216711.1.51182 WP_000216711.1.51186 WP_000216711.1.51224 WP_000216711.1.51487 WP_000216711.1.51488 WP_000216711.1.51634 WP_000216711.1.51649 WP_000216711.1.51686 WP_000216711.1.51756 WP_000216711.1.51831 WP_000216711.1.51911 WP_000216711.1.51932 WP_000216711.1.51989 WP_000216711.1.52121 WP_000216711.1.52148 WP_000216711.1.52170 WP_000216711.1.52336 WP_000216711.1.52346 WP_000216711.1.52353 WP_000216711.1.52361 WP_000216711.1.52653 WP_000216711.1.52656 WP_000216711.1.52692 WP_000216711.1.52743 WP_000216711.1.52857 WP_000216711.1.52866 WP_000216711.1.52898 WP_000216711.1.52915 WP_000216711.1.52949 WP_000216711.1.52985 WP_000216711.1.53190 WP_000216711.1.53272 WP_000216711.1.53406 WP_000216711.1.53436 WP_000216711.1.53466 WP_000216711.1.53529 WP_000216711.1.53543 WP_000216711.1.53757 WP_000216711.1.53812 WP_000216711.1.53905 WP_000216711.1.54033 WP_000216711.1.54075 WP_000216711.1.54196 WP_000216711.1.542 WP_000216711.1.54209 WP_000216711.1.54271 WP_000216711.1.54273 WP_000216711.1.54274 WP_000216711.1.54319 WP_000216711.1.54364 WP_000216711.1.54400 WP_000216711.1.54526 WP_000216711.1.54644 WP_000216711.1.54662 WP_000216711.1.54722 WP_000216711.1.54749 WP_000216711.1.54764 WP_000216711.1.55008 WP_000216711.1.55152 WP_000216711.1.55156 WP_000216711.1.55285 WP_000216711.1.55325 WP_000216711.1.55430 WP_000216711.1.55475 WP_000216711.1.5560 WP_000216711.1.55647 WP_000216711.1.55743 WP_000216711.1.55768 WP_000216711.1.55782 WP_000216711.1.55796 WP_000216711.1.55973 WP_000216711.1.55993 WP_000216711.1.56002 WP_000216711.1.56012 WP_000216711.1.56105 WP_000216711.1.56238 WP_000216711.1.56244 WP_000216711.1.56286 WP_000216711.1.56304 WP_000216711.1.56414 WP_000216711.1.56438 WP_000216711.1.56559 WP_000216711.1.56560 WP_000216711.1.56597 WP_000216711.1.56614 WP_000216711.1.56660 WP_000216711.1.56682 WP_000216711.1.56875 WP_000216711.1.56877 WP_000216711.1.57168 WP_000216711.1.57187 WP_000216711.1.57232 WP_000216711.1.57356 WP_000216711.1.57377 WP_000216711.1.57433 WP_000216711.1.57515 WP_000216711.1.57529 WP_000216711.1.57576 WP_000216711.1.57601 WP_000216711.1.57607 WP_000216711.1.5774 WP_000216711.1.57763 WP_000216711.1.57862 WP_000216711.1.57890 WP_000216711.1.57891 WP_000216711.1.57978 WP_000216711.1.5801 WP_000216711.1.58041 WP_000216711.1.58358 WP_000216711.1.58407 WP_000216711.1.58418 WP_000216711.1.5854 WP_000216711.1.58548 WP_000216711.1.5858 WP_000216711.1.58662 WP_000216711.1.58669 WP_000216711.1.58745 WP_000216711.1.58803 WP_000216711.1.5886 WP_000216711.1.59094 WP_000216711.1.59224 WP_000216711.1.59321 WP_000216711.1.59375 WP_000216711.1.59420 WP_000216711.1.59458 WP_000216711.1.59490 WP_000216711.1.59508 WP_000216711.1.5953 WP_000216711.1.59684 WP_000216711.1.59694 WP_000216711.1.59771 WP_000216711.1.5979 WP_000216711.1.59953 WP_000216711.1.60008 WP_000216711.1.60021 WP_000216711.1.60052 WP_000216711.1.60069 WP_000216711.1.60140 WP_000216711.1.60155 WP_000216711.1.60285 WP_000216711.1.60379 WP_000216711.1.60464 WP_000216711.1.60545 WP_000216711.1.60561 WP_000216711.1.60772 WP_000216711.1.60874 WP_000216711.1.60941 WP_000216711.1.61078 WP_000216711.1.6114 WP_000216711.1.61232 