SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450865|ref|YP_005238224.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450865|ref|YP_005238224.1|
Domain Number 1 Region: 10-343
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.55e-114
Family Gentisate 1,2-dioxygenase-like 0.0000000000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378450865|ref|YP_005238224.1|
Sequence length 345
Comment putative 1,2-dioxygenase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSEINQNVKDSRQQYYQHISGQNLTPLWESLHHLVPQTPNANCAPAYWNYQEIRPLLMES
GNVIGAKEAIRRVLVLENPALRGQSSITATLYAGLQLILPGEVAPSHRHNQSALRFIVEG
KGAFTAVDGERTPMHTGDFILTPQWRWHDHGNPGSEPVVWLDGLDLPLVNLLGCGFAEDY
PEDQQPVTRKEGDYLPRYAANMLPLRHQRGNSSPIFNYRYDRSREALHDLTRMGDPDEWE
GYKLRYVNPVTGGYPMPSMGAFLQLLPKGFASRVARSTDSTIYHVVEGAGQVTIGNETFH
FSAKDIFVAPTWHEVSFRSSEDTVLFSFSDKPVQEALGLFREARY
Download sequence
Identical sequences A0A0F6B3N8 A0A0F7J838 A0A0G2NQG8 A0A0H3NDI3 A0A0K6QED0 A0A0L5X6C1 A0A0M0PYW3 A0A0N1TV21 A0A0T9X9W0 A0A0U1JLY3 A0A1C3A1H2 A0A1S0Z753 A0A1S1APA2 A0A1X2RKW9 A0A1X2YBL1 A0A221YYB0 A0A265B6R5 A0A271CD27 A0A2C6G8Z2 A0A2D1XQ56 A0A2D1Y3Z7 A0A2D3ADU3 A0A2D3TUY9 A0A2G1P3R6 A0A2H9YIE4 A0A2I6MJQ9 A0A2I6MXT2 A0A2I6NPL2 A0A2I6P2E2 A0A2K2ZVE5 B5EYM9 B5RC18 E8XDL5 G4C0P7 G5LBH4 G5MKF3 G5NF65 G5PQ45 G5Q4T8 G5QLH2 G5R2B9 G5RHP3 G5RXN8 G5SE15 Q57MG0 Q83T65 Q8ZNM1 S5HIK3 V1WGV9 V7IMV7 V7V087
gi|549724843|ref|YP_008645033.1| gi|537436032|ref|YP_008480409.1| gi|525858212|ref|YP_008261473.1| gi|550901616|ref|YP_008670708.1| gi|525829755|ref|YP_008252925.1| gi|383496886|ref|YP_005397575.1| gi|205353314|ref|YP_002227115.1| gi|62180765|ref|YP_217182.1| gi|488653224|ref|YP_007925027.1| gi|378984740|ref|YP_005247895.1| gi|16765508|ref|NP_461123.1| gi|525946817|ref|YP_008308054.1| gi|378445613|ref|YP_005233245.1| gi|482903994|ref|YP_007902554.1| gi|378450865|ref|YP_005238224.1| gi|194451398|ref|YP_002046232.1| NP_461123.1.58477 WP_001289857.1.100002 WP_001289857.1.100007 WP_001289857.1.100008 WP_001289857.1.100010 WP_001289857.1.100031 WP_001289857.1.100036 WP_001289857.1.100079 WP_001289857.1.100115 WP_001289857.1.10013 WP_001289857.1.100137 WP_001289857.1.100165 WP_001289857.1.100196 WP_001289857.1.100234 WP_001289857.1.100258 WP_001289857.1.100266 WP_001289857.1.100284 WP_001289857.1.100288 WP_001289857.1.100313 WP_001289857.1.100314 WP_001289857.1.100321 WP_001289857.1.100354 WP_001289857.1.100376 WP_001289857.1.100413 WP_001289857.1.100421 WP_001289857.1.100424 WP_001289857.1.100432 WP_001289857.1.100436 WP_001289857.1.100438 WP_001289857.1.100446 WP_001289857.1.100450 WP_001289857.1.100472 WP_001289857.1.100484 WP_001289857.1.100488 WP_001289857.1.100521 WP_001289857.1.100541 WP_001289857.1.100584 WP_001289857.1.100589 WP_001289857.1.100592 WP_001289857.1.100597 WP_001289857.1.100610 WP_001289857.1.100650 WP_001289857.1.100714 WP_001289857.1.100721 WP_001289857.1.100730 WP_001289857.1.100732 WP_001289857.1.100733 WP_001289857.1.100739 WP_001289857.1.10074 WP_001289857.1.100750 WP_001289857.1.10076 WP_001289857.1.100764 WP_001289857.1.100773 WP_001289857.1.100781 WP_001289857.1.100790 WP_001289857.1.100793 WP_001289857.1.100799 WP_001289857.1.100865 WP_001289857.1.100869 WP_001289857.1.100870 WP_001289857.1.100882 WP_001289857.1.100886 WP_001289857.1.100932 WP_001289857.1.100941 WP_001289857.1.100944 WP_001289857.1.100948 WP_001289857.1.100953 WP_001289857.1.101007 WP_001289857.1.101011 WP_001289857.1.101020 WP_001289857.1.101074 WP_001289857.1.101078 WP_001289857.1.10108 WP_001289857.1.101091 WP_001289857.1.101123 WP_001289857.1.101147 WP_001289857.1.101180 WP_001289857.1.101199 WP_001289857.1.101223 WP_001289857.1.101226 WP_001289857.1.10124 WP_001289857.1.101259 WP_001289857.1.101271 WP_001289857.1.101284 WP_001289857.1.101291 WP_001289857.1.1013 WP_001289857.1.101312 WP_001289857.1.101320 WP_001289857.1.101322 WP_001289857.1.101353 WP_001289857.1.101374 WP_001289857.1.101386 WP_001289857.1.101404 WP_001289857.1.101420 WP_001289857.1.101425 WP_001289857.1.101454 WP_001289857.1.101519 WP_001289857.1.101520 WP_001289857.1.101589 WP_001289857.1.101612 WP_001289857.1.101616 WP_001289857.1.101636 WP_001289857.1.101666 WP_001289857.1.101707 WP_001289857.1.101734 WP_001289857.1.101740 WP_001289857.1.101741 WP_001289857.1.101759 WP_001289857.1.101776 WP_001289857.1.101815 WP_001289857.1.101839 WP_001289857.1.101878 WP_001289857.1.101890 WP_001289857.1.101941 WP_001289857.1.101949 WP_001289857.1.101953 WP_001289857.1.101975 WP_001289857.1.102009 WP_001289857.1.102050 WP_001289857.1.102087 WP_001289857.1.102103 WP_001289857.1.10220 WP_001289857.1.10231 WP_001289857.1.10237 WP_001289857.1.10266 WP_001289857.1.10276 WP_001289857.1.10338 WP_001289857.1.1038 WP_001289857.1.10394 WP_001289857.1.104 WP_001289857.1.10401 WP_001289857.1.10428 WP_001289857.1.10429 WP_001289857.1.10439 WP_001289857.1.10459 WP_001289857.1.10463 WP_001289857.1.10475 WP_001289857.1.10507 WP_001289857.1.10511 WP_001289857.1.10514 WP_001289857.1.10530 WP_001289857.1.10532 WP_001289857.1.10547 WP_001289857.1.10562 WP_001289857.1.10566 WP_001289857.1.10595 WP_001289857.1.10642 WP_001289857.1.10654 WP_001289857.1.10677 WP_001289857.1.10678 WP_001289857.1.10711 WP_001289857.1.10720 WP_001289857.1.10753 WP_001289857.1.10797 WP_001289857.1.10857 WP_001289857.1.10873 WP_001289857.1.10926 WP_001289857.1.10936 WP_001289857.1.10992 WP_001289857.1.11000 WP_001289857.1.11012 WP_001289857.1.11024 WP_001289857.1.11031 WP_001289857.1.11041 WP_001289857.1.11055 WP_001289857.1.11098 WP_001289857.1.1110 WP_001289857.1.11126 WP_001289857.1.11142 WP_001289857.1.11156 WP_001289857.1.11168 WP_001289857.1.11190 WP_001289857.1.11239 WP_001289857.1.11253 WP_001289857.1.11254 WP_001289857.1.11295 WP_001289857.1.113 WP_001289857.1.11304 WP_001289857.1.11314 WP_001289857.1.11362 WP_001289857.1.11369 WP_001289857.1.11385 WP_001289857.1.11405 WP_001289857.1.1142 WP_001289857.1.11426 WP_001289857.1.11429 WP_001289857.1.11455 WP_001289857.1.11458 WP_001289857.1.11479 WP_001289857.1.11518 WP_001289857.1.11532 WP_001289857.1.11544 WP_001289857.1.11557 WP_001289857.1.11565 WP_001289857.1.11567 WP_001289857.1.11588 WP_001289857.1.11603 WP_001289857.1.11621 WP_001289857.1.11638 WP_001289857.1.11677 WP_001289857.1.11681 WP_001289857.1.11687 WP_001289857.1.11735 WP_001289857.1.11763 WP_001289857.1.11772 WP_001289857.1.11834 WP_001289857.1.11865 WP_001289857.1.11868 WP_001289857.1.11875 WP_001289857.1.11883 WP_001289857.1.11897 WP_001289857.1.11908 WP_001289857.1.11914 WP_001289857.1.11936 WP_001289857.1.11938 WP_001289857.1.11964 WP_001289857.1.12007 WP_001289857.1.12017 WP_001289857.1.12025 WP_001289857.1.12040 WP_001289857.1.12059 WP_001289857.1.12061 WP_001289857.1.12063 WP_001289857.1.1207 WP_001289857.1.12114 WP_001289857.1.12141 WP_001289857.1.12144 WP_001289857.1.12159 WP_001289857.1.12160 WP_001289857.1.12172 WP_001289857.1.12192 WP_001289857.1.1224 WP_001289857.1.12244 WP_001289857.1.12280 WP_001289857.1.12282 WP_001289857.1.12351 WP_001289857.1.12364 WP_001289857.1.12370 WP_001289857.1.12397 WP_001289857.1.12398 WP_001289857.1.12441 WP_001289857.1.12456 WP_001289857.1.12472 WP_001289857.1.12546 WP_001289857.1.12581 WP_001289857.1.12584 WP_001289857.1.12620 WP_001289857.1.1264 WP_001289857.1.12648 WP_001289857.1.12650 WP_001289857.1.12683 WP_001289857.1.12701 WP_001289857.1.12726 WP_001289857.1.12727 WP_001289857.1.12728 WP_001289857.1.12741 WP_001289857.1.12864 WP_001289857.1.12877 WP_001289857.1.12879 WP_001289857.1.12936 WP_001289857.1.1299 WP_001289857.1.12995 WP_001289857.1.13027 WP_001289857.1.13101 WP_001289857.1.13108 WP_001289857.1.13130 WP_001289857.1.13161 WP_001289857.1.13207 WP_001289857.1.1321 WP_001289857.1.13268 WP_001289857.1.13291 WP_001289857.1.133 WP_001289857.1.13311 WP_001289857.1.13314 WP_001289857.1.13334 WP_001289857.1.13338 WP_001289857.1.13342 WP_001289857.1.13352 WP_001289857.1.13406 WP_001289857.1.13414 WP_001289857.1.13440 WP_001289857.1.13443 WP_001289857.1.13446 WP_001289857.1.13476 WP_001289857.1.13488 WP_001289857.1.13509 WP_001289857.1.13543 WP_001289857.1.13599 WP_001289857.1.13661 WP_001289857.1.13669 WP_001289857.1.13686 WP_001289857.1.13732 WP_001289857.1.13741 WP_001289857.1.13764 WP_001289857.1.13819 WP_001289857.1.1382 WP_001289857.1.13827 WP_001289857.1.13829 WP_001289857.1.13848 WP_001289857.1.13857 WP_001289857.1.1387 WP_001289857.1.13908 WP_001289857.1.13932 WP_001289857.1.13968 WP_001289857.1.13972 WP_001289857.1.140 WP_001289857.1.14001 WP_001289857.1.1401 WP_001289857.1.14011 WP_001289857.1.14041 WP_001289857.1.14050 WP_001289857.1.14056 WP_001289857.1.1408 WP_001289857.1.14099 WP_001289857.1.14111 WP_001289857.1.14120 WP_001289857.1.14123 WP_001289857.1.14150 WP_001289857.1.14151 WP_001289857.1.14197 WP_001289857.1.14212 WP_001289857.1.14239 WP_001289857.1.14280 WP_001289857.1.14286 WP_001289857.1.14296 WP_001289857.1.14320 WP_001289857.1.14333 WP_001289857.1.14369 WP_001289857.1.14379 WP_001289857.1.14399 WP_001289857.1.1440 WP_001289857.1.14406 WP_001289857.1.14410 WP_001289857.1.14436 WP_001289857.1.14444 WP_001289857.1.14446 WP_001289857.1.14458 WP_001289857.1.14466 WP_001289857.1.14467 WP_001289857.1.14474 WP_001289857.1.14495 WP_001289857.1.14505 WP_001289857.1.14516 WP_001289857.1.14519 WP_001289857.1.14524 WP_001289857.1.14526 WP_001289857.1.14528 WP_001289857.1.14550 WP_001289857.1.14554 WP_001289857.1.14575 WP_001289857.1.14618 WP_001289857.1.14701 WP_001289857.1.14703 WP_001289857.1.14706 WP_001289857.1.14719 WP_001289857.1.14725 WP_001289857.1.1473 WP_001289857.1.14737 WP_001289857.1.14765 WP_001289857.1.14789 WP_001289857.1.14808 WP_001289857.1.14810 WP_001289857.1.14852 WP_001289857.1.14876 WP_001289857.1.14877 WP_001289857.1.14884 WP_001289857.1.1489 WP_001289857.1.14894 WP_001289857.1.14927 WP_001289857.1.14930 WP_001289857.1.14932 WP_001289857.1.14936 WP_001289857.1.14947 WP_001289857.1.14948 WP_001289857.1.14964 WP_001289857.1.15046 WP_001289857.1.15054 WP_001289857.1.15055 WP_001289857.1.15079 WP_001289857.1.15102 WP_001289857.1.15124 WP_001289857.1.15223 WP_001289857.1.15226 WP_001289857.1.15244 WP_001289857.1.15265 WP_001289857.1.15316 WP_001289857.1.15362 WP_001289857.1.15369 WP_001289857.1.1540 WP_001289857.1.15415 WP_001289857.1.15423 WP_001289857.1.15433 WP_001289857.1.15439 WP_001289857.1.15468 WP_001289857.1.15479 WP_001289857.1.15487 WP_001289857.1.15508 WP_001289857.1.1551 WP_001289857.1.15535 WP_001289857.1.15581 WP_001289857.1.15586 WP_001289857.1.15597 WP_001289857.1.15612 WP_001289857.1.15616 WP_001289857.1.15627 WP_001289857.1.15644 WP_001289857.1.15710 WP_001289857.1.15717 WP_001289857.1.15784 WP_001289857.1.15795 WP_001289857.1.158 WP_001289857.1.15830 WP_001289857.1.15835 WP_001289857.1.15862 WP_001289857.1.15881 WP_001289857.1.15905 WP_001289857.1.15909 WP_001289857.1.15910 WP_001289857.1.15912 WP_001289857.1.1592 WP_001289857.1.15922 WP_001289857.1.15970 WP_001289857.1.15978 WP_001289857.1.15986 WP_001289857.1.15995 WP_001289857.1.16000 WP_001289857.1.16004 WP_001289857.1.16006 WP_001289857.1.16028 WP_001289857.1.16046 WP_001289857.1.16047 WP_001289857.1.16051 WP_001289857.1.16052 WP_001289857.1.16058 WP_001289857.1.16062 WP_001289857.1.16063 WP_001289857.1.16103 WP_001289857.1.1611 WP_001289857.1.16150 WP_001289857.1.16155 WP_001289857.1.16158 WP_001289857.1.16166 WP_001289857.1.16172 WP_001289857.1.16201 WP_001289857.1.16226 WP_001289857.1.16233 WP_001289857.1.1626 WP_001289857.1.16264 WP_001289857.1.16273 WP_001289857.1.16284 WP_001289857.1.16328 WP_001289857.1.16344 WP_001289857.1.1635 WP_001289857.1.16361 WP_001289857.1.16462 WP_001289857.1.16465 WP_001289857.1.16468 WP_001289857.1.16522 WP_001289857.1.16525 WP_001289857.1.16551 WP_001289857.1.16565 WP_001289857.1.16581 WP_001289857.1.16588 WP_001289857.1.16614 WP_001289857.1.16650 WP_001289857.1.16656 WP_001289857.1.16658 WP_001289857.1.16666 WP_001289857.1.16673 