SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450760|ref|YP_005238119.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450760|ref|YP_005238119.1|
Domain Number 1 Region: 186-469
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.23e-83
Family TM1459-like 0.051
Further Details:      
 
Domain Number 2 Region: 2-282
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.13e-73
Family mannose-1-phosphate guanylyl transferase 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450760|ref|YP_005238119.1|
Sequence length 479
Comment mannose-1-phosphate guanylyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSFLPVIMAGGTGSRLWPLSREYHPKQFLSVEGKLSMLQNTIKRLASLSTEEPVVICNDR
HRFLVAEQLREIDKLANNIILEPVGRNTAPAIALAAFCALQNADNADPLLLVLAADHVIQ
DEIAFTKAVRHAEEYAANGKLVTFGIVPTHAETGYGYIRRGELIGNDAYAVAEFVEKPDI
DTAGDYFKSGKYYWNSGMFLFRASSYLNELKYLSPEIYKACEKAVGHINPDLDFIRIDKE
EFMSCPSDSIDYAVMEHTQHAVVIPMSAGWSDVGSWSSLWDISNKDHQRNVLKGDIFAHA
CNDNYIYSEDMFISAIGVSNLVIVQTTDALLVANKDTVQDVKKIVDYLKRNDRNEYKQHQ
EVFRPWGKYNVIDSGKNYLVRCITVKPGEKFVAQMHHHRAEHWIVLSGTARVTKGEQTYM
VSENESTFIPPNTIHALENPGMTPLKLIEIQSGTYLGEDDIIRLEQRSGFSKEWTNERS
Download sequence
Identical sequences A0A0D6FH89 A0A0F6B3D3 A0A0F7JAX6 A0A0H3NEN6 A0A0M0QTH5 A0A0T9VRE7 A0A249UX80 A0A265B6M1 A0A2D3ADI3 A0A2H9YI47 E8XC38 P26404
gi|549724750|ref|YP_008644940.1| ABAM02000001|CDS_2624391-2622952 ABAO01000005|CDS_69078-67639 ABEL01000004|CDS_70990-69551 AE006468|CDS_2165292-2163853 CP001120|CDS_2212911-2211472 CP001363|CDS_2216844-2215405 FN424405|CDS_2188947-2187508 gi|378989472|ref|YP_005252636.1| gi|525837777|ref|YP_008254661.1| gi|526220676|ref|YP_008266335.1| gi|482903900|ref|YP_007902460.1| gi|378699997|ref|YP_005181954.1| gi|378445520|ref|YP_005233152.1| gi|525817975|ref|YP_008247993.1| NP_461029.1.58477 WP_000009017.1.100010 WP_000009017.1.100234 WP_000009017.1.100258 WP_000009017.1.100376 WP_000009017.1.100424 WP_000009017.1.100436 WP_000009017.1.100484 WP_000009017.1.100488 WP_000009017.1.100597 WP_000009017.1.100730 WP_000009017.1.100781 WP_000009017.1.100793 WP_000009017.1.100869 WP_000009017.1.100871 WP_000009017.1.100882 WP_000009017.1.101007 WP_000009017.1.101020 WP_000009017.1.101074 WP_000009017.1.101180 WP_000009017.1.101259 WP_000009017.1.101284 WP_000009017.1.101291 WP_000009017.1.1013 WP_000009017.1.101320 WP_000009017.1.101353 WP_000009017.1.101386 WP_000009017.1.101404 WP_000009017.1.101420 WP_000009017.1.101589 WP_000009017.1.101707 WP_000009017.1.101734 WP_000009017.1.101878 WP_000009017.1.101953 WP_000009017.1.10220 WP_000009017.1.10231 WP_000009017.1.10266 WP_000009017.1.10429 WP_000009017.1.10439 WP_000009017.1.10566 WP_000009017.1.10678 WP_000009017.1.10753 WP_000009017.1.10992 WP_000009017.1.11000 WP_000009017.1.11024 WP_000009017.1.11031 WP_000009017.1.11098 WP_000009017.1.1110 WP_000009017.1.11156 WP_000009017.1.11190 WP_000009017.1.11295 WP_000009017.1.11455 WP_000009017.1.11458 WP_000009017.1.11518 WP_000009017.1.11532 WP_000009017.1.11543 WP_000009017.1.11588 WP_000009017.1.11677 WP_000009017.1.11687 WP_000009017.1.11735 WP_000009017.1.11763 WP_000009017.1.11772 WP_000009017.1.11834 WP_000009017.1.12017 WP_000009017.1.12025 WP_000009017.1.12114 WP_000009017.1.12351 WP_000009017.1.12370 WP_000009017.1.12546 WP_000009017.1.1264 WP_000009017.1.12879 WP_000009017.1.12936 WP_000009017.1.12995 WP_000009017.1.13027 WP_000009017.1.13106 WP_000009017.1.13130 WP_000009017.1.13207 WP_000009017.1.13334 WP_000009017.1.13488 WP_000009017.1.13509 WP_000009017.1.13661 WP_000009017.1.13669 WP_000009017.1.13741 WP_000009017.1.1387 WP_000009017.1.13908 WP_000009017.1.13932 WP_000009017.1.13968 WP_000009017.1.14001 WP_000009017.1.14111 WP_000009017.1.14151 WP_000009017.1.14239 WP_000009017.1.14320 WP_000009017.1.14379 WP_000009017.1.14406 WP_000009017.1.14410 WP_000009017.1.14436 WP_000009017.1.14458 