WP_000216711.1.6129 WP_000216711.1.61296 WP_000216711.1.61345 WP_000216711.1.61417 WP_000216711.1.61574 WP_000216711.1.61609 WP_000216711.1.61712 WP_000216711.1.61714 WP_000216711.1.61730 WP_000216711.1.61857 WP_000216711.1.61918 WP_000216711.1.61952 WP_000216711.1.62007 WP_000216711.1.62020 WP_000216711.1.62025 WP_000216711.1.6209 WP_000216711.1.62204 WP_000216711.1.62257 WP_000216711.1.62304 WP_000216711.1.62364 WP_000216711.1.62374 WP_000216711.1.62403 WP_000216711.1.6253 WP_000216711.1.62570 WP_000216711.1.62853 WP_000216711.1.62903 WP_000216711.1.62910 WP_000216711.1.62955 WP_000216711.1.63063 WP_000216711.1.63181 WP_000216711.1.63203 WP_000216711.1.63256 WP_000216711.1.63290 WP_000216711.1.63382 WP_000216711.1.63422 WP_000216711.1.63432 WP_000216711.1.63461 WP_000216711.1.63479 WP_000216711.1.63577 WP_000216711.1.63664 WP_000216711.1.63718 WP_000216711.1.6375 WP_000216711.1.63757 WP_000216711.1.63797 WP_000216711.1.63834 WP_000216711.1.64018 WP_000216711.1.64046 WP_000216711.1.6423 WP_000216711.1.64244 WP_000216711.1.64387 WP_000216711.1.64403 WP_000216711.1.64649 WP_000216711.1.64702 WP_000216711.1.64757 WP_000216711.1.64781 WP_000216711.1.64831 WP_000216711.1.6489 WP_000216711.1.64894 WP_000216711.1.65018 WP_000216711.1.65028 WP_000216711.1.65171 WP_000216711.1.65248 WP_000216711.1.65269 WP_000216711.1.65474 WP_000216711.1.65572 WP_000216711.1.65633 WP_000216711.1.6565 WP_000216711.1.65696 WP_000216711.1.6575 WP_000216711.1.65782 WP_000216711.1.65940 WP_000216711.1.65956 WP_000216711.1.66049 WP_000216711.1.6630 WP_000216711.1.66314 WP_000216711.1.66330 WP_000216711.1.66358 WP_000216711.1.66362 WP_000216711.1.6638 WP_000216711.1.6640 WP_000216711.1.66600 WP_000216711.1.66678 WP_000216711.1.66698 WP_000216711.1.6680 WP_000216711.1.66834 WP_000216711.1.66901 WP_000216711.1.66962 WP_000216711.1.67037 WP_000216711.1.67045 WP_000216711.1.67100 WP_000216711.1.67181 WP_000216711.1.67235 WP_000216711.1.67268 WP_000216711.1.67347 WP_000216711.1.6739 WP_000216711.1.67465 WP_000216711.1.67552 WP_000216711.1.67682 WP_000216711.1.67829 WP_000216711.1.67887 WP_000216711.1.68073 WP_000216711.1.68201 WP_000216711.1.68206 WP_000216711.1.6827 WP_000216711.1.68275 WP_000216711.1.68401 WP_000216711.1.68477 WP_000216711.1.6849 WP_000216711.1.68547 WP_000216711.1.68589 WP_000216711.1.68655 WP_000216711.1.68656 WP_000216711.1.68778 WP_000216711.1.68787 WP_000216711.1.68894 WP_000216711.1.68928 WP_000216711.1.68975 WP_000216711.1.69001 WP_000216711.1.69006 WP_000216711.1.6904 WP_000216711.1.6913 WP_000216711.1.69146 WP_000216711.1.69151 WP_000216711.1.69255 WP_000216711.1.69359 WP_000216711.1.69397 WP_000216711.1.6954 WP_000216711.1.69564 WP_000216711.1.69644 WP_000216711.1.69704 WP_000216711.1.69754 WP_000216711.1.69758 WP_000216711.1.7021 WP_000216711.1.70241 WP_000216711.1.70269 WP_000216711.1.70289 WP_000216711.1.70447 WP_000216711.1.70485 WP_000216711.1.70643 WP_000216711.1.70683 WP_000216711.1.70883 WP_000216711.1.70922 WP_000216711.1.70929 WP_000216711.1.70948 WP_000216711.1.70959 WP_000216711.1.71023 WP_000216711.1.71116 WP_000216711.1.71146 WP_000216711.1.71165 WP_000216711.1.71188 