WP_001289857.1.16686 WP_001289857.1.16691 WP_001289857.1.167 WP_001289857.1.16732 WP_001289857.1.16735 WP_001289857.1.16736 WP_001289857.1.1674 WP_001289857.1.16767 WP_001289857.1.16781 WP_001289857.1.16786 WP_001289857.1.16804 WP_001289857.1.16817 WP_001289857.1.16819 WP_001289857.1.16846 WP_001289857.1.16858 WP_001289857.1.16873 WP_001289857.1.16879 WP_001289857.1.1689 WP_001289857.1.16893 WP_001289857.1.16896 WP_001289857.1.16903 WP_001289857.1.16905 WP_001289857.1.16916 WP_001289857.1.16942 WP_001289857.1.16944 WP_001289857.1.16948 WP_001289857.1.16965 WP_001289857.1.16998 WP_001289857.1.1700 WP_001289857.1.17031 WP_001289857.1.17049 WP_001289857.1.17058 WP_001289857.1.17078 WP_001289857.1.17093 WP_001289857.1.17096 WP_001289857.1.17098 WP_001289857.1.17188 WP_001289857.1.17202 WP_001289857.1.17219 WP_001289857.1.1722 WP_001289857.1.17270 WP_001289857.1.17302 WP_001289857.1.17307 WP_001289857.1.17308 WP_001289857.1.17368 WP_001289857.1.1737 WP_001289857.1.17390 WP_001289857.1.174 WP_001289857.1.17406 WP_001289857.1.17480 WP_001289857.1.1749 WP_001289857.1.17504 WP_001289857.1.17513 WP_001289857.1.17543 WP_001289857.1.17546 WP_001289857.1.17560 WP_001289857.1.17563 WP_001289857.1.1757 WP_001289857.1.17578 WP_001289857.1.17622 WP_001289857.1.17629 WP_001289857.1.17659 WP_001289857.1.17667 WP_001289857.1.17686 WP_001289857.1.17693 WP_001289857.1.17702 WP_001289857.1.17705 WP_001289857.1.17741 WP_001289857.1.17743 WP_001289857.1.17747 WP_001289857.1.17755 WP_001289857.1.17758 WP_001289857.1.17840 WP_001289857.1.17865 WP_001289857.1.17891 WP_001289857.1.17949 WP_001289857.1.17956 WP_001289857.1.1798 WP_001289857.1.18005 WP_001289857.1.1801 WP_001289857.1.18019 WP_001289857.1.18021 WP_001289857.1.18022 WP_001289857.1.1807 WP_001289857.1.18089 WP_001289857.1.18099 WP_001289857.1.18103 WP_001289857.1.18111 WP_001289857.1.18122 WP_001289857.1.18124 WP_001289857.1.1814 WP_001289857.1.18144 WP_001289857.1.18163 WP_001289857.1.18173 WP_001289857.1.18177 WP_001289857.1.18178 WP_001289857.1.1818 WP_001289857.1.18192 WP_001289857.1.18249 WP_001289857.1.1825 WP_001289857.1.18254 WP_001289857.1.18265 WP_001289857.1.18267 WP_001289857.1.18270 WP_001289857.1.18277 WP_001289857.1.18280 WP_001289857.1.18282 WP_001289857.1.18328 WP_001289857.1.18358 WP_001289857.1.18370 WP_001289857.1.18406 WP_001289857.1.18441 WP_001289857.1.18445 WP_001289857.1.18468 WP_001289857.1.18474 WP_001289857.1.18489 WP_001289857.1.18513 WP_001289857.1.18607 WP_001289857.1.18610 WP_001289857.1.18678 WP_001289857.1.18705 WP_001289857.1.18715 WP_001289857.1.18722 WP_001289857.1.18766 WP_001289857.1.18776 WP_001289857.1.1880 WP_001289857.1.18822 WP_001289857.1.1885 WP_001289857.1.18860 WP_001289857.1.18881 WP_001289857.1.18895 WP_001289857.1.18919 WP_001289857.1.18922 WP_001289857.1.18940 WP_001289857.1.18949 WP_001289857.1.18959 WP_001289857.1.18972 WP_001289857.1.19001 WP_001289857.1.19006 WP_001289857.1.19038 WP_001289857.1.19044 WP_001289857.1.19053 WP_001289857.1.19055 WP_001289857.1.19064 WP_001289857.1.19084 WP_001289857.1.19163 WP_001289857.1.19174 WP_001289857.1.19187 WP_001289857.1.19228 WP_001289857.1.19240 WP_001289857.1.19273 WP_001289857.1.19288 WP_001289857.1.19291 WP_001289857.1.19300 WP_001289857.1.19320 WP_001289857.1.19340 WP_001289857.1.1939 WP_001289857.1.19405 WP_001289857.1.19422 WP_001289857.1.19454 WP_001289857.1.19456 WP_001289857.1.19458 WP_001289857.1.19460 WP_001289857.1.19461 WP_001289857.1.19469 WP_001289857.1.19496 WP_001289857.1.19535 WP_001289857.1.19538 WP_001289857.1.1954 WP_001289857.1.19588 WP_001289857.1.19589 WP_001289857.1.19614 WP_001289857.1.19616 WP_001289857.1.19642 WP_001289857.1.19660 WP_001289857.1.19663 WP_001289857.1.1968 WP_001289857.1.19683 WP_001289857.1.19686 WP_001289857.1.19702 WP_001289857.1.19706 WP_001289857.1.19723 WP_001289857.1.19724 WP_001289857.1.19731 WP_001289857.1.19740 WP_001289857.1.19749 WP_001289857.1.19784 WP_001289857.1.19793 WP_001289857.1.19794 WP_001289857.1.19802 WP_001289857.1.19823 WP_001289857.1.19851 WP_001289857.1.19863 WP_001289857.1.19867 WP_001289857.1.19884 WP_001289857.1.1992 WP_001289857.1.19938 WP_001289857.1.19967 WP_001289857.1.19970 WP_001289857.1.19975 WP_001289857.1.1998 WP_001289857.1.19987 WP_001289857.1.19999 WP_001289857.1.20 WP_001289857.1.20023 WP_001289857.1.20034 WP_001289857.1.20081 WP_001289857.1.20089 WP_001289857.1.2010 WP_001289857.1.20119 WP_001289857.1.20212 WP_001289857.1.20218 WP_001289857.1.20254 WP_001289857.1.20255 WP_001289857.1.20266 WP_001289857.1.20271 WP_001289857.1.20296 WP_001289857.1.20330 WP_001289857.1.20339 WP_001289857.1.20349 WP_001289857.1.20362 WP_001289857.1.20364 WP_001289857.1.20376 WP_001289857.1.20415 WP_001289857.1.20418 WP_001289857.1.20419 WP_001289857.1.20443 WP_001289857.1.20446 WP_001289857.1.20465 WP_001289857.1.2047 WP_001289857.1.20488 WP_001289857.1.20492 WP_001289857.1.20503 WP_001289857.1.20525 WP_001289857.1.2053 WP_001289857.1.2054 WP_001289857.1.20553 WP_001289857.1.20573 WP_001289857.1.20614 WP_001289857.1.20626 WP_001289857.1.20635 WP_001289857.1.20646 WP_001289857.1.20718 WP_001289857.1.20721 WP_001289857.1.2073 WP_001289857.1.20740 WP_001289857.1.20760 WP_001289857.1.20789 WP_001289857.1.20795 WP_001289857.1.20810 WP_001289857.1.20828 WP_001289857.1.20839 WP_001289857.1.20862 WP_001289857.1.2087 WP_001289857.1.20883 WP_001289857.1.20886 WP_001289857.1.20894 WP_001289857.1.20900 WP_001289857.1.20908 WP_001289857.1.2091 WP_001289857.1.20947 WP_001289857.1.20953 WP_001289857.1.2101 WP_001289857.1.21010 WP_001289857.1.21049 WP_001289857.1.2106 WP_001289857.1.21062 WP_001289857.1.21075 WP_001289857.1.21086 WP_001289857.1.21089 WP_001289857.1.21136 WP_001289857.1.21144 WP_001289857.1.21146 WP_001289857.1.21162 WP_001289857.1.21165 WP_001289857.1.21181 WP_001289857.1.21184 WP_001289857.1.21185 WP_001289857.1.21245 WP_001289857.1.21246 WP_001289857.1.21260 WP_001289857.1.21269 WP_001289857.1.21286 WP_001289857.1.2130 WP_001289857.1.21351 WP_001289857.1.21366 WP_001289857.1.21399 WP_001289857.1.21400 WP_001289857.1.21404 WP_001289857.1.21423 WP_001289857.1.21443 WP_001289857.1.21453 WP_001289857.1.2146 WP_001289857.1.21473 WP_001289857.1.21492 WP_001289857.1.21497 WP_001289857.1.21499 WP_001289857.1.21548 WP_001289857.1.21603 WP_001289857.1.2166 WP_001289857.1.21674 WP_001289857.1.21728 WP_001289857.1.21730 WP_001289857.1.21750 WP_001289857.1.21751 WP_001289857.1.21757 WP_001289857.1.21825 WP_001289857.1.21845 WP_001289857.1.21910 WP_001289857.1.21940 WP_001289857.1.21946 WP_001289857.1.21981 WP_001289857.1.21991 WP_001289857.1.22019 WP_001289857.1.22024 WP_001289857.1.22030 WP_001289857.1.2205 WP_001289857.1.22062 WP_001289857.1.22064 WP_001289857.1.22067 WP_001289857.1.22117 WP_001289857.1.22118 WP_001289857.1.22126 WP_001289857.1.2216 WP_001289857.1.22205 WP_001289857.1.22208 WP_001289857.1.2221 WP_001289857.1.22235 WP_001289857.1.2224 WP_001289857.1.22240 WP_001289857.1.2227 WP_001289857.1.22270 WP_001289857.1.22315 WP_001289857.1.22337 WP_001289857.1.2235 WP_001289857.1.22373 WP_001289857.1.22379 WP_001289857.1.22388 WP_001289857.1.22427 WP_001289857.1.22453 WP_001289857.1.2246 WP_001289857.1.22476 WP_001289857.1.22485 WP_001289857.1.22537 WP_001289857.1.22565 WP_001289857.1.22575 WP_001289857.1.22604 WP_001289857.1.22614 WP_001289857.1.22620 WP_001289857.1.22623 WP_001289857.1.22652 WP_001289857.1.22683 WP_001289857.1.22692 WP_001289857.1.22758 WP_001289857.1.2283 WP_001289857.1.2284 WP_001289857.1.22855 WP_001289857.1.22870 WP_001289857.1.22895 WP_001289857.1.22926 WP_001289857.1.22943 WP_001289857.1.22966 WP_001289857.1.22967 WP_001289857.1.22979 WP_001289857.1.23010 WP_001289857.1.23040 WP_001289857.1.23058 WP_001289857.1.23080 WP_001289857.1.23102 WP_001289857.1.23114 WP_001289857.1.2314 WP_001289857.1.23148 WP_001289857.1.23169 WP_001289857.1.23172 WP_001289857.1.23175 WP_001289857.1.23192 WP_001289857.1.23201 WP_001289857.1.23218 WP_001289857.1.23258 WP_001289857.1.23259 WP_001289857.1.23274 WP_001289857.1.23279 WP_001289857.1.23309 WP_001289857.1.2331 WP_001289857.1.23311 WP_001289857.1.2332 WP_001289857.1.23340 WP_001289857.1.23343 WP_001289857.1.23365 WP_001289857.1.23379 WP_001289857.1.23409 WP_001289857.1.23412 WP_001289857.1.23426 WP_001289857.1.23444 WP_001289857.1.23460 WP_001289857.1.23466 WP_001289857.1.23472 WP_001289857.1.23482 WP_001289857.1.23485 WP_001289857.1.23492 WP_001289857.1.23500 WP_001289857.1.23503 WP_001289857.1.23509 WP_001289857.1.23513 WP_001289857.1.23548 WP_001289857.1.23571 WP_001289857.1.23587 WP_001289857.1.23604 WP_001289857.1.23621 WP_001289857.1.23629 WP_001289857.1.23634 WP_001289857.1.23639 WP_001289857.1.2364 WP_001289857.1.23643 WP_001289857.1.23646 WP_001289857.1.23670 WP_001289857.1.23675 WP_001289857.1.23685 WP_001289857.1.237 WP_001289857.1.23707 WP_001289857.1.23720 WP_001289857.1.23728 WP_001289857.1.2375 WP_001289857.1.23755 WP_001289857.1.23783 WP_001289857.1.23786 WP_001289857.1.23787 WP_001289857.1.2380 WP_001289857.1.23801 WP_001289857.1.23932 WP_001289857.1.23959 WP_001289857.1.24017 WP_001289857.1.24028 WP_001289857.1.24061 WP_001289857.1.24082 WP_001289857.1.24083 WP_001289857.1.24117 WP_001289857.1.24125 WP_001289857.1.24138 WP_001289857.1.24153 WP_001289857.1.24158 WP_001289857.1.24206 WP_001289857.1.24291 WP_001289857.1.24303 WP_001289857.1.24308 WP_001289857.1.24322 WP_001289857.1.24325 WP_001289857.1.24355 WP_001289857.1.24375 WP_001289857.1.24400 WP_001289857.1.24412 WP_001289857.1.24419 WP_001289857.1.24420 WP_001289857.1.24444 WP_001289857.1.24450 WP_001289857.1.24476 WP_001289857.1.24521 WP_001289857.1.24567 WP_001289857.1.24578 WP_001289857.1.24619 WP_001289857.1.24643 WP_001289857.1.24686 WP_001289857.1.24688 WP_001289857.1.24696 WP_001289857.1.24716 WP_001289857.1.24723 WP_001289857.1.24737 WP_001289857.1.24779 WP_001289857.1.2481 WP_001289857.1.24832 WP_001289857.1.24837 WP_001289857.1.24839 WP_001289857.1.24873 WP_001289857.1.24964 WP_001289857.1.24995 WP_001289857.1.25008 WP_001289857.1.25015 WP_001289857.1.25017 WP_001289857.1.25032 WP_001289857.1.25036 WP_001289857.1.25041 WP_001289857.1.25053 WP_001289857.1.25064 WP_001289857.1.25072 WP_001289857.1.25119 WP_001289857.1.25140 WP_001289857.1.25185 WP_001289857.1.25196 WP_001289857.1.25205 WP_001289857.1.25206 WP_001289857.1.25210 WP_001289857.1.25217 WP_001289857.1.25219 WP_001289857.1.25229 WP_001289857.1.2525 WP_001289857.1.25297 WP_001289857.1.25304 WP_001289857.1.25374 WP_001289857.1.25397 WP_001289857.1.25405 WP_001289857.1.25454 WP_001289857.1.25475 WP_001289857.1.25490 WP_001289857.1.25493 WP_001289857.1.25508 WP_001289857.1.25512 WP_001289857.1.25514 WP_001289857.1.25546 WP_001289857.1.25564 WP_001289857.1.25596 WP_001289857.1.2562 WP_001289857.1.25666 WP_001289857.1.25668 WP_001289857.1.25690 WP_001289857.1.2570 WP_001289857.1.25700 WP_001289857.1.25703 WP_001289857.1.25708 WP_001289857.1.25740 WP_001289857.1.25793 WP_001289857.1.25807 WP_001289857.1.25809 WP_001289857.1.2581 WP_001289857.1.25814 WP_001289857.1.25821 WP_001289857.1.25825 WP_001289857.1.25833 WP_001289857.1.25835 WP_001289857.1.25882 WP_001289857.1.25911 WP_001289857.1.25928 WP_001289857.1.25944 WP_001289857.1.25962 WP_001289857.1.25963 WP_001289857.1.25988 WP_001289857.1.26001 WP_001289857.1.26027 WP_001289857.1.26030 WP_001289857.1.26034 WP_001289857.1.26075 WP_001289857.1.26093 WP_001289857.1.26107 WP_001289857.1.26123 WP_001289857.1.26129 WP_001289857.1.2615 WP_001289857.1.26199 WP_001289857.1.26213 WP_001289857.1.26217 WP_001289857.1.26224 WP_001289857.1.26230 WP_001289857.1.26232 WP_001289857.1.26272 WP_001289857.1.26282 WP_001289857.1.26286 WP_001289857.1.26288 WP_001289857.1.26311 WP_001289857.1.26319 WP_001289857.1.2634 WP_001289857.1.26384 WP_001289857.1.26394 WP_001289857.1.26429 WP_001289857.1.26440 WP_001289857.1.26491 WP_001289857.1.26493 