WP_000009017.1.14466 WP_000009017.1.14524 WP_000009017.1.14554 WP_000009017.1.14618 WP_000009017.1.14725 WP_000009017.1.14852 WP_000009017.1.14932 WP_000009017.1.15055 WP_000009017.1.15079 WP_000009017.1.15124 WP_000009017.1.15223 WP_000009017.1.15226 WP_000009017.1.15316 WP_000009017.1.15369 WP_000009017.1.1540 WP_000009017.1.15508 WP_000009017.1.15784 WP_000009017.1.15830 WP_000009017.1.15862 WP_000009017.1.15909 WP_000009017.1.15910 WP_000009017.1.15986 WP_000009017.1.16004 WP_000009017.1.16047 WP_000009017.1.16063 WP_000009017.1.16103 WP_000009017.1.16233 WP_000009017.1.16284 WP_000009017.1.16328 WP_000009017.1.1635 WP_000009017.1.16361 WP_000009017.1.16468 WP_000009017.1.16525 WP_000009017.1.16614 WP_000009017.1.16650 WP_000009017.1.16686 WP_000009017.1.16691 WP_000009017.1.167 WP_000009017.1.16732 WP_000009017.1.16735 WP_000009017.1.16786 WP_000009017.1.16858 WP_000009017.1.16873 WP_000009017.1.16896 WP_000009017.1.16903 WP_000009017.1.16916 WP_000009017.1.16965 WP_000009017.1.1700 WP_000009017.1.17093 WP_000009017.1.17307 WP_000009017.1.174 WP_000009017.1.17480 WP_000009017.1.17546 WP_000009017.1.17702 WP_000009017.1.17705 WP_000009017.1.17743 WP_000009017.1.17747 WP_000009017.1.17891 WP_000009017.1.18019 WP_000009017.1.18111 WP_000009017.1.18122 WP_000009017.1.18163 WP_000009017.1.1818 WP_000009017.1.18254 WP_000009017.1.18265 WP_000009017.1.18468 WP_000009017.1.18607 WP_000009017.1.18705 WP_000009017.1.18715 WP_000009017.1.18776 WP_000009017.1.18822 WP_000009017.1.18881 WP_000009017.1.18940 WP_000009017.1.18949 WP_000009017.1.19053 WP_000009017.1.19273 WP_000009017.1.19320 WP_000009017.1.19458 WP_000009017.1.19460 WP_000009017.1.19461 WP_000009017.1.19588 WP_000009017.1.19614 WP_000009017.1.19642 WP_000009017.1.19702 WP_000009017.1.19706 WP_000009017.1.19724 WP_000009017.1.19749 WP_000009017.1.19784 WP_000009017.1.19793 WP_000009017.1.19802 WP_000009017.1.19809 WP_000009017.1.19867 WP_000009017.1.19975 WP_000009017.1.1998 WP_000009017.1.20 WP_000009017.1.2010 WP_000009017.1.20212 WP_000009017.1.20266 WP_000009017.1.20271 WP_000009017.1.20330 WP_000009017.1.20362 WP_000009017.1.20418 WP_000009017.1.20443 WP_000009017.1.20446 WP_000009017.1.20525 WP_000009017.1.2054 WP_000009017.1.20553 WP_000009017.1.20614 WP_000009017.1.20626 WP_000009017.1.20646 WP_000009017.1.20886 WP_000009017.1.20908 WP_000009017.1.21049 WP_000009017.1.21136 WP_000009017.1.21146 WP_000009017.1.21245 WP_000009017.1.21246 WP_000009017.1.21269 WP_000009017.1.21351 WP_000009017.1.21400 WP_000009017.1.21497 WP_000009017.1.21499 WP_000009017.1.21548 WP_000009017.1.21603 WP_000009017.1.21751 WP_000009017.1.21991 WP_000009017.1.22024 WP_000009017.1.2205 WP_000009017.1.22062 WP_000009017.1.22067 WP_000009017.1.2221 WP_000009017.1.22235 WP_000009017.1.2235 WP_000009017.1.22379 WP_000009017.1.22427 WP_000009017.1.2246 WP_000009017.1.22485 WP_000009017.1.22537 WP_000009017.1.22692 WP_000009017.1.22758 WP_000009017.1.22864 WP_000009017.1.22870 WP_000009017.1.22979 WP_000009017.1.23102 WP_000009017.1.23114 WP_000009017.1.2314 WP_000009017.1.23192 WP_000009017.1.23259 WP_000009017.1.23379 WP_000009017.1.23460 WP_000009017.1.23482 WP_000009017.1.23509 WP_000009017.1.23634 WP_000009017.1.2364 WP_000009017.1.23932 WP_000009017.1.23959 WP_000009017.1.24082 WP_000009017.1.24308 WP_000009017.1.24578 WP_000009017.1.24737 WP_000009017.1.24779 WP_000009017.1.25008 WP_000009017.1.25015 WP_000009017.1.25119 WP_000009017.1.25206 WP_000009017.1.25405 WP_000009017.1.25454 WP_000009017.1.25493 WP_000009017.1.25668 WP_000009017.1.25690 WP_000009017.1.2570 WP_000009017.1.25740 WP_000009017.1.25793 WP_000009017.1.25814 WP_000009017.1.25988 WP_000009017.1.26282 WP_000009017.1.26311 WP_000009017.1.26319 WP_000009017.1.26429 WP_000009017.1.26440 WP_000009017.1.26493 WP_000009017.1.26551 