WP_000216711.1.71202 WP_000216711.1.71243 WP_000216711.1.71306 WP_000216711.1.71337 WP_000216711.1.71363 WP_000216711.1.71378 WP_000216711.1.71401 WP_000216711.1.71481 WP_000216711.1.71636 WP_000216711.1.71691 WP_000216711.1.71702 WP_000216711.1.71750 WP_000216711.1.71798 WP_000216711.1.71845 WP_000216711.1.71881 WP_000216711.1.71908 WP_000216711.1.71952 WP_000216711.1.71973 WP_000216711.1.72105 WP_000216711.1.72203 WP_000216711.1.72372 WP_000216711.1.72376 WP_000216711.1.72403 WP_000216711.1.72594 WP_000216711.1.72728 WP_000216711.1.72871 WP_000216711.1.72975 WP_000216711.1.73062 WP_000216711.1.73125 WP_000216711.1.7315 WP_000216711.1.73200 WP_000216711.1.7334 WP_000216711.1.73377 WP_000216711.1.73461 WP_000216711.1.73481 WP_000216711.1.7356 WP_000216711.1.73561 WP_000216711.1.73581 WP_000216711.1.73617 WP_000216711.1.73667 WP_000216711.1.73753 WP_000216711.1.73758 WP_000216711.1.73794 WP_000216711.1.73847 WP_000216711.1.7387 WP_000216711.1.73924 WP_000216711.1.73926 WP_000216711.1.74029 WP_000216711.1.74181 WP_000216711.1.74191 WP_000216711.1.7433 WP_000216711.1.74379 WP_000216711.1.74410 WP_000216711.1.74466 WP_000216711.1.745 WP_000216711.1.74529 WP_000216711.1.74545 WP_000216711.1.74745 WP_000216711.1.7491 WP_000216711.1.75129 WP_000216711.1.75187 WP_000216711.1.75288 WP_000216711.1.75334 WP_000216711.1.75362 WP_000216711.1.75385 WP_000216711.1.75392 WP_000216711.1.75760 WP_000216711.1.75764 WP_000216711.1.75828 WP_000216711.1.75837 WP_000216711.1.75874 WP_000216711.1.75945 WP_000216711.1.76020 WP_000216711.1.76252 WP_000216711.1.76327 WP_000216711.1.76445 WP_000216711.1.7660 WP_000216711.1.76673 WP_000216711.1.76706 WP_000216711.1.76721 WP_000216711.1.76756 WP_000216711.1.76760 WP_000216711.1.76875 WP_000216711.1.76880 WP_000216711.1.76899 WP_000216711.1.77038 WP_000216711.1.77047 WP_000216711.1.77080 WP_000216711.1.7712 WP_000216711.1.77177 WP_000216711.1.77180 WP_000216711.1.77244 WP_000216711.1.77267 WP_000216711.1.77292 WP_000216711.1.77349 WP_000216711.1.77514 WP_000216711.1.77529 WP_000216711.1.77549 WP_000216711.1.77692 WP_000216711.1.77710 WP_000216711.1.7782 WP_000216711.1.77851 WP_000216711.1.77898 WP_000216711.1.77918 WP_000216711.1.77960 WP_000216711.1.78033 WP_000216711.1.78076 WP_000216711.1.78096 WP_000216711.1.78100 WP_000216711.1.78110 WP_000216711.1.78120 WP_000216711.1.78372 WP_000216711.1.78383 WP_000216711.1.78407 WP_000216711.1.7861 WP_000216711.1.78618 WP_000216711.1.78673 WP_000216711.1.78735 WP_000216711.1.78802 WP_000216711.1.78830 WP_000216711.1.78835 WP_000216711.1.78838 WP_000216711.1.78871 WP_000216711.1.78874 WP_000216711.1.78918 WP_000216711.1.78930 WP_000216711.1.79151 WP_000216711.1.79167 WP_000216711.1.79335 WP_000216711.1.79462 WP_000216711.1.79472 WP_000216711.1.79490 WP_000216711.1.79495 WP_000216711.1.79529 WP_000216711.1.79570 WP_000216711.1.7964 WP_000216711.1.79668 WP_000216711.1.79708 WP_000216711.1.79734 WP_000216711.1.7979 WP_000216711.1.79845 WP_000216711.1.80077 WP_000216711.1.80137 WP_000216711.1.80182 WP_000216711.1.80296 WP_000216711.1.80366 WP_000216711.1.80741 WP_000216711.1.80780 WP_000216711.1.80831 WP_000216711.1.80850 