WP_001289857.1.2654 WP_001289857.1.26551 WP_001289857.1.26554 WP_001289857.1.26563 WP_001289857.1.26567 WP_001289857.1.26576 WP_001289857.1.2660 WP_001289857.1.26636 WP_001289857.1.26646 WP_001289857.1.2667 WP_001289857.1.26689 WP_001289857.1.26709 WP_001289857.1.26741 WP_001289857.1.26758 WP_001289857.1.26787 WP_001289857.1.2679 WP_001289857.1.26833 WP_001289857.1.26856 WP_001289857.1.26882 WP_001289857.1.26883 WP_001289857.1.26892 WP_001289857.1.26908 WP_001289857.1.26919 WP_001289857.1.2692 WP_001289857.1.26928 WP_001289857.1.26980 WP_001289857.1.270 WP_001289857.1.27008 WP_001289857.1.27010 WP_001289857.1.27027 WP_001289857.1.27051 WP_001289857.1.27055 WP_001289857.1.27070 WP_001289857.1.27072 WP_001289857.1.27077 WP_001289857.1.27084 WP_001289857.1.27086 WP_001289857.1.27087 WP_001289857.1.27111 WP_001289857.1.27115 WP_001289857.1.27122 WP_001289857.1.27169 WP_001289857.1.2717 WP_001289857.1.27173 WP_001289857.1.272 WP_001289857.1.27206 WP_001289857.1.27223 WP_001289857.1.27228 WP_001289857.1.2723 WP_001289857.1.27255 WP_001289857.1.27279 WP_001289857.1.27282 WP_001289857.1.27285 WP_001289857.1.27309 WP_001289857.1.27329 WP_001289857.1.27361 WP_001289857.1.27423 WP_001289857.1.27522 WP_001289857.1.27523 WP_001289857.1.27535 WP_001289857.1.27544 WP_001289857.1.27556 WP_001289857.1.27561 WP_001289857.1.27565 WP_001289857.1.27595 WP_001289857.1.27598 WP_001289857.1.2763 WP_001289857.1.27655 WP_001289857.1.27665 WP_001289857.1.27679 WP_001289857.1.27706 WP_001289857.1.27707 WP_001289857.1.27713 WP_001289857.1.27755 WP_001289857.1.27761 WP_001289857.1.2777 WP_001289857.1.27775 WP_001289857.1.27785 WP_001289857.1.27798 WP_001289857.1.27815 WP_001289857.1.27857 WP_001289857.1.27900 WP_001289857.1.27928 WP_001289857.1.27945 WP_001289857.1.27969 WP_001289857.1.27977 WP_001289857.1.27997 WP_001289857.1.28002 WP_001289857.1.28004 WP_001289857.1.28032 WP_001289857.1.2806 WP_001289857.1.28073 WP_001289857.1.2809 WP_001289857.1.28094 WP_001289857.1.28116 WP_001289857.1.28126 WP_001289857.1.28155 WP_001289857.1.28170 WP_001289857.1.28174 WP_001289857.1.28198 WP_001289857.1.2822 WP_001289857.1.28225 WP_001289857.1.28229 WP_001289857.1.28235 WP_001289857.1.28267 WP_001289857.1.2829 WP_001289857.1.28301 WP_001289857.1.28302 WP_001289857.1.2835 WP_001289857.1.28370 WP_001289857.1.28384 WP_001289857.1.28386 WP_001289857.1.28393 WP_001289857.1.28395 WP_001289857.1.284 WP_001289857.1.2845 WP_001289857.1.28479 WP_001289857.1.28504 WP_001289857.1.28514 WP_001289857.1.28538 WP_001289857.1.28575 WP_001289857.1.28627 WP_001289857.1.28655 WP_001289857.1.28673 WP_001289857.1.28692 WP_001289857.1.28694 WP_001289857.1.2873 WP_001289857.1.28733 WP_001289857.1.28775 WP_001289857.1.28776 WP_001289857.1.2879 WP_001289857.1.28811 WP_001289857.1.28830 WP_001289857.1.2890 WP_001289857.1.28902 WP_001289857.1.28917 WP_001289857.1.28921 WP_001289857.1.28938 WP_001289857.1.28946 WP_001289857.1.28948 WP_001289857.1.28962 WP_001289857.1.28963 WP_001289857.1.28977 WP_001289857.1.29006 WP_001289857.1.29010 WP_001289857.1.29023 WP_001289857.1.29042 WP_001289857.1.2905 WP_001289857.1.2907 WP_001289857.1.29089 WP_001289857.1.29099 WP_001289857.1.2910 WP_001289857.1.29113 WP_001289857.1.29130 WP_001289857.1.29153 WP_001289857.1.29174 WP_001289857.1.29190 WP_001289857.1.29203 WP_001289857.1.29237 WP_001289857.1.29255 WP_001289857.1.29265 WP_001289857.1.29288 WP_001289857.1.29349 WP_001289857.1.29389 WP_001289857.1.29439 WP_001289857.1.2946 WP_001289857.1.29462 WP_001289857.1.29509 WP_001289857.1.29530 WP_001289857.1.29588 WP_001289857.1.29593 WP_001289857.1.29601 WP_001289857.1.29606 WP_001289857.1.29615 WP_001289857.1.29619 WP_001289857.1.29704 WP_001289857.1.29711 WP_001289857.1.29727 WP_001289857.1.29732 WP_001289857.1.29743 WP_001289857.1.29774 WP_001289857.1.29775 WP_001289857.1.29782 WP_001289857.1.29827 WP_001289857.1.29833 WP_001289857.1.2984 WP_001289857.1.29845 WP_001289857.1.29865 WP_001289857.1.29886 WP_001289857.1.29898 WP_001289857.1.29919 WP_001289857.1.2994 WP_001289857.1.29964 WP_001289857.1.29969 WP_001289857.1.29983 WP_001289857.1.29990 WP_001289857.1.30006 WP_001289857.1.30009 WP_001289857.1.30018 WP_001289857.1.3002 WP_001289857.1.30022 WP_001289857.1.30027 WP_001289857.1.30034 WP_001289857.1.30049 WP_001289857.1.30058 WP_001289857.1.30086 WP_001289857.1.30093 WP_001289857.1.30170 WP_001289857.1.30172 WP_001289857.1.30179 WP_001289857.1.30180 WP_001289857.1.30185 WP_001289857.1.30195 WP_001289857.1.30202 WP_001289857.1.30225 WP_001289857.1.30246 WP_001289857.1.30331 WP_001289857.1.30354 WP_001289857.1.30356 WP_001289857.1.30357 WP_001289857.1.30362 WP_001289857.1.3042 WP_001289857.1.30421 WP_001289857.1.30425 WP_001289857.1.30437 WP_001289857.1.30440 WP_001289857.1.30448 WP_001289857.1.30469 WP_001289857.1.30489 WP_001289857.1.30505 WP_001289857.1.30507 WP_001289857.1.30517 WP_001289857.1.30535 WP_001289857.1.30542 WP_001289857.1.30544 WP_001289857.1.30547 WP_001289857.1.30573 WP_001289857.1.30585 WP_001289857.1.30618 WP_001289857.1.30619 WP_001289857.1.30635 WP_001289857.1.30664 WP_001289857.1.3068 WP_001289857.1.30688 WP_001289857.1.30696 WP_001289857.1.3076 WP_001289857.1.30794 WP_001289857.1.3080 WP_001289857.1.30803 WP_001289857.1.30806 WP_001289857.1.30819 WP_001289857.1.30823 WP_001289857.1.30833 WP_001289857.1.30835 WP_001289857.1.30934 WP_001289857.1.3095 WP_001289857.1.30951 WP_001289857.1.30967 WP_001289857.1.30972 WP_001289857.1.31 WP_001289857.1.31001 WP_001289857.1.31011 WP_001289857.1.31042 WP_001289857.1.31046 WP_001289857.1.31066 WP_001289857.1.31078 WP_001289857.1.31086 WP_001289857.1.31092 WP_001289857.1.31107 WP_001289857.1.31111 WP_001289857.1.31122 WP_001289857.1.3113 WP_001289857.1.31139 WP_001289857.1.3114 WP_001289857.1.31145 WP_001289857.1.31155 WP_001289857.1.31156 WP_001289857.1.31171 WP_001289857.1.31182 WP_001289857.1.31185 WP_001289857.1.3119 WP_001289857.1.31190 WP_001289857.1.31195 WP_001289857.1.31196 WP_001289857.1.31198 WP_001289857.1.31205 WP_001289857.1.3121 WP_001289857.1.31214 WP_001289857.1.31219 WP_001289857.1.31222 WP_001289857.1.31223 WP_001289857.1.31251 WP_001289857.1.31262 WP_001289857.1.3127 WP_001289857.1.31281 WP_001289857.1.31303 WP_001289857.1.3131 WP_001289857.1.31352 WP_001289857.1.31362 WP_001289857.1.31389 WP_001289857.1.31413 WP_001289857.1.31446 WP_001289857.1.31451 WP_001289857.1.31504 WP_001289857.1.31533 WP_001289857.1.31578 WP_001289857.1.31658 WP_001289857.1.31665 WP_001289857.1.3170 WP_001289857.1.31720 WP_001289857.1.31725 WP_001289857.1.31762 WP_001289857.1.31782 WP_001289857.1.31799 WP_001289857.1.31836 WP_001289857.1.3185 WP_001289857.1.31927 WP_001289857.1.31940 WP_001289857.1.31951 WP_001289857.1.31952 WP_001289857.1.31967 WP_001289857.1.31972 WP_001289857.1.32006 WP_001289857.1.32038 WP_001289857.1.32041 WP_001289857.1.32042 WP_001289857.1.32054 WP_001289857.1.32056 WP_001289857.1.3207 WP_001289857.1.32170 WP_001289857.1.32189 WP_001289857.1.32192 WP_001289857.1.32202 WP_001289857.1.32206 WP_001289857.1.32255 WP_001289857.1.32260 WP_001289857.1.32263 WP_001289857.1.32275 WP_001289857.1.32293 WP_001289857.1.32299 WP_001289857.1.32357 WP_001289857.1.32368 WP_001289857.1.32422 WP_001289857.1.32423 WP_001289857.1.32425 WP_001289857.1.32434 WP_001289857.1.32438 WP_001289857.1.32458 WP_001289857.1.32459 WP_001289857.1.32460 WP_001289857.1.32491 WP_001289857.1.32493 WP_001289857.1.32515 WP_001289857.1.32529 WP_001289857.1.32545 WP_001289857.1.32563 WP_001289857.1.32578 WP_001289857.1.32617 WP_001289857.1.32624 WP_001289857.1.32629 WP_001289857.1.32643 WP_001289857.1.32660 WP_001289857.1.3270 WP_001289857.1.32702 WP_001289857.1.32714 WP_001289857.1.32725 WP_001289857.1.32747 WP_001289857.1.32750 WP_001289857.1.3278 WP_001289857.1.32786 WP_001289857.1.32804 WP_001289857.1.32838 WP_001289857.1.32848 WP_001289857.1.32860 WP_001289857.1.32868 WP_001289857.1.3290 WP_001289857.1.32900 WP_001289857.1.32907 WP_001289857.1.32930 WP_001289857.1.32940 WP_001289857.1.32941 WP_001289857.1.3296 WP_001289857.1.32961 WP_001289857.1.32966 WP_001289857.1.32985 WP_001289857.1.33010 WP_001289857.1.33030 WP_001289857.1.3305 WP_001289857.1.33051 WP_001289857.1.33065 WP_001289857.1.33078 WP_001289857.1.3310 WP_001289857.1.33106 WP_001289857.1.33122 WP_001289857.1.33127 WP_001289857.1.33143 WP_001289857.1.3315 WP_001289857.1.33160 WP_001289857.1.33208 WP_001289857.1.33214 WP_001289857.1.33247 WP_001289857.1.33248 WP_001289857.1.33261 WP_001289857.1.33280 WP_001289857.1.33283 WP_001289857.1.333 WP_001289857.1.33313 WP_001289857.1.33339 WP_001289857.1.33382 WP_001289857.1.33392 WP_001289857.1.33486 WP_001289857.1.33490 WP_001289857.1.33492 WP_001289857.1.33499 WP_001289857.1.33501 WP_001289857.1.33529 WP_001289857.1.33553 WP_001289857.1.33580 WP_001289857.1.33592 WP_001289857.1.33609 WP_001289857.1.33629 WP_001289857.1.33659 WP_001289857.1.33689 WP_001289857.1.33693 WP_001289857.1.3370 WP_001289857.1.33741 WP_001289857.1.33817 WP_001289857.1.33840 WP_001289857.1.33894 WP_001289857.1.3392 WP_001289857.1.33926 WP_001289857.1.3394 WP_001289857.1.3395 WP_001289857.1.33957 WP_001289857.1.33969 WP_001289857.1.33986 WP_001289857.1.34001 WP_001289857.1.34022 WP_001289857.1.34043 WP_001289857.1.34059 WP_001289857.1.34075 WP_001289857.1.34081 WP_001289857.1.34084 WP_001289857.1.34118 WP_001289857.1.34126 WP_001289857.1.34184 WP_001289857.1.34211 WP_001289857.1.34214 WP_001289857.1.34234 WP_001289857.1.34257 WP_001289857.1.34259 WP_001289857.1.34279 WP_001289857.1.34284 WP_001289857.1.34304 WP_001289857.1.34330 WP_001289857.1.34376 WP_001289857.1.34382 WP_001289857.1.34417 WP_001289857.1.3445 WP_001289857.1.34453 WP_001289857.1.34458 WP_001289857.1.34484 WP_001289857.1.34496 WP_001289857.1.34517 WP_001289857.1.34530 WP_001289857.1.34610 WP_001289857.1.34647 WP_001289857.1.34665 WP_001289857.1.34667 WP_001289857.1.34694 WP_001289857.1.34703 WP_001289857.1.34704 WP_001289857.1.34707 WP_001289857.1.34751 WP_001289857.1.3476 WP_001289857.1.34801 WP_001289857.1.34808 WP_001289857.1.34824 WP_001289857.1.34834 WP_001289857.1.34854 WP_001289857.1.34856 WP_001289857.1.34881 WP_001289857.1.3489 WP_001289857.1.34932 WP_001289857.1.34962 WP_001289857.1.34972 WP_001289857.1.34975 WP_001289857.1.34977 WP_001289857.1.35001 WP_001289857.1.35035 WP_001289857.1.35040 WP_001289857.1.35045 WP_001289857.1.35074 WP_001289857.1.35075 WP_001289857.1.35125 WP_001289857.1.35129 WP_001289857.1.35175 WP_001289857.1.35184 WP_001289857.1.35193 WP_001289857.1.35219 WP_001289857.1.35240 WP_001289857.1.35274 WP_001289857.1.35294 WP_001289857.1.35404 WP_001289857.1.35408 WP_001289857.1.3541 WP_001289857.1.35425 WP_001289857.1.35429 WP_001289857.1.35446 WP_001289857.1.35460 WP_001289857.1.35463 WP_001289857.1.35494 WP_001289857.1.35503 WP_001289857.1.35509 WP_001289857.1.35532 WP_001289857.1.35560 WP_001289857.1.3557 WP_001289857.1.35590 WP_001289857.1.35628 WP_001289857.1.35648 WP_001289857.1.3566 WP_001289857.1.3570 WP_001289857.1.35712 WP_001289857.1.35713 WP_001289857.1.35736 WP_001289857.1.35777 WP_001289857.1.35791 WP_001289857.1.35795 WP_001289857.1.35809 WP_001289857.1.35835 WP_001289857.1.35870 WP_001289857.1.35892 WP_001289857.1.35916 WP_001289857.1.35938 WP_001289857.1.35940 WP_001289857.1.35966 WP_001289857.1.36000 WP_001289857.1.36003 WP_001289857.1.3601 WP_001289857.1.36011 WP_001289857.1.36017 WP_001289857.1.36034 WP_001289857.1.36036 WP_001289857.1.36069 WP_001289857.1.3610 WP_001289857.1.36232 WP_001289857.1.36236 WP_001289857.1.36286 WP_001289857.1.36291 WP_001289857.1.36298 WP_001289857.1.36308 WP_001289857.1.36343 WP_001289857.1.36425 WP_001289857.1.36460 WP_001289857.1.3649 WP_001289857.1.36495 WP_001289857.1.36512 WP_001289857.1.36526 WP_001289857.1.36542 WP_001289857.1.36547 WP_001289857.1.36579 WP_001289857.1.36592 WP_001289857.1.36609 WP_001289857.1.36617 WP_001289857.1.36618 