SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450782|ref|YP_005238141.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450782|ref|YP_005238141.1|
Domain Number 1 Region: 193-477
Classification Level Classification E-value
Superfamily RmlC-like cupins 3.56e-90
Family Germin/Seed storage 7S protein 0.064
Further Details:      
 
Domain Number 2 Region: 6-290
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.27e-73
Family mannose-1-phosphate guanylyl transferase 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450782|ref|YP_005238141.1|
Sequence length 478
Comment mannose-1-phosphate guanylyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPLVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAATRQHTDCDPLMLVLAADH
AIANEEAFRDAVRGAMPYADAGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQ
FVEKPGLETAQAYVASGDYYWNSGMFLFRAGRYLEELKKFRPDILAACEQAMRGVDPDLD
FIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDVGSWSSLWEISAHTPEGNVHH
GDVISHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRHAVQDVKKVVEKIKADGR
HEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRV
Download sequence
Identical sequences A0A0D6FG86 A0A0F6B3F5 A0A0F7J7Y8 A0A0H3ND41 A0A0T9W5Q0 A0A0W4BDE2 A0A2D3ADM5
99287.STM2105.S ABAO01000005|CDS_93723-92287 CP001363|CDS_2241489-2240053 gi|39546334|ref|NP_461050.2| gi|482903921|ref|YP_007902481.1| gi|383496814|ref|YP_005397503.1| gi|378700018|ref|YP_005181975.1| gi|378450782|ref|YP_005238141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]