WP_000009017.1.26567 WP_000009017.1.26741 WP_000009017.1.26919 WP_000009017.1.26980 WP_000009017.1.27010 WP_000009017.1.27084 WP_000009017.1.27173 WP_000009017.1.27206 WP_000009017.1.27223 WP_000009017.1.27423 WP_000009017.1.27544 WP_000009017.1.27561 WP_000009017.1.2763 WP_000009017.1.27665 WP_000009017.1.27707 WP_000009017.1.27761 WP_000009017.1.2777 WP_000009017.1.27857 WP_000009017.1.27977 WP_000009017.1.28032 WP_000009017.1.28094 WP_000009017.1.28126 WP_000009017.1.28170 WP_000009017.1.28302 WP_000009017.1.2835 WP_000009017.1.28370 WP_000009017.1.28538 WP_000009017.1.28575 WP_000009017.1.28625 WP_000009017.1.28655 WP_000009017.1.28694 WP_000009017.1.2879 WP_000009017.1.2890 WP_000009017.1.28938 WP_000009017.1.28946 WP_000009017.1.29010 WP_000009017.1.2910 WP_000009017.1.29113 WP_000009017.1.29509 WP_000009017.1.29588 WP_000009017.1.29601 WP_000009017.1.29606 WP_000009017.1.29615 WP_000009017.1.29619 WP_000009017.1.29704 WP_000009017.1.29827 WP_000009017.1.29969 WP_000009017.1.29990 WP_000009017.1.30006 WP_000009017.1.30022 WP_000009017.1.30027 WP_000009017.1.30180 WP_000009017.1.30202 WP_000009017.1.30469 WP_000009017.1.30505 WP_000009017.1.30507 WP_000009017.1.30535 WP_000009017.1.30547 WP_000009017.1.30794 WP_000009017.1.30833 WP_000009017.1.30835 WP_000009017.1.30972 WP_000009017.1.31 WP_000009017.1.31092 WP_000009017.1.31122 WP_000009017.1.31185 WP_000009017.1.3119 WP_000009017.1.31190 WP_000009017.1.31196 WP_000009017.1.31219 WP_000009017.1.31281 WP_000009017.1.31362 WP_000009017.1.31451 WP_000009017.1.31504 WP_000009017.1.31515 WP_000009017.1.31578 WP_000009017.1.31658 WP_000009017.1.31940 WP_000009017.1.31967 WP_000009017.1.31972 WP_000009017.1.32192 WP_000009017.1.32206 WP_000009017.1.32260 WP_000009017.1.32438 WP_000009017.1.32515 WP_000009017.1.32527 WP_000009017.1.32660 WP_000009017.1.32702 WP_000009017.1.32714 WP_000009017.1.32786 WP_000009017.1.32804 WP_000009017.1.32860 WP_000009017.1.33030 WP_000009017.1.33127 WP_000009017.1.33143 WP_000009017.1.33248 WP_000009017.1.33261 WP_000009017.1.333 WP_000009017.1.33492 WP_000009017.1.33553 WP_000009017.1.33580 WP_000009017.1.33592 WP_000009017.1.33825 WP_000009017.1.33894 WP_000009017.1.3394 WP_000009017.1.34043 WP_000009017.1.34075 WP_000009017.1.34257 WP_000009017.1.34279 WP_000009017.1.34319 WP_000009017.1.34417 WP_000009017.1.34453 WP_000009017.1.34610 WP_000009017.1.34856 WP_000009017.1.34975 WP_000009017.1.34977 WP_000009017.1.35045 WP_000009017.1.35129 WP_000009017.1.35184 WP_000009017.1.35193 WP_000009017.1.35404 WP_000009017.1.35408 WP_000009017.1.35425 WP_000009017.1.35429 WP_000009017.1.35446 WP_000009017.1.35463 WP_000009017.1.35503 WP_000009017.1.35509 WP_000009017.1.35590 WP_000009017.1.35892 WP_000009017.1.35940 WP_000009017.1.36003 WP_000009017.1.3601 WP_000009017.1.36017 WP_000009017.1.36547 WP_000009017.1.36609 WP_000009017.1.36690 WP_000009017.1.3670 WP_000009017.1.36705 WP_000009017.1.36918 WP_000009017.1.36931 WP_000009017.1.37063 WP_000009017.1.37073 WP_000009017.1.37111 WP_000009017.1.37112 WP_000009017.1.37293 WP_000009017.1.37370 WP_000009017.1.37376 WP_000009017.1.3744 WP_000009017.1.37498 WP_000009017.1.37504 WP_000009017.1.37618 WP_000009017.1.37687 WP_000009017.1.37968 WP_000009017.1.37978 WP_000009017.1.38125 WP_000009017.1.383 WP_000009017.1.38393 WP_000009017.1.3848 WP_000009017.1.38569 WP_000009017.1.38613 WP_000009017.1.38673 WP_000009017.1.3869 WP_000009017.1.38693 WP_000009017.1.38773 WP_000009017.1.38781 WP_000009017.1.38882 WP_000009017.1.38913 WP_000009017.1.39003 WP_000009017.1.39136 WP_000009017.1.39197 WP_000009017.1.39229 WP_000009017.1.39265 WP_000009017.1.39385 WP_000009017.1.39405 WP_000009017.1.39420 WP_000009017.1.39449 WP_000009017.1.39512 WP_000009017.1.39556 WP_000009017.1.39584 WP_000009017.1.39629 WP_000009017.1.39724 