WP_001289857.1.36643 WP_001289857.1.36652 WP_001289857.1.36663 WP_001289857.1.36690 WP_001289857.1.3670 WP_001289857.1.36701 WP_001289857.1.36705 WP_001289857.1.36725 WP_001289857.1.36779 WP_001289857.1.36792 WP_001289857.1.36798 WP_001289857.1.36802 WP_001289857.1.36821 WP_001289857.1.36839 WP_001289857.1.36853 WP_001289857.1.3688 WP_001289857.1.36885 WP_001289857.1.36918 WP_001289857.1.36931 WP_001289857.1.36948 WP_001289857.1.36949 WP_001289857.1.36950 WP_001289857.1.37013 WP_001289857.1.37014 WP_001289857.1.37021 WP_001289857.1.37028 WP_001289857.1.37063 WP_001289857.1.37073 WP_001289857.1.37100 WP_001289857.1.37111 WP_001289857.1.37112 WP_001289857.1.37133 WP_001289857.1.37147 WP_001289857.1.37158 WP_001289857.1.37176 WP_001289857.1.37190 WP_001289857.1.37199 WP_001289857.1.37200 WP_001289857.1.37256 WP_001289857.1.37258 WP_001289857.1.37267 WP_001289857.1.3728 WP_001289857.1.37293 WP_001289857.1.37303 WP_001289857.1.37320 WP_001289857.1.3734 WP_001289857.1.37351 WP_001289857.1.37363 WP_001289857.1.37370 WP_001289857.1.37376 WP_001289857.1.3744 WP_001289857.1.37478 WP_001289857.1.37498 WP_001289857.1.37504 WP_001289857.1.3751 WP_001289857.1.37513 WP_001289857.1.37521 WP_001289857.1.37584 WP_001289857.1.37590 WP_001289857.1.37593 WP_001289857.1.37600 WP_001289857.1.37610 WP_001289857.1.37613 WP_001289857.1.37618 WP_001289857.1.37659 WP_001289857.1.37662 WP_001289857.1.37675 WP_001289857.1.37687 WP_001289857.1.37691 WP_001289857.1.37719 WP_001289857.1.37761 WP_001289857.1.37775 WP_001289857.1.37777 WP_001289857.1.378 WP_001289857.1.37848 WP_001289857.1.379 WP_001289857.1.37911 WP_001289857.1.37941 WP_001289857.1.37965 WP_001289857.1.37968 WP_001289857.1.37978 WP_001289857.1.37985 WP_001289857.1.38001 WP_001289857.1.38026 WP_001289857.1.38055 WP_001289857.1.38061 WP_001289857.1.38064 WP_001289857.1.38108 WP_001289857.1.38113 WP_001289857.1.38125 WP_001289857.1.38145 WP_001289857.1.3816 WP_001289857.1.38207 WP_001289857.1.38261 WP_001289857.1.38266 WP_001289857.1.38273 WP_001289857.1.3828 WP_001289857.1.383 WP_001289857.1.38310 WP_001289857.1.38322 WP_001289857.1.3834 WP_001289857.1.38341 WP_001289857.1.38349 WP_001289857.1.38351 WP_001289857.1.3838 WP_001289857.1.38381 WP_001289857.1.38393 WP_001289857.1.38408 WP_001289857.1.38440 WP_001289857.1.3848 WP_001289857.1.38486 WP_001289857.1.38512 WP_001289857.1.38515 WP_001289857.1.38569 WP_001289857.1.38595 WP_001289857.1.3860 WP_001289857.1.38609 WP_001289857.1.38613 WP_001289857.1.38622 WP_001289857.1.38642 WP_001289857.1.38673 WP_001289857.1.3869 WP_001289857.1.38693 WP_001289857.1.38734 WP_001289857.1.38740 WP_001289857.1.38773 WP_001289857.1.38781 WP_001289857.1.38797 WP_001289857.1.38830 WP_001289857.1.38857 WP_001289857.1.38877 WP_001289857.1.38882 WP_001289857.1.38942 WP_001289857.1.38983 WP_001289857.1.38995 WP_001289857.1.38996 WP_001289857.1.39003 WP_001289857.1.39038 WP_001289857.1.39056 WP_001289857.1.39059 WP_001289857.1.3907 WP_001289857.1.39105 WP_001289857.1.39113 WP_001289857.1.39128 WP_001289857.1.39136 WP_001289857.1.3914 WP_001289857.1.39147 WP_001289857.1.39161 WP_001289857.1.39183 WP_001289857.1.39197 WP_001289857.1.39210 WP_001289857.1.39229 WP_001289857.1.39235 WP_001289857.1.39265 WP_001289857.1.39275 WP_001289857.1.3931 WP_001289857.1.39385 WP_001289857.1.39405 WP_001289857.1.39420 WP_001289857.1.39466 WP_001289857.1.39471 WP_001289857.1.39497 WP_001289857.1.39502 WP_001289857.1.39503 WP_001289857.1.39512 WP_001289857.1.39530 WP_001289857.1.39556 WP_001289857.1.39576 WP_001289857.1.39584 WP_001289857.1.39609 WP_001289857.1.39619 WP_001289857.1.39620 WP_001289857.1.39624 WP_001289857.1.39629 WP_001289857.1.39659 WP_001289857.1.39667 WP_001289857.1.39722 WP_001289857.1.39723 WP_001289857.1.39724 WP_001289857.1.39763 WP_001289857.1.39775 WP_001289857.1.39808 WP_001289857.1.39862 WP_001289857.1.39879 WP_001289857.1.39890 WP_001289857.1.39921 WP_001289857.1.39941 WP_001289857.1.39945 WP_001289857.1.39947 WP_001289857.1.40008 WP_001289857.1.40017 WP_001289857.1.40025 WP_001289857.1.40072 WP_001289857.1.40073 WP_001289857.1.40095 WP_001289857.1.40097 WP_001289857.1.401 WP_001289857.1.4011 WP_001289857.1.40111 WP_001289857.1.40155 WP_001289857.1.40160 WP_001289857.1.40170 WP_001289857.1.40171 WP_001289857.1.40205 WP_001289857.1.40208 WP_001289857.1.40224 WP_001289857.1.40229 WP_001289857.1.40240 WP_001289857.1.40254 WP_001289857.1.40257 WP_001289857.1.40258 WP_001289857.1.40279 WP_001289857.1.40292 WP_001289857.1.40305 WP_001289857.1.40311 WP_001289857.1.40341 WP_001289857.1.40361 WP_001289857.1.40380 WP_001289857.1.40395 WP_001289857.1.4042 WP_001289857.1.40465 WP_001289857.1.40467 WP_001289857.1.40492 WP_001289857.1.40496 WP_001289857.1.40508 WP_001289857.1.40517 WP_001289857.1.40583 WP_001289857.1.40648 WP_001289857.1.40693 WP_001289857.1.40698 WP_001289857.1.40710 WP_001289857.1.40722 WP_001289857.1.4075 WP_001289857.1.40750 WP_001289857.1.40763 WP_001289857.1.40771 WP_001289857.1.40854 WP_001289857.1.4087 WP_001289857.1.40877 WP_001289857.1.4088 WP_001289857.1.4089 WP_001289857.1.40910 WP_001289857.1.40924 WP_001289857.1.40932 WP_001289857.1.40935 WP_001289857.1.40946 WP_001289857.1.40979 WP_001289857.1.40996 WP_001289857.1.41004 WP_001289857.1.41017 WP_001289857.1.41018 WP_001289857.1.41048 WP_001289857.1.41050 WP_001289857.1.4106 WP_001289857.1.41070 WP_001289857.1.41074 WP_001289857.1.41075 WP_001289857.1.41086 WP_001289857.1.4109 WP_001289857.1.41091 WP_001289857.1.41097 WP_001289857.1.41132 WP_001289857.1.41176 WP_001289857.1.41225 WP_001289857.1.41226 WP_001289857.1.41251 WP_001289857.1.41258 WP_001289857.1.41265 WP_001289857.1.41279 WP_001289857.1.41299 WP_001289857.1.41305 WP_001289857.1.41308 WP_001289857.1.41310 WP_001289857.1.41321 WP_001289857.1.41333 WP_001289857.1.41335 WP_001289857.1.4136 WP_001289857.1.41375 WP_001289857.1.41415 WP_001289857.1.41438 WP_001289857.1.41440 WP_001289857.1.41459 WP_001289857.1.41498 WP_001289857.1.41516 WP_001289857.1.41519 WP_001289857.1.41524 WP_001289857.1.41554 WP_001289857.1.41572 WP_001289857.1.41591 WP_001289857.1.41593 WP_001289857.1.41628 WP_001289857.1.41658 WP_001289857.1.41659 WP_001289857.1.41662 WP_001289857.1.41716 WP_001289857.1.41735 WP_001289857.1.41746 WP_001289857.1.41761 WP_001289857.1.4178 WP_001289857.1.41789 WP_001289857.1.41802 WP_001289857.1.41824 WP_001289857.1.41825 WP_001289857.1.41836 WP_001289857.1.4184 WP_001289857.1.41859 WP_001289857.1.41862 WP_001289857.1.41877 WP_001289857.1.41882 WP_001289857.1.41894 WP_001289857.1.41897 WP_001289857.1.41904 WP_001289857.1.41919 WP_001289857.1.41929 WP_001289857.1.41931 WP_001289857.1.4194 WP_001289857.1.41979 WP_001289857.1.41985 WP_001289857.1.41994 WP_001289857.1.41998 WP_001289857.1.42009 WP_001289857.1.42069 WP_001289857.1.42081 WP_001289857.1.42090 WP_001289857.1.42104 WP_001289857.1.42109 WP_001289857.1.42111 WP_001289857.1.42156 WP_001289857.1.42187 WP_001289857.1.42200 WP_001289857.1.42219 WP_001289857.1.4222 WP_001289857.1.42238 WP_001289857.1.42243 WP_001289857.1.42244 WP_001289857.1.42248 WP_001289857.1.42257 WP_001289857.1.42261 WP_001289857.1.42320 WP_001289857.1.42328 WP_001289857.1.42342 WP_001289857.1.42349 WP_001289857.1.42356 WP_001289857.1.42364 WP_001289857.1.42371 WP_001289857.1.42379 WP_001289857.1.42391 WP_001289857.1.42399 WP_001289857.1.42422 WP_001289857.1.42433 WP_001289857.1.42444 WP_001289857.1.42453 WP_001289857.1.42489 WP_001289857.1.42539 WP_001289857.1.4257 WP_001289857.1.42595 WP_001289857.1.42603 WP_001289857.1.42605 WP_001289857.1.42650 WP_001289857.1.42655 WP_001289857.1.4267 WP_001289857.1.42676 WP_001289857.1.42685 WP_001289857.1.42701 WP_001289857.1.42707 WP_001289857.1.4276 WP_001289857.1.42767 WP_001289857.1.42794 WP_001289857.1.42805 WP_001289857.1.42815 WP_001289857.1.42859 WP_001289857.1.42861 WP_001289857.1.42864 WP_001289857.1.4288 WP_001289857.1.4289 WP_001289857.1.42923 WP_001289857.1.42957 WP_001289857.1.42978 WP_001289857.1.4298 WP_001289857.1.42981 WP_001289857.1.43008 WP_001289857.1.43016 WP_001289857.1.43018 WP_001289857.1.43019 WP_001289857.1.43041 WP_001289857.1.43065 WP_001289857.1.43069 WP_001289857.1.43070 WP_001289857.1.43077 WP_001289857.1.43086 WP_001289857.1.43126 WP_001289857.1.43141 WP_001289857.1.43149 WP_001289857.1.43157 WP_001289857.1.43160 WP_001289857.1.43161 WP_001289857.1.43190 WP_001289857.1.43198 WP_001289857.1.43244 WP_001289857.1.43258 WP_001289857.1.4326 WP_001289857.1.43272 WP_001289857.1.43276 WP_001289857.1.43290 WP_001289857.1.43299 WP_001289857.1.43307 WP_001289857.1.43312 WP_001289857.1.4332 WP_001289857.1.43334 WP_001289857.1.43339 WP_001289857.1.43351 WP_001289857.1.43371 WP_001289857.1.43437 WP_001289857.1.43438 WP_001289857.1.43441 WP_001289857.1.43476 WP_001289857.1.43508 WP_001289857.1.43513 WP_001289857.1.43520 WP_001289857.1.43522 WP_001289857.1.43606 WP_001289857.1.43613 WP_001289857.1.43633 WP_001289857.1.43637 WP_001289857.1.43651 WP_001289857.1.43654 WP_001289857.1.43668 WP_001289857.1.43676 WP_001289857.1.43710 WP_001289857.1.43722 WP_001289857.1.4373 WP_001289857.1.43778 WP_001289857.1.43782 WP_001289857.1.43801 WP_001289857.1.43812 WP_001289857.1.43828 WP_001289857.1.43839 WP_001289857.1.43864 WP_001289857.1.43886 WP_001289857.1.43888 WP_001289857.1.43919 WP_001289857.1.43951 WP_001289857.1.43954 WP_001289857.1.43974 WP_001289857.1.44005 WP_001289857.1.4404 WP_001289857.1.44043 WP_001289857.1.44049 WP_001289857.1.44099 WP_001289857.1.44101 WP_001289857.1.44113 WP_001289857.1.44121 WP_001289857.1.44132 WP_001289857.1.44160 WP_001289857.1.44180 WP_001289857.1.44187 WP_001289857.1.44196 WP_001289857.1.4422 WP_001289857.1.44248 WP_001289857.1.44262 WP_001289857.1.44268 WP_001289857.1.4427 WP_001289857.1.44291 WP_001289857.1.44296 WP_001289857.1.44300 WP_001289857.1.44310 WP_001289857.1.44339 WP_001289857.1.44343 WP_001289857.1.44351 WP_001289857.1.44359 WP_001289857.1.44360 WP_001289857.1.44380 WP_001289857.1.44386 WP_001289857.1.44416 WP_001289857.1.44431 WP_001289857.1.44433 WP_001289857.1.44437 WP_001289857.1.44443 WP_001289857.1.44453 WP_001289857.1.44479 WP_001289857.1.44546 WP_001289857.1.44578 WP_001289857.1.44593 WP_001289857.1.44607 WP_001289857.1.44633 WP_001289857.1.44636 WP_001289857.1.44640 WP_001289857.1.4467 WP_001289857.1.44678 WP_001289857.1.4468 WP_001289857.1.44702 WP_001289857.1.44747 WP_001289857.1.44762 WP_001289857.1.44791 WP_001289857.1.44815 WP_001289857.1.44828 WP_001289857.1.44833 WP_001289857.1.44877 WP_001289857.1.44879 WP_001289857.1.44887 WP_001289857.1.449 WP_001289857.1.44917 WP_001289857.1.44927 WP_001289857.1.44933 WP_001289857.1.44943 WP_001289857.1.44950 WP_001289857.1.44971 WP_001289857.1.44985 WP_001289857.1.44998 WP_001289857.1.4501 WP_001289857.1.45027 WP_001289857.1.45038 WP_001289857.1.45067 WP_001289857.1.45072 WP_001289857.1.45074 WP_001289857.1.45079 WP_001289857.1.45093 WP_001289857.1.45098 WP_001289857.1.45123 WP_001289857.1.45134 WP_001289857.1.45136 WP_001289857.1.45138 WP_001289857.1.45145 WP_001289857.1.45177 WP_001289857.1.45184 WP_001289857.1.45229 WP_001289857.1.45241 WP_001289857.1.45251 WP_001289857.1.45259 WP_001289857.1.45268 WP_001289857.1.45322 WP_001289857.1.45344 WP_001289857.1.45349 WP_001289857.1.45351 WP_001289857.1.45365 WP_001289857.1.4540 WP_001289857.1.45402 WP_001289857.1.45434 WP_001289857.1.45435 WP_001289857.1.45468 WP_001289857.1.45522 WP_001289857.1.45535 WP_001289857.1.45550 WP_001289857.1.45566 WP_001289857.1.45582 WP_001289857.1.45596 WP_001289857.1.45622 WP_001289857.1.45648 WP_001289857.1.45660 WP_001289857.1.45690 WP_001289857.1.45706 WP_001289857.1.45781 WP_001289857.1.45797 WP_001289857.1.458 WP_001289857.1.45829 WP_001289857.1.45848 WP_001289857.1.45871 WP_001289857.1.45984 WP_001289857.1.46011 WP_001289857.1.46028 WP_001289857.1.46030 WP_001289857.1.46069 WP_001289857.1.46077 WP_001289857.1.46091 WP_001289857.1.46112 