WP_000216711.1.80881 WP_000216711.1.80939 WP_000216711.1.8096 WP_000216711.1.81037 WP_000216711.1.81069 WP_000216711.1.81149 WP_000216711.1.81175 WP_000216711.1.8119 WP_000216711.1.81193 WP_000216711.1.81305 WP_000216711.1.81320 WP_000216711.1.81328 WP_000216711.1.81354 WP_000216711.1.81410 WP_000216711.1.81425 WP_000216711.1.81528 WP_000216711.1.81735 WP_000216711.1.81750 WP_000216711.1.81760 WP_000216711.1.81785 WP_000216711.1.81902 WP_000216711.1.81974 WP_000216711.1.82192 WP_000216711.1.82232 WP_000216711.1.82464 WP_000216711.1.82479 WP_000216711.1.82503 WP_000216711.1.82515 WP_000216711.1.82584 WP_000216711.1.82676 WP_000216711.1.82761 WP_000216711.1.8282 WP_000216711.1.82944 WP_000216711.1.82956 WP_000216711.1.83092 WP_000216711.1.83163 WP_000216711.1.83305 WP_000216711.1.83365 WP_000216711.1.83413 WP_000216711.1.83491 WP_000216711.1.83523 WP_000216711.1.8354 WP_000216711.1.83651 WP_000216711.1.83721 WP_000216711.1.83760 WP_000216711.1.83995 WP_000216711.1.84103 WP_000216711.1.84283 WP_000216711.1.84291 WP_000216711.1.84392 WP_000216711.1.84397 WP_000216711.1.8441 WP_000216711.1.84532 WP_000216711.1.84659 WP_000216711.1.84693 WP_000216711.1.84899 WP_000216711.1.8497 WP_000216711.1.85040 WP_000216711.1.85134 WP_000216711.1.85178 WP_000216711.1.85180 WP_000216711.1.85190 WP_000216711.1.8533 WP_000216711.1.8545 WP_000216711.1.85481 WP_000216711.1.85483 WP_000216711.1.85541 WP_000216711.1.8556 WP_000216711.1.85568 WP_000216711.1.85615 WP_000216711.1.85617 WP_000216711.1.85663 WP_000216711.1.85671 WP_000216711.1.85672 WP_000216711.1.85777 WP_000216711.1.85855 WP_000216711.1.85886 WP_000216711.1.85900 WP_000216711.1.85904 WP_000216711.1.85976 WP_000216711.1.86043 WP_000216711.1.86173 WP_000216711.1.86306 WP_000216711.1.86356 WP_000216711.1.86450 WP_000216711.1.86469 WP_000216711.1.86580 WP_000216711.1.86588 WP_000216711.1.86661 WP_000216711.1.8671 WP_000216711.1.8672 WP_000216711.1.8678 WP_000216711.1.86810 WP_000216711.1.8684 WP_000216711.1.86895 WP_000216711.1.86906 WP_000216711.1.87095 WP_000216711.1.87323 WP_000216711.1.8736 WP_000216711.1.87552 WP_000216711.1.87695 WP_000216711.1.87779 WP_000216711.1.87899 WP_000216711.1.8792 WP_000216711.1.87945 WP_000216711.1.88019 WP_000216711.1.88073 WP_000216711.1.8809 WP_000216711.1.88291 WP_000216711.1.88293 WP_000216711.1.8837 WP_000216711.1.88393 WP_000216711.1.88792 WP_000216711.1.88902 WP_000216711.1.8891 WP_000216711.1.88957 WP_000216711.1.88980 WP_000216711.1.88981 WP_000216711.1.89008 WP_000216711.1.89114 WP_000216711.1.89116 WP_000216711.1.89119 WP_000216711.1.89138 WP_000216711.1.89304 WP_000216711.1.89512 WP_000216711.1.89527 WP_000216711.1.89570 WP_000216711.1.89604 WP_000216711.1.89622 WP_000216711.1.89659 WP_000216711.1.89765 WP_000216711.1.89817 WP_000216711.1.89902 WP_000216711.1.8996 WP_000216711.1.90097 WP_000216711.1.90252 WP_000216711.1.90348 WP_000216711.1.90417 WP_000216711.1.90453 WP_000216711.1.90458 WP_000216711.1.90557 WP_000216711.1.90585 WP_000216711.1.90641 WP_000216711.1.90734 WP_000216711.1.91003 WP_000216711.1.91056 WP_000216711.1.91069 WP_000216711.1.91179 WP_000216711.1.91278 WP_000216711.1.9131 