WP_000009017.1.39763 WP_000009017.1.39862 WP_000009017.1.39921 WP_000009017.1.39923 WP_000009017.1.40017 WP_000009017.1.40072 WP_000009017.1.40073 WP_000009017.1.4011 WP_000009017.1.40208 WP_000009017.1.40240 WP_000009017.1.40257 WP_000009017.1.40292 WP_000009017.1.40305 WP_000009017.1.40311 WP_000009017.1.40341 WP_000009017.1.40380 WP_000009017.1.40395 WP_000009017.1.40465 WP_000009017.1.40508 WP_000009017.1.40710 WP_000009017.1.4075 WP_000009017.1.4087 WP_000009017.1.40877 WP_000009017.1.40996 WP_000009017.1.41017 WP_000009017.1.41018 WP_000009017.1.41086 WP_000009017.1.41091 WP_000009017.1.41226 WP_000009017.1.41279 WP_000009017.1.41516 WP_000009017.1.41554 WP_000009017.1.41572 WP_000009017.1.41591 WP_000009017.1.41708 WP_000009017.1.41761 WP_000009017.1.41859 WP_000009017.1.41882 WP_000009017.1.41979 WP_000009017.1.41985 WP_000009017.1.42104 WP_000009017.1.42156 WP_000009017.1.4222 WP_000009017.1.42243 WP_000009017.1.42320 WP_000009017.1.42342 WP_000009017.1.42422 WP_000009017.1.42444 WP_000009017.1.42676 WP_000009017.1.4276 WP_000009017.1.42864 WP_000009017.1.43018 WP_000009017.1.43041 WP_000009017.1.43077 WP_000009017.1.43244 WP_000009017.1.43312 WP_000009017.1.43334 WP_000009017.1.43339 WP_000009017.1.43351 WP_000009017.1.43371 WP_000009017.1.43437 WP_000009017.1.43522 WP_000009017.1.43613 WP_000009017.1.43668 WP_000009017.1.43778 WP_000009017.1.43886 WP_000009017.1.43951 WP_000009017.1.44005 WP_000009017.1.44043 WP_000009017.1.44099 WP_000009017.1.44121 WP_000009017.1.44291 WP_000009017.1.44310 WP_000009017.1.44386 WP_000009017.1.44433 WP_000009017.1.44479 WP_000009017.1.44640 WP_000009017.1.4467 WP_000009017.1.44747 WP_000009017.1.4485 WP_000009017.1.44877 WP_000009017.1.44927 WP_000009017.1.44933 WP_000009017.1.44971 WP_000009017.1.45067 WP_000009017.1.45074 WP_000009017.1.45079 WP_000009017.1.45145 WP_000009017.1.45177 WP_000009017.1.45184 WP_000009017.1.45259 WP_000009017.1.45344 WP_000009017.1.45349 WP_000009017.1.45365 WP_000009017.1.45434 WP_000009017.1.45550 WP_000009017.1.45582 WP_000009017.1.45585 WP_000009017.1.45660 WP_000009017.1.45690 WP_000009017.1.45797 WP_000009017.1.458 WP_000009017.1.45848 WP_000009017.1.46011 WP_000009017.1.46069 WP_000009017.1.46112 WP_000009017.1.46173 WP_000009017.1.46174 WP_000009017.1.46187 WP_000009017.1.46278 WP_000009017.1.46303 WP_000009017.1.46434 WP_000009017.1.46595 WP_000009017.1.46675 WP_000009017.1.46930 WP_000009017.1.47008 WP_000009017.1.47057 WP_000009017.1.47214 WP_000009017.1.47429 WP_000009017.1.47448 WP_000009017.1.4747 WP_000009017.1.47472 WP_000009017.1.47478 WP_000009017.1.47579 WP_000009017.1.47621 WP_000009017.1.47799 WP_000009017.1.47928 WP_000009017.1.48242 WP_000009017.1.48253 WP_000009017.1.483 WP_000009017.1.48367 WP_000009017.1.48377 WP_000009017.1.4853 WP_000009017.1.48788 WP_000009017.1.4885 WP_000009017.1.48894 WP_000009017.1.48919 WP_000009017.1.49084 WP_000009017.1.49113 WP_000009017.1.49155 WP_000009017.1.49204 WP_000009017.1.49239 WP_000009017.1.49256 WP_000009017.1.49290 WP_000009017.1.49340 WP_000009017.1.49366 WP_000009017.1.49490 WP_000009017.1.49515 WP_000009017.1.49572 WP_000009017.1.49686 WP_000009017.1.4979 WP_000009017.1.49803 WP_000009017.1.49805 WP_000009017.1.49929 WP_000009017.1.50080 WP_000009017.1.50161 WP_000009017.1.50211 WP_000009017.1.50376 WP_000009017.1.50389 WP_000009017.1.50404 WP_000009017.1.50676 WP_000009017.1.50774 WP_000009017.1.50804 WP_000009017.1.50808 WP_000009017.1.5088 WP_000009017.1.50908 WP_000009017.1.50941 WP_000009017.1.50999 WP_000009017.1.51014 WP_000009017.1.51022 WP_000009017.1.51066 WP_000009017.1.51182 WP_000009017.1.51186 WP_000009017.1.51224 WP_000009017.1.51487 WP_000009017.1.51488 WP_000009017.1.51634 WP_000009017.1.51649 WP_000009017.1.51686 WP_000009017.1.51756 WP_000009017.1.51831 