WP_001289857.1.46124 WP_001289857.1.46169 WP_001289857.1.46173 WP_001289857.1.46174 WP_001289857.1.46187 WP_001289857.1.46203 WP_001289857.1.46205 WP_001289857.1.46225 WP_001289857.1.46241 WP_001289857.1.46243 WP_001289857.1.46278 WP_001289857.1.46286 WP_001289857.1.46307 WP_001289857.1.46323 WP_001289857.1.46355 WP_001289857.1.46358 WP_001289857.1.464 WP_001289857.1.46406 WP_001289857.1.46434 WP_001289857.1.46444 WP_001289857.1.46461 WP_001289857.1.46499 WP_001289857.1.46504 WP_001289857.1.46505 WP_001289857.1.46551 WP_001289857.1.46559 WP_001289857.1.46572 WP_001289857.1.46574 WP_001289857.1.46595 WP_001289857.1.46620 WP_001289857.1.46637 WP_001289857.1.46666 WP_001289857.1.46675 WP_001289857.1.46693 WP_001289857.1.46701 WP_001289857.1.4671 WP_001289857.1.46732 WP_001289857.1.46749 WP_001289857.1.46803 WP_001289857.1.46804 WP_001289857.1.46816 WP_001289857.1.46842 WP_001289857.1.4690 WP_001289857.1.46920 WP_001289857.1.46930 WP_001289857.1.46945 WP_001289857.1.47005 WP_001289857.1.47008 WP_001289857.1.47014 WP_001289857.1.47036 WP_001289857.1.47037 WP_001289857.1.47042 WP_001289857.1.47057 WP_001289857.1.47058 WP_001289857.1.47059 WP_001289857.1.47067 WP_001289857.1.47085 WP_001289857.1.47123 WP_001289857.1.47214 WP_001289857.1.47215 WP_001289857.1.47257 WP_001289857.1.47429 WP_001289857.1.47442 WP_001289857.1.47448 WP_001289857.1.47460 WP_001289857.1.4747 WP_001289857.1.47472 WP_001289857.1.47478 WP_001289857.1.47482 WP_001289857.1.47492 WP_001289857.1.47506 WP_001289857.1.47523 WP_001289857.1.47531 WP_001289857.1.47532 WP_001289857.1.47579 WP_001289857.1.47587 WP_001289857.1.47605 WP_001289857.1.47614 WP_001289857.1.47621 WP_001289857.1.47630 WP_001289857.1.47649 WP_001289857.1.4769 WP_001289857.1.4770 WP_001289857.1.4774 WP_001289857.1.47756 WP_001289857.1.47767 WP_001289857.1.47799 WP_001289857.1.4781 WP_001289857.1.47814 WP_001289857.1.47849 WP_001289857.1.47886 WP_001289857.1.47898 WP_001289857.1.47902 WP_001289857.1.47928 WP_001289857.1.47992 WP_001289857.1.48019 WP_001289857.1.48100 WP_001289857.1.48114 WP_001289857.1.48124 WP_001289857.1.48139 WP_001289857.1.48190 WP_001289857.1.48209 WP_001289857.1.48215 WP_001289857.1.48218 WP_001289857.1.48242 WP_001289857.1.48244 WP_001289857.1.48247 WP_001289857.1.48253 WP_001289857.1.48262 WP_001289857.1.48292 WP_001289857.1.483 WP_001289857.1.48324 WP_001289857.1.48367 WP_001289857.1.48377 WP_001289857.1.48399 WP_001289857.1.48426 WP_001289857.1.48430 WP_001289857.1.48436 WP_001289857.1.48455 WP_001289857.1.48493 WP_001289857.1.48524 WP_001289857.1.4853 WP_001289857.1.48570 WP_001289857.1.4859 WP_001289857.1.48591 WP_001289857.1.48610 WP_001289857.1.48631 WP_001289857.1.48647 WP_001289857.1.48651 WP_001289857.1.48690 WP_001289857.1.48734 WP_001289857.1.48751 WP_001289857.1.48755 WP_001289857.1.48756 WP_001289857.1.48774 WP_001289857.1.48778 WP_001289857.1.48788 WP_001289857.1.48849 WP_001289857.1.4885 WP_001289857.1.48855 WP_001289857.1.48886 WP_001289857.1.48894 WP_001289857.1.48896 WP_001289857.1.48908 WP_001289857.1.48918 WP_001289857.1.48919 WP_001289857.1.48931 WP_001289857.1.48955 WP_001289857.1.48963 WP_001289857.1.48973 WP_001289857.1.48985 WP_001289857.1.49004 WP_001289857.1.49012 WP_001289857.1.49084 WP_001289857.1.49090 WP_001289857.1.49106 WP_001289857.1.49113 WP_001289857.1.49117 WP_001289857.1.49121 WP_001289857.1.49140 WP_001289857.1.49153 WP_001289857.1.49155 WP_001289857.1.49166 WP_001289857.1.49175 WP_001289857.1.49204 WP_001289857.1.49214 WP_001289857.1.49239 WP_001289857.1.49256 WP_001289857.1.49262 WP_001289857.1.49276 WP_001289857.1.49290 WP_001289857.1.49304 WP_001289857.1.49309 WP_001289857.1.49340 WP_001289857.1.49358 WP_001289857.1.49366 WP_001289857.1.49375 WP_001289857.1.49429 WP_001289857.1.49434 WP_001289857.1.49443 WP_001289857.1.49450 WP_001289857.1.49472 WP_001289857.1.49490 WP_001289857.1.495 WP_001289857.1.49515 WP_001289857.1.49545 WP_001289857.1.49550 WP_001289857.1.49572 WP_001289857.1.49574 WP_001289857.1.49595 WP_001289857.1.49602 WP_001289857.1.49626 WP_001289857.1.49630 WP_001289857.1.49686 WP_001289857.1.49703 WP_001289857.1.49769 WP_001289857.1.49778 WP_001289857.1.49780 WP_001289857.1.4979 WP_001289857.1.49803 WP_001289857.1.49805 WP_001289857.1.49827 WP_001289857.1.49846 WP_001289857.1.4991 WP_001289857.1.49929 WP_001289857.1.49947 WP_001289857.1.49959 WP_001289857.1.50 WP_001289857.1.50003 WP_001289857.1.50014 WP_001289857.1.50030 WP_001289857.1.50043 WP_001289857.1.50103 WP_001289857.1.50158 WP_001289857.1.50161 WP_001289857.1.50211 WP_001289857.1.50238 WP_001289857.1.50239 WP_001289857.1.50247 WP_001289857.1.50251 WP_001289857.1.50285 WP_001289857.1.50308 WP_001289857.1.50309 WP_001289857.1.50374 WP_001289857.1.50376 WP_001289857.1.50386 WP_001289857.1.50387 WP_001289857.1.50389 WP_001289857.1.50404 WP_001289857.1.50406 WP_001289857.1.50413 WP_001289857.1.50468 WP_001289857.1.50469 WP_001289857.1.50478 WP_001289857.1.50497 WP_001289857.1.5051 WP_001289857.1.50517 WP_001289857.1.50563 WP_001289857.1.50565 WP_001289857.1.50566 WP_001289857.1.50570 WP_001289857.1.5058 WP_001289857.1.50593 WP_001289857.1.50626 WP_001289857.1.50676 WP_001289857.1.50726 WP_001289857.1.50769 WP_001289857.1.50771 WP_001289857.1.50774 WP_001289857.1.50777 WP_001289857.1.50782 WP_001289857.1.50800 WP_001289857.1.50804 WP_001289857.1.50808 WP_001289857.1.50811 WP_001289857.1.50875 WP_001289857.1.5088 WP_001289857.1.50893 WP_001289857.1.509 WP_001289857.1.50908 WP_001289857.1.50929 WP_001289857.1.50941 WP_001289857.1.50970 WP_001289857.1.50999 WP_001289857.1.51014 WP_001289857.1.51022 WP_001289857.1.51025 WP_001289857.1.51036 WP_001289857.1.51040 WP_001289857.1.51048 WP_001289857.1.51066 WP_001289857.1.51100 WP_001289857.1.51117 WP_001289857.1.51131 WP_001289857.1.51134 WP_001289857.1.5114 WP_001289857.1.51179 WP_001289857.1.51182 WP_001289857.1.51186 WP_001289857.1.51224 WP_001289857.1.51227 WP_001289857.1.5125 WP_001289857.1.5127 WP_001289857.1.51285 WP_001289857.1.51305 WP_001289857.1.51308 WP_001289857.1.51315 WP_001289857.1.51331 WP_001289857.1.5136 WP_001289857.1.5138 WP_001289857.1.51394 WP_001289857.1.51414 WP_001289857.1.51419 WP_001289857.1.51464 WP_001289857.1.51474 WP_001289857.1.51487 WP_001289857.1.51488 WP_001289857.1.51506 WP_001289857.1.51514 WP_001289857.1.51519 WP_001289857.1.51594 WP_001289857.1.51598 WP_001289857.1.51613 WP_001289857.1.51615 WP_001289857.1.51634 WP_001289857.1.51644 WP_001289857.1.51649 WP_001289857.1.51686 WP_001289857.1.51700 WP_001289857.1.51704 WP_001289857.1.51724 WP_001289857.1.51831 WP_001289857.1.51838 WP_001289857.1.51841 WP_001289857.1.51888 WP_001289857.1.51910 WP_001289857.1.51911 WP_001289857.1.51932 WP_001289857.1.51935 WP_001289857.1.51989 WP_001289857.1.52057 WP_001289857.1.52114 WP_001289857.1.52121 WP_001289857.1.52123 WP_001289857.1.52129 WP_001289857.1.52148 WP_001289857.1.5216 WP_001289857.1.52161 WP_001289857.1.52170 WP_001289857.1.52191 WP_001289857.1.52202 WP_001289857.1.52209 WP_001289857.1.52255 WP_001289857.1.52336 WP_001289857.1.52339 WP_001289857.1.52346 WP_001289857.1.52353 WP_001289857.1.52361 WP_001289857.1.52438 WP_001289857.1.52446 WP_001289857.1.52456 WP_001289857.1.52469 WP_001289857.1.52527 WP_001289857.1.52528 WP_001289857.1.52571 WP_001289857.1.526 WP_001289857.1.52608 WP_001289857.1.52637 WP_001289857.1.52647 WP_001289857.1.52653 WP_001289857.1.52656 WP_001289857.1.52675 WP_001289857.1.52692 WP_001289857.1.5273 WP_001289857.1.52738 WP_001289857.1.52742 WP_001289857.1.52743 WP_001289857.1.52744 WP_001289857.1.52748 WP_001289857.1.52773 WP_001289857.1.52795 WP_001289857.1.52807 WP_001289857.1.52824 WP_001289857.1.52857 WP_001289857.1.52866 WP_001289857.1.52887 WP_001289857.1.52898 WP_001289857.1.52915 WP_001289857.1.52924 WP_001289857.1.52949 WP_001289857.1.52985 WP_001289857.1.5301 WP_001289857.1.53016 WP_001289857.1.53092 WP_001289857.1.53100 WP_001289857.1.53141 WP_001289857.1.53151 WP_001289857.1.53154 WP_001289857.1.53159 WP_001289857.1.5316 WP_001289857.1.53190 WP_001289857.1.53203 WP_001289857.1.53210 WP_001289857.1.53233 WP_001289857.1.53272 WP_001289857.1.53274 WP_001289857.1.53286 WP_001289857.1.53307 WP_001289857.1.53315 WP_001289857.1.53316 WP_001289857.1.53321 WP_001289857.1.53328 WP_001289857.1.5333 WP_001289857.1.53368 WP_001289857.1.53375 WP_001289857.1.53406 WP_001289857.1.53436 WP_001289857.1.53450 WP_001289857.1.53454 WP_001289857.1.53466 WP_001289857.1.5349 WP_001289857.1.53529 WP_001289857.1.53534 WP_001289857.1.53540 WP_001289857.1.53543 WP_001289857.1.53555 WP_001289857.1.53559 WP_001289857.1.5356 WP_001289857.1.53571 WP_001289857.1.5358 WP_001289857.1.53675 WP_001289857.1.53688 WP_001289857.1.53692 WP_001289857.1.53696 WP_001289857.1.53723 WP_001289857.1.5374 WP_001289857.1.53750 WP_001289857.1.53757 WP_001289857.1.53772 WP_001289857.1.53790 WP_001289857.1.53800 WP_001289857.1.53812 WP_001289857.1.53814 WP_001289857.1.53815 WP_001289857.1.53839 WP_001289857.1.53892 WP_001289857.1.53902 WP_001289857.1.53905 WP_001289857.1.5392 WP_001289857.1.53935 WP_001289857.1.53958 WP_001289857.1.53981 WP_001289857.1.53984 WP_001289857.1.54033 WP_001289857.1.54068 WP_001289857.1.54075 WP_001289857.1.54085 WP_001289857.1.54132 WP_001289857.1.54136 WP_001289857.1.5415 WP_001289857.1.54159 WP_001289857.1.54170 WP_001289857.1.54175 WP_001289857.1.54196 WP_001289857.1.542 WP_001289857.1.54203 WP_001289857.1.54209 WP_001289857.1.54259 WP_001289857.1.54271 WP_001289857.1.54273 WP_001289857.1.54274 WP_001289857.1.5430 WP_001289857.1.54319 WP_001289857.1.54324 WP_001289857.1.54333 WP_001289857.1.54364 WP_001289857.1.54371 WP_001289857.1.54400 WP_001289857.1.54442 WP_001289857.1.54482 WP_001289857.1.54522 WP_001289857.1.54526 WP_001289857.1.5456 WP_001289857.1.54569 WP_001289857.1.54589 WP_001289857.1.5459 WP_001289857.1.54607 WP_001289857.1.54644 WP_001289857.1.54662 WP_001289857.1.54667 WP_001289857.1.54678 WP_001289857.1.54681 WP_001289857.1.54694 WP_001289857.1.54722 WP_001289857.1.54748 WP_001289857.1.54749 WP_001289857.1.54764 WP_001289857.1.54774 WP_001289857.1.5481 WP_001289857.1.54814 WP_001289857.1.54822 WP_001289857.1.54827 WP_001289857.1.54845 WP_001289857.1.5485 WP_001289857.1.54865 WP_001289857.1.5493 WP_001289857.1.54935 WP_001289857.1.54979 WP_001289857.1.54984 WP_001289857.1.54992 WP_001289857.1.55008 WP_001289857.1.55010 WP_001289857.1.55034 WP_001289857.1.55073 WP_001289857.1.55152 WP_001289857.1.55156 WP_001289857.1.55163 WP_001289857.1.55165 WP_001289857.1.55166 WP_001289857.1.55178 WP_001289857.1.55215 WP_001289857.1.55224 WP_001289857.1.5523 WP_001289857.1.5525 WP_001289857.1.5527 WP_001289857.1.55285 WP_001289857.1.55294 WP_001289857.1.55310 WP_001289857.1.55317 WP_001289857.1.55325 WP_001289857.1.55361 WP_001289857.1.55379 WP_001289857.1.5539 WP_001289857.1.55418 WP_001289857.1.55430 WP_001289857.1.55461 WP_001289857.1.55468 WP_001289857.1.55475 WP_001289857.1.55477 WP_001289857.1.55496 WP_001289857.1.5552 WP_001289857.1.55528 WP_001289857.1.55545 WP_001289857.1.5555 WP_001289857.1.55557 WP_001289857.1.5560 WP_001289857.1.55604 WP_001289857.1.55614 WP_001289857.1.55639 WP_001289857.1.55647 WP_001289857.1.55672 WP_001289857.1.55680 WP_001289857.1.55706 WP_001289857.1.55718 WP_001289857.1.55725 WP_001289857.1.55743 WP_001289857.1.55768 WP_001289857.1.55780 WP_001289857.1.55782 WP_001289857.1.55796 WP_001289857.1.55803 WP_001289857.1.55967 WP_001289857.1.55973 WP_001289857.1.55993 WP_001289857.1.55995 WP_001289857.1.56002 WP_001289857.1.56012 WP_001289857.1.56026 WP_001289857.1.56059 WP_001289857.1.56069 WP_001289857.1.56082 WP_001289857.1.56100 WP_001289857.1.56105 WP_001289857.1.56130 WP_001289857.1.56144 WP_001289857.1.56152 WP_001289857.1.56172 WP_001289857.1.5621 WP_001289857.1.56222 WP_001289857.1.56226 WP_001289857.1.56238 WP_001289857.1.56244 WP_001289857.1.56261 WP_001289857.1.56286 