WP_000216711.1.91512 WP_000216711.1.91524 WP_000216711.1.91564 WP_000216711.1.91621 WP_000216711.1.91628 WP_000216711.1.91655 WP_000216711.1.91724 WP_000216711.1.91732 WP_000216711.1.91788 WP_000216711.1.92013 WP_000216711.1.92060 WP_000216711.1.92093 WP_000216711.1.92108 WP_000216711.1.92165 WP_000216711.1.92171 WP_000216711.1.92183 WP_000216711.1.92208 WP_000216711.1.92268 WP_000216711.1.92310 WP_000216711.1.92318 WP_000216711.1.92443 WP_000216711.1.92482 WP_000216711.1.92531 WP_000216711.1.92669 WP_000216711.1.92671 WP_000216711.1.92738 WP_000216711.1.92893 WP_000216711.1.93059 WP_000216711.1.93086 WP_000216711.1.93101 WP_000216711.1.93136 WP_000216711.1.93155 WP_000216711.1.93213 WP_000216711.1.93275 WP_000216711.1.93339 WP_000216711.1.93365 WP_000216711.1.93376 WP_000216711.1.93543 WP_000216711.1.93650 WP_000216711.1.93656 WP_000216711.1.93662 WP_000216711.1.937 WP_000216711.1.93705 WP_000216711.1.93804 WP_000216711.1.9389 WP_000216711.1.93937 WP_000216711.1.93994 WP_000216711.1.94072 WP_000216711.1.94162 WP_000216711.1.94168 WP_000216711.1.94198 WP_000216711.1.9432 WP_000216711.1.94354 WP_000216711.1.94380 WP_000216711.1.94458 WP_000216711.1.94565 WP_000216711.1.94584 WP_000216711.1.94655 WP_000216711.1.94674 WP_000216711.1.94796 WP_000216711.1.94959 WP_000216711.1.95051 WP_000216711.1.95085 WP_000216711.1.95121 WP_000216711.1.95248 WP_000216711.1.95277 WP_000216711.1.95282 WP_000216711.1.95388 WP_000216711.1.95546 WP_000216711.1.95630 WP_000216711.1.95670 WP_000216711.1.95691 WP_000216711.1.95911 WP_000216711.1.95939 WP_000216711.1.96004 WP_000216711.1.96139 WP_000216711.1.96162 WP_000216711.1.96317 WP_000216711.1.96343 WP_000216711.1.9644 WP_000216711.1.96469 WP_000216711.1.96497 WP_000216711.1.96500 WP_000216711.1.96555 WP_000216711.1.96563 WP_000216711.1.96732 WP_000216711.1.9674 WP_000216711.1.96771 WP_000216711.1.97015 WP_000216711.1.97047 WP_000216711.1.97143 WP_000216711.1.97145 WP_000216711.1.97190 WP_000216711.1.97297 WP_000216711.1.97318 WP_000216711.1.97369 WP_000216711.1.97477 WP_000216711.1.97487 WP_000216711.1.97594 WP_000216711.1.97597 WP_000216711.1.97613 WP_000216711.1.97620 WP_000216711.1.97631 WP_000216711.1.97727 WP_000216711.1.97732 WP_000216711.1.97736 WP_000216711.1.9775 WP_000216711.1.97846 WP_000216711.1.9799 WP_000216711.1.98006 WP_000216711.1.98019 WP_000216711.1.98022 WP_000216711.1.98110 WP_000216711.1.98146 WP_000216711.1.98170 WP_000216711.1.98219 WP_000216711.1.9826 WP_000216711.1.9841 WP_000216711.1.98495 WP_000216711.1.98531 WP_000216711.1.98577 WP_000216711.1.98676 WP_000216711.1.98677 WP_000216711.1.98760 WP_000216711.1.98843 WP_000216711.1.9898 WP_000216711.1.99072 WP_000216711.1.99098 WP_000216711.1.99184 WP_000216711.1.99267 WP_000216711.1.99276 WP_000216711.1.99626 WP_000216711.1.99646 WP_000216711.1.99657 WP_000216711.1.99660 WP_000216711.1.99712 WP_000216711.1.99813 WP_000216711.1.99858 WP_000216711.1.99889 WP_000216711.1.99958 gi|194450582|ref|YP_002046116.1| gi|525817958|ref|YP_008247976.1| gi|550901505|ref|YP_008670597.1| 454169.SeHA_C2291 99287.STM2067 gi|378989455|ref|YP_005252619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]