WP_000009017.1.51911 WP_000009017.1.51932 WP_000009017.1.51989 WP_000009017.1.52121 WP_000009017.1.52148 WP_000009017.1.52170 WP_000009017.1.52336 WP_000009017.1.52346 WP_000009017.1.52353 WP_000009017.1.52361 WP_000009017.1.52653 WP_000009017.1.52656 WP_000009017.1.52692 WP_000009017.1.52743 WP_000009017.1.52857 WP_000009017.1.52866 WP_000009017.1.52915 WP_000009017.1.52949 WP_000009017.1.53190 WP_000009017.1.53272 WP_000009017.1.53406 WP_000009017.1.53436 WP_000009017.1.53466 WP_000009017.1.53529 WP_000009017.1.53543 WP_000009017.1.53757 WP_000009017.1.53812 WP_000009017.1.53905 WP_000009017.1.54033 WP_000009017.1.54075 WP_000009017.1.54196 WP_000009017.1.542 WP_000009017.1.54209 WP_000009017.1.54271 WP_000009017.1.54273 WP_000009017.1.54274 WP_000009017.1.54319 WP_000009017.1.54364 WP_000009017.1.54400 WP_000009017.1.54526 WP_000009017.1.54662 WP_000009017.1.54722 WP_000009017.1.54749 WP_000009017.1.54764 WP_000009017.1.55008 WP_000009017.1.55152 WP_000009017.1.55156 WP_000009017.1.55285 WP_000009017.1.55325 WP_000009017.1.55430 WP_000009017.1.55475 WP_000009017.1.5560 WP_000009017.1.55647 WP_000009017.1.55743 WP_000009017.1.55768 WP_000009017.1.55782 WP_000009017.1.55796 WP_000009017.1.55973 WP_000009017.1.55993 WP_000009017.1.56002 WP_000009017.1.56012 WP_000009017.1.56105 WP_000009017.1.56238 WP_000009017.1.56244 WP_000009017.1.56286 WP_000009017.1.56304 WP_000009017.1.56414 WP_000009017.1.56438 WP_000009017.1.56559 WP_000009017.1.56560 WP_000009017.1.56597 WP_000009017.1.56601 WP_000009017.1.56614 WP_000009017.1.56660 WP_000009017.1.56671 WP_000009017.1.56682 WP_000009017.1.56877 WP_000009017.1.57168 WP_000009017.1.57187 WP_000009017.1.57232 WP_000009017.1.57356 WP_000009017.1.57377 WP_000009017.1.57418 WP_000009017.1.57433 WP_000009017.1.57515 WP_000009017.1.57529 WP_000009017.1.57576 WP_000009017.1.57601 WP_000009017.1.57607 WP_000009017.1.5774 WP_000009017.1.57763 WP_000009017.1.57862 WP_000009017.1.57890 WP_000009017.1.57891 WP_000009017.1.57978 WP_000009017.1.5801 WP_000009017.1.58041 WP_000009017.1.58358 WP_000009017.1.58407 WP_000009017.1.58418 WP_000009017.1.5854 WP_000009017.1.58548 WP_000009017.1.5858 WP_000009017.1.58662 WP_000009017.1.58669 WP_000009017.1.58745 WP_000009017.1.58803 WP_000009017.1.5886 WP_000009017.1.59094 WP_000009017.1.59224 WP_000009017.1.59321 WP_000009017.1.59375 WP_000009017.1.59420 WP_000009017.1.59458 WP_000009017.1.59490 WP_000009017.1.59508 WP_000009017.1.5953 WP_000009017.1.59684 WP_000009017.1.59694 WP_000009017.1.59771 WP_000009017.1.5979 WP_000009017.1.59953 WP_000009017.1.60008 WP_000009017.1.60021 WP_000009017.1.60052 WP_000009017.1.60069 WP_000009017.1.60140 WP_000009017.1.60155 WP_000009017.1.60285 WP_000009017.1.60379 WP_000009017.1.60464 WP_000009017.1.60545 WP_000009017.1.60561 WP_000009017.1.60772 WP_000009017.1.60874 WP_000009017.1.60941 WP_000009017.1.61078 WP_000009017.1.6114 WP_000009017.1.61232 WP_000009017.1.6129 WP_000009017.1.61296 WP_000009017.1.61345 WP_000009017.1.61417 WP_000009017.1.61574 WP_000009017.1.61609 WP_000009017.1.61712 WP_000009017.1.61714 WP_000009017.1.61730 WP_000009017.1.61857 WP_000009017.1.61918 WP_000009017.1.61952 WP_000009017.1.62007 WP_000009017.1.62020 WP_000009017.1.62025 WP_000009017.1.6209 WP_000009017.1.62204 WP_000009017.1.62257 WP_000009017.1.62304 WP_000009017.1.62364 WP_000009017.1.62374 WP_000009017.1.62403 WP_000009017.1.6253 WP_000009017.1.62570 WP_000009017.1.62853 WP_000009017.1.62903 WP_000009017.1.62910 WP_000009017.1.62955 WP_000009017.1.63063 WP_000009017.1.63181 WP_000009017.1.63203 WP_000009017.1.63256 WP_000009017.1.63290 WP_000009017.1.63382 WP_000009017.1.63432 WP_000009017.1.63461 WP_000009017.1.63479 WP_000009017.1.63577 WP_000009017.1.63718 WP_000009017.1.6375 WP_000009017.1.63757 WP_000009017.1.63797 WP_000009017.1.63834 