WP_001289857.1.56304 WP_001289857.1.56305 WP_001289857.1.5633 WP_001289857.1.56385 WP_001289857.1.56389 WP_001289857.1.56396 WP_001289857.1.56414 WP_001289857.1.56419 WP_001289857.1.56423 WP_001289857.1.56438 WP_001289857.1.56468 WP_001289857.1.56512 WP_001289857.1.56514 WP_001289857.1.56535 WP_001289857.1.56559 WP_001289857.1.56585 WP_001289857.1.56597 WP_001289857.1.56601 WP_001289857.1.56614 WP_001289857.1.56615 WP_001289857.1.56647 WP_001289857.1.56651 WP_001289857.1.56660 WP_001289857.1.56671 WP_001289857.1.56682 WP_001289857.1.56724 WP_001289857.1.56824 WP_001289857.1.56825 WP_001289857.1.56853 WP_001289857.1.56875 WP_001289857.1.56877 WP_001289857.1.56887 WP_001289857.1.56889 WP_001289857.1.56893 WP_001289857.1.56905 WP_001289857.1.56981 WP_001289857.1.57000 WP_001289857.1.57076 WP_001289857.1.57084 WP_001289857.1.57101 WP_001289857.1.57125 WP_001289857.1.57147 WP_001289857.1.57168 WP_001289857.1.57179 WP_001289857.1.57186 WP_001289857.1.57187 WP_001289857.1.57232 WP_001289857.1.57233 WP_001289857.1.57307 WP_001289857.1.57342 WP_001289857.1.57344 WP_001289857.1.57356 WP_001289857.1.57377 WP_001289857.1.57399 WP_001289857.1.57418 WP_001289857.1.57433 WP_001289857.1.57494 WP_001289857.1.57495 WP_001289857.1.57510 WP_001289857.1.57515 WP_001289857.1.57529 WP_001289857.1.5753 WP_001289857.1.57534 WP_001289857.1.57555 WP_001289857.1.57576 WP_001289857.1.57601 WP_001289857.1.57607 WP_001289857.1.57684 WP_001289857.1.57699 WP_001289857.1.57709 WP_001289857.1.57710 WP_001289857.1.5774 WP_001289857.1.57763 WP_001289857.1.57778 WP_001289857.1.57781 WP_001289857.1.57785 WP_001289857.1.57797 WP_001289857.1.57800 WP_001289857.1.5781 WP_001289857.1.57862 WP_001289857.1.57873 WP_001289857.1.57890 WP_001289857.1.57891 WP_001289857.1.57902 WP_001289857.1.57965 WP_001289857.1.57972 WP_001289857.1.57978 WP_001289857.1.58008 WP_001289857.1.5801 WP_001289857.1.58040 WP_001289857.1.58041 WP_001289857.1.58044 WP_001289857.1.58081 WP_001289857.1.5809 WP_001289857.1.58131 WP_001289857.1.58132 WP_001289857.1.58153 WP_001289857.1.58191 WP_001289857.1.58194 WP_001289857.1.58239 WP_001289857.1.58252 WP_001289857.1.58261 WP_001289857.1.58274 WP_001289857.1.58282 WP_001289857.1.58324 WP_001289857.1.58326 WP_001289857.1.58334 WP_001289857.1.58358 WP_001289857.1.5836 WP_001289857.1.58372 WP_001289857.1.58407 WP_001289857.1.58416 WP_001289857.1.58442 WP_001289857.1.58451 WP_001289857.1.5846 WP_001289857.1.58485 WP_001289857.1.58537 WP_001289857.1.5854 WP_001289857.1.58548 WP_001289857.1.58568 WP_001289857.1.5858 WP_001289857.1.58583 WP_001289857.1.58604 WP_001289857.1.58633 WP_001289857.1.58652 WP_001289857.1.58662 WP_001289857.1.58663 WP_001289857.1.58669 WP_001289857.1.58724 WP_001289857.1.58729 WP_001289857.1.58744 WP_001289857.1.5875 WP_001289857.1.5878 WP_001289857.1.58796 WP_001289857.1.58803 WP_001289857.1.58807 WP_001289857.1.58831 WP_001289857.1.58834 WP_001289857.1.58836 WP_001289857.1.5886 WP_001289857.1.58861 WP_001289857.1.58883 WP_001289857.1.58949 WP_001289857.1.58963 WP_001289857.1.58970 WP_001289857.1.58974 WP_001289857.1.59006 WP_001289857.1.59012 WP_001289857.1.59020 WP_001289857.1.59043 WP_001289857.1.59056 WP_001289857.1.59061 WP_001289857.1.59064 WP_001289857.1.59084 WP_001289857.1.59094 WP_001289857.1.59136 WP_001289857.1.59148 WP_001289857.1.59224 WP_001289857.1.59236 WP_001289857.1.59282 WP_001289857.1.5929 WP_001289857.1.59294 WP_001289857.1.59295 WP_001289857.1.59299 WP_001289857.1.59313 WP_001289857.1.59336 WP_001289857.1.59375 WP_001289857.1.59381 WP_001289857.1.59412 WP_001289857.1.59420 WP_001289857.1.59458 WP_001289857.1.5949 WP_001289857.1.59490 WP_001289857.1.59501 WP_001289857.1.59508 WP_001289857.1.59510 WP_001289857.1.59521 WP_001289857.1.5953 WP_001289857.1.59562 WP_001289857.1.59604 WP_001289857.1.59636 WP_001289857.1.59641 WP_001289857.1.59648 WP_001289857.1.59684 WP_001289857.1.5969 WP_001289857.1.59694 WP_001289857.1.59709 WP_001289857.1.59751 WP_001289857.1.59771 WP_001289857.1.5979 WP_001289857.1.59827 WP_001289857.1.59829 WP_001289857.1.59830 WP_001289857.1.59847 WP_001289857.1.59863 WP_001289857.1.5993 WP_001289857.1.59953 WP_001289857.1.59969 WP_001289857.1.59979 WP_001289857.1.59994 WP_001289857.1.60008 WP_001289857.1.60015 WP_001289857.1.60021 WP_001289857.1.60045 WP_001289857.1.60052 WP_001289857.1.60069 WP_001289857.1.60076 WP_001289857.1.60106 WP_001289857.1.60114 WP_001289857.1.60140 WP_001289857.1.60154 WP_001289857.1.60155 WP_001289857.1.60168 WP_001289857.1.60192 WP_001289857.1.60199 WP_001289857.1.60209 WP_001289857.1.60212 WP_001289857.1.60213 WP_001289857.1.60231 WP_001289857.1.60253 WP_001289857.1.60285 WP_001289857.1.60322 WP_001289857.1.60324 WP_001289857.1.60356 WP_001289857.1.60370 WP_001289857.1.60379 WP_001289857.1.6038 WP_001289857.1.60380 WP_001289857.1.6041 WP_001289857.1.60424 WP_001289857.1.60464 WP_001289857.1.60481 WP_001289857.1.60486 WP_001289857.1.605 WP_001289857.1.60503 WP_001289857.1.60545 WP_001289857.1.60561 WP_001289857.1.6058 WP_001289857.1.60584 WP_001289857.1.60597 WP_001289857.1.6060 WP_001289857.1.60622 WP_001289857.1.60643 WP_001289857.1.60676 WP_001289857.1.60708 WP_001289857.1.60725 WP_001289857.1.60760 WP_001289857.1.60772 WP_001289857.1.60792 WP_001289857.1.60794 WP_001289857.1.60807 WP_001289857.1.60851 WP_001289857.1.60857 WP_001289857.1.6086 WP_001289857.1.60863 WP_001289857.1.60874 WP_001289857.1.60882 WP_001289857.1.60889 WP_001289857.1.6090 WP_001289857.1.60919 WP_001289857.1.60941 WP_001289857.1.60950 WP_001289857.1.60976 WP_001289857.1.60988 WP_001289857.1.6104 WP_001289857.1.61044 WP_001289857.1.61045 WP_001289857.1.61076 WP_001289857.1.61078 WP_001289857.1.61114 WP_001289857.1.61123 WP_001289857.1.6114 WP_001289857.1.61146 WP_001289857.1.61147 WP_001289857.1.61168 WP_001289857.1.61200 WP_001289857.1.61210 WP_001289857.1.61218 WP_001289857.1.61232 WP_001289857.1.6129 WP_001289857.1.61296 WP_001289857.1.61345 WP_001289857.1.61357 WP_001289857.1.61417 WP_001289857.1.61497 WP_001289857.1.61511 WP_001289857.1.61519 WP_001289857.1.61539 WP_001289857.1.61542 WP_001289857.1.61553 WP_001289857.1.61574 WP_001289857.1.61582 WP_001289857.1.61609 WP_001289857.1.6164 WP_001289857.1.61649 WP_001289857.1.61652 WP_001289857.1.61662 WP_001289857.1.61667 WP_001289857.1.61697 WP_001289857.1.61712 WP_001289857.1.61714 WP_001289857.1.61730 WP_001289857.1.61732 WP_001289857.1.61737 WP_001289857.1.61743 WP_001289857.1.61809 WP_001289857.1.61857 WP_001289857.1.61877 WP_001289857.1.6190 WP_001289857.1.61918 WP_001289857.1.61920 WP_001289857.1.61922 WP_001289857.1.61924 WP_001289857.1.61952 WP_001289857.1.61968 WP_001289857.1.62007 WP_001289857.1.62020 WP_001289857.1.62025 WP_001289857.1.6209 WP_001289857.1.62120 WP_001289857.1.62122 WP_001289857.1.62124 WP_001289857.1.62144 WP_001289857.1.62184 WP_001289857.1.62199 WP_001289857.1.62204 WP_001289857.1.62223 WP_001289857.1.62257 WP_001289857.1.62271 WP_001289857.1.62302 WP_001289857.1.62304 WP_001289857.1.62314 WP_001289857.1.62323 WP_001289857.1.62333 WP_001289857.1.62338 WP_001289857.1.62339 WP_001289857.1.62361 WP_001289857.1.62364 WP_001289857.1.62374 WP_001289857.1.62380 WP_001289857.1.62403 WP_001289857.1.62404 WP_001289857.1.62411 WP_001289857.1.62436 WP_001289857.1.62475 WP_001289857.1.62488 WP_001289857.1.62504 WP_001289857.1.62522 WP_001289857.1.6253 WP_001289857.1.62536 WP_001289857.1.62564 WP_001289857.1.62570 WP_001289857.1.62619 WP_001289857.1.62640 WP_001289857.1.62648 WP_001289857.1.62677 WP_001289857.1.62686 WP_001289857.1.62693 WP_001289857.1.62751 WP_001289857.1.62825 WP_001289857.1.62828 WP_001289857.1.62853 WP_001289857.1.62903 WP_001289857.1.62910 WP_001289857.1.62913 WP_001289857.1.62932 WP_001289857.1.62955 WP_001289857.1.62960 WP_001289857.1.62976 WP_001289857.1.63016 WP_001289857.1.63025 WP_001289857.1.63063 WP_001289857.1.63069 WP_001289857.1.63087 WP_001289857.1.63129 WP_001289857.1.63155 WP_001289857.1.63169 WP_001289857.1.63181 WP_001289857.1.63186 WP_001289857.1.63203 WP_001289857.1.63243 WP_001289857.1.63250 WP_001289857.1.63256 WP_001289857.1.63290 WP_001289857.1.63297 WP_001289857.1.63382 WP_001289857.1.63422 WP_001289857.1.63448 WP_001289857.1.63455 WP_001289857.1.63461 WP_001289857.1.63479 WP_001289857.1.63513 WP_001289857.1.63514 WP_001289857.1.63525 WP_001289857.1.63568 WP_001289857.1.6357 WP_001289857.1.63577 WP_001289857.1.63583 WP_001289857.1.63592 WP_001289857.1.63633 WP_001289857.1.63663 WP_001289857.1.63664 WP_001289857.1.63677 WP_001289857.1.63690 WP_001289857.1.63718 WP_001289857.1.63731 WP_001289857.1.63736 WP_001289857.1.6375 WP_001289857.1.63757 WP_001289857.1.63766 WP_001289857.1.63781 WP_001289857.1.63797 WP_001289857.1.63816 WP_001289857.1.63831 WP_001289857.1.63834 WP_001289857.1.63860 WP_001289857.1.63866 WP_001289857.1.63876 WP_001289857.1.63901 WP_001289857.1.63912 WP_001289857.1.63934 WP_001289857.1.63955 WP_001289857.1.63958 WP_001289857.1.63963 WP_001289857.1.63977 WP_001289857.1.6399 WP_001289857.1.64007 WP_001289857.1.64018 WP_001289857.1.64032 WP_001289857.1.64034 WP_001289857.1.64046 WP_001289857.1.64072 WP_001289857.1.64087 WP_001289857.1.6415 WP_001289857.1.64208 WP_001289857.1.6423 WP_001289857.1.64244 WP_001289857.1.64266 WP_001289857.1.64293 WP_001289857.1.64332 WP_001289857.1.6437 WP_001289857.1.64376 WP_001289857.1.64387 WP_001289857.1.644 WP_001289857.1.64403 WP_001289857.1.64471 WP_001289857.1.64501 WP_001289857.1.6451 WP_001289857.1.64538 WP_001289857.1.64632 WP_001289857.1.64645 WP_001289857.1.64648 WP_001289857.1.64649 WP_001289857.1.64654 WP_001289857.1.64662 WP_001289857.1.64663 WP_001289857.1.64667 WP_001289857.1.64674 WP_001289857.1.64690 WP_001289857.1.64702 WP_001289857.1.64709 WP_001289857.1.64710 WP_001289857.1.64744 WP_001289857.1.64757 WP_001289857.1.64781 WP_001289857.1.64817 WP_001289857.1.64831 WP_001289857.1.64847 WP_001289857.1.6487 WP_001289857.1.6489 WP_001289857.1.64891 WP_001289857.1.64894 WP_001289857.1.64919 WP_001289857.1.64972 WP_001289857.1.64974 WP_001289857.1.64977 WP_001289857.1.65016 WP_001289857.1.65018 WP_001289857.1.65027 WP_001289857.1.65028 WP_001289857.1.65052 WP_001289857.1.65054 WP_001289857.1.65075 WP_001289857.1.6514 WP_001289857.1.65163 WP_001289857.1.65168 WP_001289857.1.65171 WP_001289857.1.65172 WP_001289857.1.65185 WP_001289857.1.65191 WP_001289857.1.65200 WP_001289857.1.65211 WP_001289857.1.65218 WP_001289857.1.65226 WP_001289857.1.65238 WP_001289857.1.65248 WP_001289857.1.65249 WP_001289857.1.6525 WP_001289857.1.65266 WP_001289857.1.65269 WP_001289857.1.65295 WP_001289857.1.65348 WP_001289857.1.6535 WP_001289857.1.65363 WP_001289857.1.65394 WP_001289857.1.65395 WP_001289857.1.65437 WP_001289857.1.65459 WP_001289857.1.65463 WP_001289857.1.65474 WP_001289857.1.65487 WP_001289857.1.6549 WP_001289857.1.65499 WP_001289857.1.65508 WP_001289857.1.65538 WP_001289857.1.6554 WP_001289857.1.65572 WP_001289857.1.65633 WP_001289857.1.6565 WP_001289857.1.65650 WP_001289857.1.65696 WP_001289857.1.65699 WP_001289857.1.6572 WP_001289857.1.65737 WP_001289857.1.6575 WP_001289857.1.65755 WP_001289857.1.65782 WP_001289857.1.65795 WP_001289857.1.65812 WP_001289857.1.65846 WP_001289857.1.65863 WP_001289857.1.65876 WP_001289857.1.6594 WP_001289857.1.65940 WP_001289857.1.65956 WP_001289857.1.65968 WP_001289857.1.65985 WP_001289857.1.66021 WP_001289857.1.66031 WP_001289857.1.66049 WP_001289857.1.66052 WP_001289857.1.66064 WP_001289857.1.66074 WP_001289857.1.66085 WP_001289857.1.66109 WP_001289857.1.66129 WP_001289857.1.66145 WP_001289857.1.66183 WP_001289857.1.6620 WP_001289857.1.66216 WP_001289857.1.66235 WP_001289857.1.66250 WP_001289857.1.66270 WP_001289857.1.66272 WP_001289857.1.66273 WP_001289857.1.6630 WP_001289857.1.66314 WP_001289857.1.66324 WP_001289857.1.66330 WP_001289857.1.6634 WP_001289857.1.66358 WP_001289857.1.66361 WP_001289857.1.66362 WP_001289857.1.66365 WP_001289857.1.66368 WP_001289857.1.6638 WP_001289857.1.6640 WP_001289857.1.6647 WP_001289857.1.66480 WP_001289857.1.66600 WP_001289857.1.66630 WP_001289857.1.66665 WP_001289857.1.66678 WP_001289857.1.66681 WP_001289857.1.66684 WP_001289857.1.66698 WP_001289857.1.66702 WP_001289857.1.66755 WP_001289857.1.66759 WP_001289857.1.66779 WP_001289857.1.6680 WP_001289857.1.66800 WP_001289857.1.66801 WP_001289857.1.66807 WP_001289857.1.66820 WP_001289857.1.66825 WP_001289857.1.66834 WP_001289857.1.66860 WP_001289857.1.66876 WP_001289857.1.66901 WP_001289857.1.66953 WP_001289857.1.66955 WP_001289857.1.66962 WP_001289857.1.66981 WP_001289857.1.67 WP_001289857.1.67024 WP_001289857.1.67037 WP_001289857.1.67042 WP_001289857.1.67045 WP_001289857.1.67100 WP_001289857.1.67101 WP_001289857.1.67143 WP_001289857.1.67181 WP_001289857.1.67211 WP_001289857.1.67235 WP_001289857.1.67237 WP_001289857.1.67268 WP_001289857.1.67288 WP_001289857.1.67336 WP_001289857.1.67339 WP_001289857.1.67347 WP_001289857.1.67387 WP_001289857.1.6739 WP_001289857.1.67394 WP_001289857.1.67397 WP_001289857.1.67403 WP_001289857.1.67405 WP_001289857.1.67442 WP_001289857.1.67465 WP_001289857.1.67539 WP_001289857.1.67552 WP_001289857.1.67556 WP_001289857.1.67576 WP_001289857.1.67603 WP_001289857.1.67604 WP_001289857.1.67617 WP_001289857.1.67619 WP_001289857.1.67625 WP_001289857.1.67627 WP_001289857.1.67633 WP_001289857.1.67637 WP_001289857.1.67641 WP_001289857.1.67657 WP_001289857.1.67673 WP_001289857.1.67682 WP_001289857.1.67700 WP_001289857.1.67707 WP_001289857.1.67718 WP_001289857.1.67729 WP_001289857.1.67731 WP_001289857.1.67774 WP_001289857.1.67803 WP_001289857.1.67814 WP_001289857.1.67827 WP_001289857.1.67829 WP_001289857.1.6785 WP_001289857.1.67887 WP_001289857.1.67905 WP_001289857.1.67910 WP_001289857.1.67924 WP_001289857.1.67954 WP_001289857.1.67969 WP_001289857.1.67970 WP_001289857.1.67977 WP_001289857.1.68 WP_001289857.1.68043 WP_001289857.1.68073 WP_001289857.1.68075 WP_001289857.1.6809 WP_001289857.1.68105 WP_001289857.1.68113 WP_001289857.1.68115 WP_001289857.1.68131 WP_001289857.1.68147 WP_001289857.1.68167 WP_001289857.1.68182 WP_001289857.1.6819 WP_001289857.1.68201 WP_001289857.1.68206 WP_001289857.1.68210 WP_001289857.1.6827 WP_001289857.1.68275 WP_001289857.1.68285 WP_001289857.1.6833 WP_001289857.1.68359 WP_001289857.1.68401 WP_001289857.1.68420 WP_001289857.1.68477 WP_001289857.1.6849 WP_001289857.1.685 WP_001289857.1.68514 WP_001289857.1.68532 WP_001289857.1.68547 WP_001289857.1.68564 WP_001289857.1.6857 WP_001289857.1.6858 WP_001289857.1.68589 WP_001289857.1.68591 WP_001289857.1.68629 WP_001289857.1.68655 WP_001289857.1.68656 WP_001289857.1.68658 WP_001289857.1.68688 WP_001289857.1.68742 WP_001289857.1.6875 WP_001289857.1.68770 WP_001289857.1.68778 WP_001289857.1.68787 WP_001289857.1.6879 WP_001289857.1.68809 WP_001289857.1.68816 WP_001289857.1.6882 WP_001289857.1.6883 WP_001289857.1.68894 WP_001289857.1.68914 WP_001289857.1.68928 WP_001289857.1.68966 WP_001289857.1.68975 WP_001289857.1.68999 WP_001289857.1.69001 WP_001289857.1.69006 WP_001289857.1.69029 WP_001289857.1.6904 WP_001289857.1.6905 WP_001289857.1.69053 WP_001289857.1.6907 WP_001289857.1.6913 WP_001289857.1.69139 WP_001289857.1.69146 WP_001289857.1.69151 WP_001289857.1.69170 WP_001289857.1.69210 WP_001289857.1.69255 WP_001289857.1.69270 WP_001289857.1.69282 WP_001289857.1.69320 WP_001289857.1.69359 WP_001289857.1.69371 WP_001289857.1.69376 WP_001289857.1.69385 WP_001289857.1.69396 WP_001289857.1.69397 WP_001289857.1.69465 WP_001289857.1.69466 WP_001289857.1.69515 WP_001289857.1.6954 WP_001289857.1.69554 WP_001289857.1.69564 WP_001289857.1.69588 WP_001289857.1.69597 WP_001289857.1.69611 WP_001289857.1.69636 WP_001289857.1.69642 WP_001289857.1.69644 WP_001289857.1.69656 WP_001289857.1.69657 WP_001289857.1.69690 WP_001289857.1.69696 WP_001289857.1.69704 WP_001289857.1.69710 WP_001289857.1.69754 WP_001289857.1.69758 WP_001289857.1.69760 WP_001289857.1.69785 WP_001289857.1.69787 WP_001289857.1.69790 WP_001289857.1.69807 WP_001289857.1.69808 WP_001289857.1.69848 WP_001289857.1.69923 WP_001289857.1.69948 WP_001289857.1.69953 WP_001289857.1.69975 WP_001289857.1.69977 WP_001289857.1.69982 WP_001289857.1.70003 WP_001289857.1.70010 WP_001289857.1.70028 WP_001289857.1.70047 WP_001289857.1.70049 WP_001289857.1.70058 WP_001289857.1.70061 WP_001289857.1.70087 WP_001289857.1.7016 WP_001289857.1.70169 WP_001289857.1.70205 WP_001289857.1.7021 WP_001289857.1.70240 WP_001289857.1.70241 WP_001289857.1.70248 WP_001289857.1.70249 WP_001289857.1.70261 WP_001289857.1.70269 WP_001289857.1.70281 WP_001289857.1.70289 WP_001289857.1.70290 WP_001289857.1.70314 WP_001289857.1.70321 WP_001289857.1.70327 WP_001289857.1.7033 WP_001289857.1.70355 WP_001289857.1.70427 WP_001289857.1.70433 WP_001289857.1.7044 WP_001289857.1.70447 WP_001289857.1.70485 WP_001289857.1.70491 WP_001289857.1.70545 WP_001289857.1.7055 WP_001289857.1.70623 WP_001289857.1.70643 WP_001289857.1.70644 WP_001289857.1.70671 WP_001289857.1.70679 WP_001289857.1.70683 WP_001289857.1.70708 WP_001289857.1.70717 WP_001289857.1.70732 WP_001289857.1.70733 WP_001289857.1.70761 WP_001289857.1.70772 WP_001289857.1.70792 WP_001289857.1.70797 WP_001289857.1.70845 WP_001289857.1.70846 WP_001289857.1.70869 WP_001289857.1.70883 WP_001289857.1.70899 WP_001289857.1.70922 WP_001289857.1.7093 WP_001289857.1.70948 WP_001289857.1.70959 WP_001289857.1.70969 WP_001289857.1.70971 WP_001289857.1.70981 WP_001289857.1.70986 WP_001289857.1.70995 WP_001289857.1.71023 WP_001289857.1.71039 WP_001289857.1.71057 WP_001289857.1.71069 WP_001289857.1.71081 WP_001289857.1.71088 WP_001289857.1.7110 WP_001289857.1.71116 WP_001289857.1.71117 WP_001289857.1.71146 WP_001289857.1.71150 WP_001289857.1.71165 WP_001289857.1.71186 WP_001289857.1.71188 WP_001289857.1.71202 WP_001289857.1.71243 WP_001289857.1.71268 WP_001289857.1.71299 WP_001289857.1.71306 WP_001289857.1.71337 WP_001289857.1.7134 WP_001289857.1.71363 WP_001289857.1.71368 WP_001289857.1.71378 WP_001289857.1.714 WP_001289857.1.71401 WP_001289857.1.71407 WP_001289857.1.71418 WP_001289857.1.71446 WP_001289857.1.71450 WP_001289857.1.71452 WP_001289857.1.71455 WP_001289857.1.71456 WP_001289857.1.71481 WP_001289857.1.71487 WP_001289857.1.71500 WP_001289857.1.71523 WP_001289857.1.71542 WP_001289857.1.71566 WP_001289857.1.71583 WP_001289857.1.71636 WP_001289857.1.71640 WP_001289857.1.71651 WP_001289857.1.71653 WP_001289857.1.71667 WP_001289857.1.71691 WP_001289857.1.71702 WP_001289857.1.71716 WP_001289857.1.7174 WP_001289857.1.71750 WP_001289857.1.71756 WP_001289857.1.71798 WP_001289857.1.71845 WP_001289857.1.71872 WP_001289857.1.71881 WP_001289857.1.71908 WP_001289857.1.71923 WP_001289857.1.71929 WP_001289857.1.71950 WP_001289857.1.71952 WP_001289857.1.71954 WP_001289857.1.71973 WP_001289857.1.71985 WP_001289857.1.72003 WP_001289857.1.72068 WP_001289857.1.72073 WP_001289857.1.72105 WP_001289857.1.72119 WP_001289857.1.72188 WP_001289857.1.72203 WP_001289857.1.72220 WP_001289857.1.72226 WP_001289857.1.72234 WP_001289857.1.72243 WP_001289857.1.72269 WP_001289857.1.72277 WP_001289857.1.72283 WP_001289857.1.72307 WP_001289857.1.72350 WP_001289857.1.72372 WP_001289857.1.72376 WP_001289857.1.72382 WP_001289857.1.72383 WP_001289857.1.72403 WP_001289857.1.72412 WP_001289857.1.7243 WP_001289857.1.72438 WP_001289857.1.72461 WP_001289857.1.72527 WP_001289857.1.7255 WP_001289857.1.72594 WP_001289857.1.72629 WP_001289857.1.72631 WP_001289857.1.72638 WP_001289857.1.72642 WP_001289857.1.72667 WP_001289857.1.72671 WP_001289857.1.72674 WP_001289857.1.72689 WP_001289857.1.72724 WP_001289857.1.72728 WP_001289857.1.72789 WP_001289857.1.72793 WP_001289857.1.72827 WP_001289857.1.72828 WP_001289857.1.72843 WP_001289857.1.72850 WP_001289857.1.72871 WP_001289857.1.72887 WP_001289857.1.72892 WP_001289857.1.72894 WP_001289857.1.72896 WP_001289857.1.72897 WP_001289857.1.72944 WP_001289857.1.72968 WP_001289857.1.72969 WP_001289857.1.72975 WP_001289857.1.72987 WP_001289857.1.7304 WP_001289857.1.73052 WP_001289857.1.73062 WP_001289857.1.73125 WP_001289857.1.7315 WP_001289857.1.7316 WP_001289857.1.73164 WP_001289857.1.73177 WP_001289857.1.73180 WP_001289857.1.73200 WP_001289857.1.73258 WP_001289857.1.73285 WP_001289857.1.7332 WP_001289857.1.73328 WP_001289857.1.7333 WP_001289857.1.7334 WP_001289857.1.73352 WP_001289857.1.73377 WP_001289857.1.73389 WP_001289857.1.7341 WP_001289857.1.73425 WP_001289857.1.73461 WP_001289857.1.73481 WP_001289857.1.73488 WP_001289857.1.73504 WP_001289857.1.73512 WP_001289857.1.7353 WP_001289857.1.73535 WP_001289857.1.73544 WP_001289857.1.7356 WP_001289857.1.73561 WP_001289857.1.73581 WP_001289857.1.73596 WP_001289857.1.73598 WP_001289857.1.7361 WP_001289857.1.73617 WP_001289857.1.73648 WP_001289857.1.73667 WP_001289857.1.73669 WP_001289857.1.73701 WP_001289857.1.7374 WP_001289857.1.73753 WP_001289857.1.73758 WP_001289857.1.73768 WP_001289857.1.73794 WP_001289857.1.73804 WP_001289857.1.73831 WP_001289857.1.73847 WP_001289857.1.73849 WP_001289857.1.7386 WP_001289857.1.7387 WP_001289857.1.73901 WP_001289857.1.73924 WP_001289857.1.73926 WP_001289857.1.7394 WP_001289857.1.73945 WP_001289857.1.73948 WP_001289857.1.73956 WP_001289857.1.73965 WP_001289857.1.73999 WP_001289857.1.74024 WP_001289857.1.74028 WP_001289857.1.74029 WP_001289857.1.74030 WP_001289857.1.74038 WP_001289857.1.74043 WP_001289857.1.74049 WP_001289857.1.7405 WP_001289857.1.74058 WP_001289857.1.74070 WP_001289857.1.74077 WP_001289857.1.74089 WP_001289857.1.74117 WP_001289857.1.74135 WP_001289857.1.74181 WP_001289857.1.74191 WP_001289857.1.74214 WP_001289857.1.74228 WP_001289857.1.74241 WP_001289857.1.74285 WP_001289857.1.7430 WP_001289857.1.74317 WP_001289857.1.7433 WP_001289857.1.74379 WP_001289857.1.74410 WP_001289857.1.74414 WP_001289857.1.74415 WP_001289857.1.74418 WP_001289857.1.74422 WP_001289857.1.74428 WP_001289857.1.74454 WP_001289857.1.74466 WP_001289857.1.74469 WP_001289857.1.74481 WP_001289857.1.745 WP_001289857.1.74529 WP_001289857.1.7458 WP_001289857.1.74616 WP_001289857.1.74621 WP_001289857.1.74632 WP_001289857.1.74644 WP_001289857.1.74647 WP_001289857.1.74661 WP_001289857.1.74699 WP_001289857.1.74702 WP_001289857.1.74745 WP_001289857.1.74757 WP_001289857.1.74807 WP_001289857.1.74826 WP_001289857.1.74831 WP_001289857.1.74884 WP_001289857.1.74894 WP_001289857.1.7491 WP_001289857.1.74929 WP_001289857.1.74939 WP_001289857.1.74946 WP_001289857.1.74973 WP_001289857.1.74992 WP_001289857.1.75009 WP_001289857.1.75058 WP_001289857.1.7507 WP_001289857.1.75089 WP_001289857.1.75116 WP_001289857.1.75129 WP_001289857.1.75134 WP_001289857.1.75168 WP_001289857.1.75177 WP_001289857.1.75187 WP_001289857.1.75237 WP_001289857.1.75288 WP_001289857.1.75296 WP_001289857.1.75301 WP_001289857.1.75334 WP_001289857.1.75362 WP_001289857.1.75385 WP_001289857.1.75392 WP_001289857.1.75402 WP_001289857.1.75413 WP_001289857.1.7543 WP_001289857.1.75433 WP_001289857.1.75494 WP_001289857.1.75532 WP_001289857.1.75565 WP_001289857.1.75585 WP_001289857.1.75593 WP_001289857.1.75609 WP_001289857.1.75610 WP_001289857.1.75626 WP_001289857.1.75633 WP_001289857.1.75664 WP_001289857.1.75703 WP_001289857.1.75718 WP_001289857.1.75740 WP_001289857.1.75745 WP_001289857.1.75760 WP_001289857.1.75764 WP_001289857.1.75828 WP_001289857.1.75837 WP_001289857.1.75844 WP_001289857.1.75873 WP_001289857.1.75874 WP_001289857.1.75884 WP_001289857.1.75886 WP_001289857.1.75898 WP_001289857.1.75945 WP_001289857.1.75957 WP_001289857.1.76 WP_001289857.1.76020 WP_001289857.1.76024 WP_001289857.1.76055 WP_001289857.1.76081 WP_001289857.1.76097 WP_001289857.1.76102 WP_001289857.1.76116 WP_001289857.1.76162 WP_001289857.1.76164 WP_001289857.1.76170 WP_001289857.1.76186 WP_001289857.1.76197 WP_001289857.1.76252 WP_001289857.1.76256 WP_001289857.1.7629 WP_001289857.1.76301 WP_001289857.1.76327 