WP_000009017.1.64018 WP_000009017.1.64046 WP_000009017.1.6423 WP_000009017.1.64244 WP_000009017.1.64387 WP_000009017.1.64403 WP_000009017.1.64649 WP_000009017.1.64702 WP_000009017.1.64757 WP_000009017.1.64781 WP_000009017.1.64831 WP_000009017.1.6489 WP_000009017.1.64894 WP_000009017.1.65018 WP_000009017.1.65028 WP_000009017.1.65171 WP_000009017.1.65248 WP_000009017.1.65269 WP_000009017.1.6535 WP_000009017.1.65474 WP_000009017.1.65572 WP_000009017.1.65633 WP_000009017.1.6565 WP_000009017.1.65696 WP_000009017.1.6575 WP_000009017.1.65782 WP_000009017.1.65940 WP_000009017.1.65956 WP_000009017.1.66049 WP_000009017.1.6630 WP_000009017.1.66314 WP_000009017.1.66330 WP_000009017.1.66358 WP_000009017.1.66362 WP_000009017.1.6638 WP_000009017.1.6640 WP_000009017.1.66600 WP_000009017.1.66678 WP_000009017.1.66698 WP_000009017.1.6680 WP_000009017.1.66834 WP_000009017.1.66901 WP_000009017.1.66962 WP_000009017.1.67037 WP_000009017.1.67045 WP_000009017.1.67100 WP_000009017.1.67181 WP_000009017.1.67235 WP_000009017.1.67268 WP_000009017.1.67347 WP_000009017.1.6739 WP_000009017.1.67465 WP_000009017.1.67552 WP_000009017.1.67682 WP_000009017.1.67829 WP_000009017.1.67887 WP_000009017.1.68073 WP_000009017.1.68201 WP_000009017.1.68206 WP_000009017.1.6827 WP_000009017.1.68275 WP_000009017.1.68401 WP_000009017.1.68477 WP_000009017.1.6849 WP_000009017.1.68547 WP_000009017.1.68589 WP_000009017.1.68655 WP_000009017.1.68778 WP_000009017.1.68787 WP_000009017.1.68894 WP_000009017.1.68928 WP_000009017.1.68975 WP_000009017.1.69001 WP_000009017.1.69006 WP_000009017.1.6904 WP_000009017.1.6913 WP_000009017.1.69146 WP_000009017.1.69151 WP_000009017.1.69255 WP_000009017.1.69359 WP_000009017.1.69397 WP_000009017.1.6954 WP_000009017.1.69564 WP_000009017.1.69644 WP_000009017.1.69704 WP_000009017.1.69754 WP_000009017.1.69758 WP_000009017.1.7021 WP_000009017.1.70241 WP_000009017.1.70269 WP_000009017.1.70289 WP_000009017.1.70447 WP_000009017.1.70485 WP_000009017.1.70643 WP_000009017.1.70683 WP_000009017.1.70883 WP_000009017.1.70922 WP_000009017.1.70948 WP_000009017.1.70959 WP_000009017.1.71023 WP_000009017.1.71116 WP_000009017.1.71146 WP_000009017.1.71165 WP_000009017.1.71188 WP_000009017.1.71202 WP_000009017.1.71243 WP_000009017.1.71306 WP_000009017.1.71363 WP_000009017.1.71378 WP_000009017.1.71401 WP_000009017.1.71481 WP_000009017.1.71636 WP_000009017.1.71691 WP_000009017.1.71702 WP_000009017.1.71750 WP_000009017.1.71798 WP_000009017.1.71845 WP_000009017.1.71881 WP_000009017.1.71908 WP_000009017.1.71952 WP_000009017.1.71973 WP_000009017.1.72105 WP_000009017.1.72203 WP_000009017.1.72372 WP_000009017.1.72376 WP_000009017.1.72403 WP_000009017.1.72594 WP_000009017.1.72728 WP_000009017.1.72975 WP_000009017.1.73062 WP_000009017.1.73125 WP_000009017.1.7315 WP_000009017.1.7334 WP_000009017.1.73377 WP_000009017.1.73461 WP_000009017.1.73481 WP_000009017.1.7356 WP_000009017.1.73561 WP_000009017.1.73581 WP_000009017.1.73617 WP_000009017.1.73667 WP_000009017.1.73753 WP_000009017.1.73758 WP_000009017.1.73794 WP_000009017.1.73847 WP_000009017.1.7387 WP_000009017.1.73924 WP_000009017.1.73926 WP_000009017.1.74029 WP_000009017.1.74181 WP_000009017.1.74191 WP_000009017.1.7433 WP_000009017.1.74379 WP_000009017.1.74410 WP_000009017.1.74466 WP_000009017.1.745 WP_000009017.1.74529 WP_000009017.1.74545 WP_000009017.1.74745 WP_000009017.1.7491 WP_000009017.1.75129 WP_000009017.1.75187 WP_000009017.1.75334 WP_000009017.1.75362 WP_000009017.1.75385 WP_000009017.1.75392 WP_000009017.1.75760 WP_000009017.1.75764 WP_000009017.1.75828 WP_000009017.1.75837 WP_000009017.1.75874 WP_000009017.1.75945 WP_000009017.1.76020 WP_000009017.1.76252 WP_000009017.1.76327 WP_000009017.1.76445 WP_000009017.1.7660 WP_000009017.1.76673 WP_000009017.1.76706 WP_000009017.1.76721 WP_000009017.1.76756 WP_000009017.1.76760 WP_000009017.1.76875 WP_000009017.1.76880 WP_000009017.1.76899 WP_000009017.1.77038 WP_000009017.1.77047 WP_000009017.1.7712 WP_000009017.1.77177 WP_000009017.1.77180 WP_000009017.1.77244 WP_000009017.1.77267 WP_000009017.1.77292 WP_000009017.1.77349 WP_000009017.1.77514 WP_000009017.1.77529 WP_000009017.1.77549 WP_000009017.1.77692 WP_000009017.1.77710 WP_000009017.1.77851 WP_000009017.1.77898 WP_000009017.1.77918 WP_000009017.1.77960 WP_000009017.1.78033 WP_000009017.1.78076 WP_000009017.1.78096 WP_000009017.1.78100 WP_000009017.1.78110 WP_000009017.1.78120 WP_000009017.1.78372 WP_000009017.1.78383 WP_000009017.1.78407 WP_000009017.1.78618 WP_000009017.1.78735 WP_000009017.1.78802 WP_000009017.1.78830 WP_000009017.1.78835 WP_000009017.1.78838 WP_000009017.1.78871 WP_000009017.1.78874 WP_000009017.1.78918 WP_000009017.1.78930 WP_000009017.1.79151 WP_000009017.1.79167 WP_000009017.1.79335 WP_000009017.1.79462 WP_000009017.1.79472 WP_000009017.1.79490 WP_000009017.1.79495 WP_000009017.1.79529 WP_000009017.1.79570 WP_000009017.1.7964 WP_000009017.1.79659 WP_000009017.1.79668 WP_000009017.1.79708 WP_000009017.1.79734 WP_000009017.1.80077 WP_000009017.1.80137 WP_000009017.1.80182 WP_000009017.1.80296 WP_000009017.1.80366 WP_000009017.1.80741 WP_000009017.1.80780 WP_000009017.1.80831 WP_000009017.1.80850 WP_000009017.1.80881 WP_000009017.1.8096 WP_000009017.1.81037 WP_000009017.1.81069 WP_000009017.1.81149 WP_000009017.1.81175 WP_000009017.1.8119 WP_000009017.1.81193 WP_000009017.1.81305 WP_000009017.1.81320 WP_000009017.1.81328 WP_000009017.1.81354 WP_000009017.1.81410 WP_000009017.1.81425 WP_000009017.1.81528 WP_000009017.1.81735 WP_000009017.1.81750 WP_000009017.1.81760 WP_000009017.1.81785 WP_000009017.1.81902 WP_000009017.1.82192 WP_000009017.1.82232 WP_000009017.1.82337 WP_000009017.1.82464 WP_000009017.1.82479 WP_000009017.1.82503 WP_000009017.1.82515 WP_000009017.1.82584 WP_000009017.1.82676 WP_000009017.1.82761 WP_000009017.1.8282 WP_000009017.1.82944 WP_000009017.1.82956 WP_000009017.1.83092 WP_000009017.1.83163 WP_000009017.1.83305 WP_000009017.1.83365 WP_000009017.1.83413 WP_000009017.1.83491 WP_000009017.1.83523 WP_000009017.1.8354 WP_000009017.1.83651 WP_000009017.1.83721 WP_000009017.1.83760 WP_000009017.1.83995 WP_000009017.1.84103 WP_000009017.1.84283 WP_000009017.1.84291 WP_000009017.1.84392 WP_000009017.1.84397 WP_000009017.1.8441 WP_000009017.1.84532 WP_000009017.1.84554 WP_000009017.1.84659 WP_000009017.1.84693 WP_000009017.1.84899 WP_000009017.1.8497 WP_000009017.1.85040 WP_000009017.1.85134 WP_000009017.1.85178 WP_000009017.1.85180 WP_000009017.1.85190 WP_000009017.1.8545 WP_000009017.1.85481 WP_000009017.1.85483 WP_000009017.1.85541 WP_000009017.1.8556 WP_000009017.1.85568 WP_000009017.1.85615 WP_000009017.1.85617 WP_000009017.1.85663 WP_000009017.1.85671 WP_000009017.1.85672 WP_000009017.1.85777 WP_000009017.1.85855 WP_000009017.1.85886 WP_000009017.1.85900 WP_000009017.1.85904 WP_000009017.1.85976 WP_000009017.1.86043 WP_000009017.1.86173 WP_000009017.1.86306 WP_000009017.1.86356 WP_000009017.1.86450 WP_000009017.1.86469 WP_000009017.1.86580 WP_000009017.1.86588 WP_000009017.1.86661 WP_000009017.1.8671 WP_000009017.1.8672 WP_000009017.1.8678 WP_000009017.1.86810 WP_000009017.1.86895 WP_000009017.1.86906 WP_000009017.1.87095 WP_000009017.1.87323 WP_000009017.1.8736 WP_000009017.1.87460 WP_000009017.1.87552 WP_000009017.1.87695 WP_000009017.1.87779 WP_000009017.1.87899 WP_000009017.1.8792 WP_000009017.1.87945 WP_000009017.1.88019 WP_000009017.1.88073 WP_000009017.1.8809 WP_000009017.1.88092 WP_000009017.1.88291 WP_000009017.1.88293 WP_000009017.1.8837 WP_000009017.1.88393 WP_000009017.1.88703 WP_000009017.1.88792 WP_000009017.1.88902 WP_000009017.1.8891 WP_000009017.1.88957 WP_000009017.1.88980 WP_000009017.1.88981 WP_000009017.1.89008 WP_000009017.1.89114 WP_000009017.1.89116 WP_000009017.1.89119 WP_000009017.1.89138 WP_000009017.1.89304 WP_000009017.1.89527 WP_000009017.1.89570 WP_000009017.1.89604 WP_000009017.1.89622 WP_000009017.1.89657 WP_000009017.1.89659 WP_000009017.1.89765 WP_000009017.1.89817 WP_000009017.1.89902 WP_000009017.1.8996 WP_000009017.1.90097 WP_000009017.1.90252 WP_000009017.1.90417 WP_000009017.1.90453 WP_000009017.1.90557 WP_000009017.1.90585 WP_000009017.1.90641 WP_000009017.1.90734 WP_000009017.1.91003 WP_000009017.1.91056 WP_000009017.1.91069 WP_000009017.1.91179 WP_000009017.1.91278 WP_000009017.1.9131 WP_000009017.1.91512 WP_000009017.1.91524 WP_000009017.1.91564 WP_000009017.1.91621 WP_000009017.1.91628 WP_000009017.1.91655 WP_000009017.1.91724 WP_000009017.1.91732 WP_000009017.1.91788 WP_000009017.1.92013 WP_000009017.1.92060 WP_000009017.1.92093 WP_000009017.1.92108 WP_000009017.1.92165 WP_000009017.1.92171 WP_000009017.1.92183 WP_000009017.1.92208 WP_000009017.1.92310 WP_000009017.1.92318 WP_000009017.1.92443 WP_000009017.1.92482 WP_000009017.1.92531 WP_000009017.1.92669 WP_000009017.1.92671 WP_000009017.1.92738 WP_000009017.1.92893 WP_000009017.1.93059 WP_000009017.1.93086 WP_000009017.1.93101 WP_000009017.1.93136 WP_000009017.1.93155 WP_000009017.1.93275 WP_000009017.1.93339 WP_000009017.1.93365 WP_000009017.1.93376 WP_000009017.1.93543 WP_000009017.1.93656 WP_000009017.1.93662 WP_000009017.1.937 WP_000009017.1.93705 WP_000009017.1.93804 WP_000009017.1.9389 WP_000009017.1.93937 WP_000009017.1.93994 WP_000009017.1.94072 WP_000009017.1.94162 WP_000009017.1.94168 WP_000009017.1.94198 WP_000009017.1.9432 WP_000009017.1.94354 WP_000009017.1.94380 WP_000009017.1.94565 WP_000009017.1.94584 WP_000009017.1.94655 WP_000009017.1.94674 WP_000009017.1.94796 WP_000009017.1.94959 WP_000009017.1.95051 WP_000009017.1.95085 WP_000009017.1.95121 WP_000009017.1.95248 WP_000009017.1.95277 WP_000009017.1.95282 WP_000009017.1.95388 WP_000009017.1.95546 WP_000009017.1.95630 WP_000009017.1.95670 WP_000009017.1.95691 WP_000009017.1.95911 WP_000009017.1.95939 WP_000009017.1.96004 WP_000009017.1.96139 WP_000009017.1.96162 WP_000009017.1.96317 WP_000009017.1.96343 WP_000009017.1.9644 WP_000009017.1.96469 WP_000009017.1.96497 WP_000009017.1.96500 WP_000009017.1.96555 WP_000009017.1.96563 WP_000009017.1.96732 WP_000009017.1.9674 WP_000009017.1.96771 WP_000009017.1.97015 WP_000009017.1.97047 WP_000009017.1.97143 WP_000009017.1.97145 WP_000009017.1.97190 WP_000009017.1.97297 WP_000009017.1.97318 WP_000009017.1.97369 WP_000009017.1.97477 WP_000009017.1.97487 WP_000009017.1.97597 WP_000009017.1.97613 WP_000009017.1.97620 WP_000009017.1.97631 WP_000009017.1.97727 WP_000009017.1.97732 WP_000009017.1.97736 WP_000009017.1.9775 WP_000009017.1.97846 WP_000009017.1.9799 WP_000009017.1.98006 WP_000009017.1.98019 WP_000009017.1.98022 WP_000009017.1.98110 WP_000009017.1.98146 WP_000009017.1.98170 WP_000009017.1.98219 WP_000009017.1.9826 WP_000009017.1.9841 WP_000009017.1.98495 WP_000009017.1.98531 WP_000009017.1.98577 WP_000009017.1.98676 WP_000009017.1.98677 WP_000009017.1.98760 WP_000009017.1.98843 WP_000009017.1.9898 WP_000009017.1.99072 WP_000009017.1.99098 WP_000009017.1.99184 WP_000009017.1.99267 WP_000009017.1.99276 WP_000009017.1.99626 WP_000009017.1.99646 WP_000009017.1.99657 WP_000009017.1.99660 WP_000009017.1.99712 WP_000009017.1.99813 WP_000009017.1.99858 WP_000009017.1.99889 WP_000009017.1.99958 gi|525829834|ref|YP_008253018.1| gi|379701308|ref|YP_005243036.1| gi|378984647|ref|YP_005247802.1| gi|16765414|ref|NP_461029.1| gi|383496794|ref|YP_005397483.1| gi|194451573|ref|YP_002046134.1| gi|378450760|ref|YP_005238119.1| gi|550901523|ref|YP_008670615.1| 454169.SeHA_C2310 99287.STM2084 APC24511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]