WP_001289857.1.76339 WP_001289857.1.7634 WP_001289857.1.76364 WP_001289857.1.76366 WP_001289857.1.76417 WP_001289857.1.76445 WP_001289857.1.7646 WP_001289857.1.76510 WP_001289857.1.76529 WP_001289857.1.76532 WP_001289857.1.76548 WP_001289857.1.7655 WP_001289857.1.76558 WP_001289857.1.7657 WP_001289857.1.76572 WP_001289857.1.76576 WP_001289857.1.7660 WP_001289857.1.76641 WP_001289857.1.76651 WP_001289857.1.76653 WP_001289857.1.76673 WP_001289857.1.76706 WP_001289857.1.7672 WP_001289857.1.76721 WP_001289857.1.76724 WP_001289857.1.76756 WP_001289857.1.76760 WP_001289857.1.76788 WP_001289857.1.76799 WP_001289857.1.76806 WP_001289857.1.7684 WP_001289857.1.76854 WP_001289857.1.76866 WP_001289857.1.76875 WP_001289857.1.76880 WP_001289857.1.76899 WP_001289857.1.76916 WP_001289857.1.76932 WP_001289857.1.76973 WP_001289857.1.76988 WP_001289857.1.77016 WP_001289857.1.77017 WP_001289857.1.77033 WP_001289857.1.77038 WP_001289857.1.77047 WP_001289857.1.77080 WP_001289857.1.77087 WP_001289857.1.77090 WP_001289857.1.77111 WP_001289857.1.7712 WP_001289857.1.77177 WP_001289857.1.77180 WP_001289857.1.77184 WP_001289857.1.77193 WP_001289857.1.77241 WP_001289857.1.77244 WP_001289857.1.77267 WP_001289857.1.77271 WP_001289857.1.77292 WP_001289857.1.77299 WP_001289857.1.77313 WP_001289857.1.77349 WP_001289857.1.77384 WP_001289857.1.77390 WP_001289857.1.77431 WP_001289857.1.77440 WP_001289857.1.77501 WP_001289857.1.77512 WP_001289857.1.77513 WP_001289857.1.77514 WP_001289857.1.77529 WP_001289857.1.77549 WP_001289857.1.77555 WP_001289857.1.77563 WP_001289857.1.77629 WP_001289857.1.77646 WP_001289857.1.77653 WP_001289857.1.77692 WP_001289857.1.77702 WP_001289857.1.77713 WP_001289857.1.7772 WP_001289857.1.77729 WP_001289857.1.77761 WP_001289857.1.7782 WP_001289857.1.77825 WP_001289857.1.77837 WP_001289857.1.77846 WP_001289857.1.77851 WP_001289857.1.77871 WP_001289857.1.77898 WP_001289857.1.77900 WP_001289857.1.77918 WP_001289857.1.77923 WP_001289857.1.77960 WP_001289857.1.77971 WP_001289857.1.77975 WP_001289857.1.77987 WP_001289857.1.78 WP_001289857.1.78016 WP_001289857.1.78026 WP_001289857.1.78033 WP_001289857.1.78035 WP_001289857.1.78048 WP_001289857.1.78076 WP_001289857.1.78096 WP_001289857.1.78100 WP_001289857.1.78107 WP_001289857.1.78110 WP_001289857.1.78120 WP_001289857.1.7814 WP_001289857.1.78166 WP_001289857.1.78170 WP_001289857.1.78180 WP_001289857.1.78195 WP_001289857.1.78201 WP_001289857.1.78245 WP_001289857.1.78259 WP_001289857.1.78291 WP_001289857.1.78301 WP_001289857.1.78309 WP_001289857.1.78320 WP_001289857.1.78339 WP_001289857.1.78366 WP_001289857.1.78372 WP_001289857.1.78382 WP_001289857.1.78383 WP_001289857.1.78388 WP_001289857.1.78407 WP_001289857.1.78410 WP_001289857.1.78495 WP_001289857.1.78496 WP_001289857.1.7861 WP_001289857.1.78618 WP_001289857.1.7862 WP_001289857.1.78626 WP_001289857.1.78661 WP_001289857.1.78673 WP_001289857.1.78674 WP_001289857.1.78676 WP_001289857.1.78735 WP_001289857.1.78738 WP_001289857.1.78761 WP_001289857.1.78802 WP_001289857.1.78830 WP_001289857.1.78835 WP_001289857.1.78838 WP_001289857.1.78862 WP_001289857.1.78871 WP_001289857.1.78874 WP_001289857.1.78881 WP_001289857.1.789 WP_001289857.1.7891 WP_001289857.1.78913 WP_001289857.1.78918 WP_001289857.1.78930 WP_001289857.1.78951 WP_001289857.1.78993 WP_001289857.1.79012 WP_001289857.1.79032 WP_001289857.1.79069 WP_001289857.1.79074 WP_001289857.1.79081 WP_001289857.1.79098 WP_001289857.1.79140 WP_001289857.1.79151 WP_001289857.1.79155 WP_001289857.1.79164 WP_001289857.1.79167 WP_001289857.1.79189 WP_001289857.1.79203 WP_001289857.1.79204 WP_001289857.1.79235 WP_001289857.1.79280 WP_001289857.1.79302 WP_001289857.1.79335 WP_001289857.1.79370 WP_001289857.1.79397 WP_001289857.1.794 WP_001289857.1.79456 WP_001289857.1.79462 WP_001289857.1.79466 WP_001289857.1.79472 WP_001289857.1.79490 WP_001289857.1.79495 WP_001289857.1.79529 WP_001289857.1.79532 WP_001289857.1.79547 WP_001289857.1.7956 WP_001289857.1.79570 WP_001289857.1.7964 WP_001289857.1.79642 WP_001289857.1.79645 WP_001289857.1.79654 WP_001289857.1.79659 WP_001289857.1.79668 WP_001289857.1.7970 WP_001289857.1.79708 WP_001289857.1.7972 WP_001289857.1.79722 WP_001289857.1.79734 WP_001289857.1.79738 WP_001289857.1.79772 WP_001289857.1.79778 WP_001289857.1.7979 WP_001289857.1.79832 WP_001289857.1.79845 WP_001289857.1.79867 WP_001289857.1.79880 WP_001289857.1.79910 WP_001289857.1.79916 WP_001289857.1.79929 WP_001289857.1.7994 WP_001289857.1.79942 WP_001289857.1.79945 WP_001289857.1.79951 WP_001289857.1.79966 WP_001289857.1.79996 WP_001289857.1.80065 WP_001289857.1.80077 WP_001289857.1.80103 WP_001289857.1.80137 WP_001289857.1.80149 WP_001289857.1.80182 WP_001289857.1.80229 WP_001289857.1.80236 WP_001289857.1.8024 WP_001289857.1.80250 WP_001289857.1.80273 WP_001289857.1.80282 WP_001289857.1.80293 WP_001289857.1.80296 WP_001289857.1.80333 WP_001289857.1.80354 WP_001289857.1.80366 WP_001289857.1.80368 WP_001289857.1.80386 WP_001289857.1.80400 WP_001289857.1.80441 WP_001289857.1.80443 WP_001289857.1.80448 WP_001289857.1.80462 WP_001289857.1.80473 WP_001289857.1.80480 WP_001289857.1.8049 WP_001289857.1.80492 WP_001289857.1.80496 WP_001289857.1.80529 WP_001289857.1.80542 WP_001289857.1.80569 WP_001289857.1.80586 WP_001289857.1.80629 WP_001289857.1.80638 WP_001289857.1.80651 WP_001289857.1.80664 WP_001289857.1.80667 WP_001289857.1.80674 WP_001289857.1.80696 WP_001289857.1.80707 WP_001289857.1.80723 WP_001289857.1.80725 WP_001289857.1.80741 WP_001289857.1.80750 WP_001289857.1.80757 WP_001289857.1.80780 WP_001289857.1.80803 WP_001289857.1.80819 WP_001289857.1.80827 WP_001289857.1.80831 WP_001289857.1.80840 WP_001289857.1.80850 WP_001289857.1.80857 WP_001289857.1.80868 WP_001289857.1.80881 WP_001289857.1.80913 WP_001289857.1.80927 WP_001289857.1.80939 WP_001289857.1.80959 WP_001289857.1.8096 WP_001289857.1.80973 WP_001289857.1.80984 WP_001289857.1.81037 WP_001289857.1.81062 WP_001289857.1.81067 WP_001289857.1.81069 WP_001289857.1.81118 WP_001289857.1.81131 WP_001289857.1.81149 WP_001289857.1.81175 WP_001289857.1.81187 WP_001289857.1.8119 WP_001289857.1.81193 WP_001289857.1.81231 WP_001289857.1.81262 WP_001289857.1.81268 WP_001289857.1.81269 WP_001289857.1.8127 WP_001289857.1.81271 WP_001289857.1.81275 WP_001289857.1.81302 WP_001289857.1.81305 WP_001289857.1.8131 WP_001289857.1.81321 WP_001289857.1.81328 WP_001289857.1.81333 WP_001289857.1.81342 WP_001289857.1.81354 WP_001289857.1.81364 WP_001289857.1.81404 WP_001289857.1.81409 WP_001289857.1.81410 WP_001289857.1.81425 WP_001289857.1.81472 WP_001289857.1.81494 WP_001289857.1.81504 WP_001289857.1.81528 WP_001289857.1.81548 WP_001289857.1.81557 WP_001289857.1.81676 WP_001289857.1.8168 WP_001289857.1.8170 WP_001289857.1.81735 WP_001289857.1.81736 WP_001289857.1.81743 WP_001289857.1.81746 WP_001289857.1.81750 WP_001289857.1.81760 WP_001289857.1.81763 WP_001289857.1.81785 WP_001289857.1.81795 WP_001289857.1.81855 WP_001289857.1.81921 WP_001289857.1.81931 WP_001289857.1.81936 WP_001289857.1.81941 WP_001289857.1.81949 WP_001289857.1.8196 WP_001289857.1.81974 WP_001289857.1.81977 WP_001289857.1.81995 WP_001289857.1.82037 WP_001289857.1.82070 WP_001289857.1.82076 WP_001289857.1.82099 WP_001289857.1.82131 WP_001289857.1.82144 WP_001289857.1.82156 WP_001289857.1.8218 WP_001289857.1.82180 WP_001289857.1.82192 WP_001289857.1.82201 WP_001289857.1.82214 WP_001289857.1.82225 WP_001289857.1.82232 WP_001289857.1.82258 WP_001289857.1.82269 WP_001289857.1.82337 WP_001289857.1.82352 WP_001289857.1.8236 WP_001289857.1.82369 WP_001289857.1.8240 WP_001289857.1.82416 WP_001289857.1.8242 WP_001289857.1.82456 WP_001289857.1.82464 WP_001289857.1.82465 WP_001289857.1.82473 WP_001289857.1.82479 WP_001289857.1.82503 WP_001289857.1.82515 WP_001289857.1.82530 WP_001289857.1.82553 WP_001289857.1.82562 WP_001289857.1.82570 WP_001289857.1.82584 WP_001289857.1.82636 WP_001289857.1.82637 WP_001289857.1.82646 WP_001289857.1.82648 WP_001289857.1.82670 WP_001289857.1.82676 WP_001289857.1.82731 WP_001289857.1.82761 WP_001289857.1.82763 WP_001289857.1.82812 WP_001289857.1.8282 WP_001289857.1.82841 WP_001289857.1.82850 WP_001289857.1.82867 WP_001289857.1.82886 WP_001289857.1.82899 WP_001289857.1.82937 WP_001289857.1.8294 WP_001289857.1.82944 WP_001289857.1.82946 WP_001289857.1.82956 WP_001289857.1.82959 WP_001289857.1.82964 WP_001289857.1.8304 WP_001289857.1.83092 WP_001289857.1.83119 WP_001289857.1.83128 WP_001289857.1.83139 WP_001289857.1.83163 WP_001289857.1.83180 WP_001289857.1.8322 WP_001289857.1.83221 WP_001289857.1.83229 WP_001289857.1.83247 WP_001289857.1.83252 WP_001289857.1.83258 WP_001289857.1.83290 WP_001289857.1.83305 WP_001289857.1.83333 WP_001289857.1.83360 WP_001289857.1.83365 WP_001289857.1.83378 WP_001289857.1.83382 WP_001289857.1.83388 WP_001289857.1.83407 WP_001289857.1.83413 WP_001289857.1.83491 WP_001289857.1.83523 WP_001289857.1.8354 WP_001289857.1.83598 WP_001289857.1.83650 WP_001289857.1.83651 WP_001289857.1.83657 WP_001289857.1.83710 WP_001289857.1.83721 WP_001289857.1.8375 WP_001289857.1.83760 WP_001289857.1.83854 WP_001289857.1.83897 WP_001289857.1.83923 WP_001289857.1.83960 WP_001289857.1.83979 WP_001289857.1.83994 WP_001289857.1.83995 WP_001289857.1.84001 WP_001289857.1.84031 WP_001289857.1.8406 WP_001289857.1.84076 WP_001289857.1.84077 WP_001289857.1.84100 WP_001289857.1.84103 WP_001289857.1.84110 WP_001289857.1.84127 WP_001289857.1.84150 WP_001289857.1.84168 WP_001289857.1.84179 WP_001289857.1.84205 WP_001289857.1.84209 WP_001289857.1.84229 WP_001289857.1.84230 WP_001289857.1.84252 WP_001289857.1.84283 WP_001289857.1.84291 WP_001289857.1.8431 WP_001289857.1.84325 WP_001289857.1.84345 WP_001289857.1.84355 WP_001289857.1.84359 WP_001289857.1.84369 WP_001289857.1.84373 WP_001289857.1.84392 WP_001289857.1.84397 WP_001289857.1.84401 WP_001289857.1.8441 WP_001289857.1.84435 WP_001289857.1.84459 WP_001289857.1.84461 WP_001289857.1.84523 WP_001289857.1.84532 WP_001289857.1.84554 WP_001289857.1.84567 WP_001289857.1.84631 WP_001289857.1.84644 WP_001289857.1.84659 WP_001289857.1.84683 WP_001289857.1.84693 WP_001289857.1.84727 WP_001289857.1.84744 WP_001289857.1.84773 WP_001289857.1.84899 WP_001289857.1.849 WP_001289857.1.84945 WP_001289857.1.84967 WP_001289857.1.8497 WP_001289857.1.850 WP_001289857.1.85004 WP_001289857.1.8502 WP_001289857.1.85031 WP_001289857.1.85039 WP_001289857.1.85040 WP_001289857.1.85094 WP_001289857.1.85134 WP_001289857.1.85153 WP_001289857.1.85178 WP_001289857.1.85180 WP_001289857.1.85190 WP_001289857.1.85217 WP_001289857.1.85273 WP_001289857.1.8533 WP_001289857.1.85338 WP_001289857.1.85339 WP_001289857.1.8537 WP_001289857.1.85408 WP_001289857.1.85433 WP_001289857.1.8545 WP_001289857.1.85456 WP_001289857.1.85469 WP_001289857.1.85481 WP_001289857.1.85483 WP_001289857.1.85511 WP_001289857.1.85512 WP_001289857.1.85541 WP_001289857.1.8556 WP_001289857.1.85568 WP_001289857.1.8557 WP_001289857.1.85606 WP_001289857.1.85615 WP_001289857.1.85617 WP_001289857.1.85635 WP_001289857.1.85646 WP_001289857.1.85654 WP_001289857.1.85663 WP_001289857.1.85665 WP_001289857.1.85669 WP_001289857.1.85671 WP_001289857.1.85672 WP_001289857.1.85675 WP_001289857.1.85688 WP_001289857.1.85703 WP_001289857.1.85723 WP_001289857.1.85728 WP_001289857.1.85746 WP_001289857.1.85777 WP_001289857.1.85780 WP_001289857.1.85784 WP_001289857.1.85811 WP_001289857.1.85855 WP_001289857.1.85864 WP_001289857.1.85886 WP_001289857.1.859 WP_001289857.1.85900 WP_001289857.1.85904 WP_001289857.1.8591 WP_001289857.1.85917 WP_001289857.1.8594 WP_001289857.1.85943 WP_001289857.1.85976 WP_001289857.1.85977 WP_001289857.1.86007 WP_001289857.1.86010 WP_001289857.1.86043 WP_001289857.1.8605 WP_001289857.1.86084 WP_001289857.1.8610 WP_001289857.1.86120 WP_001289857.1.86126 WP_001289857.1.8614 WP_001289857.1.86156 WP_001289857.1.86173 WP_001289857.1.86206 WP_001289857.1.86224 WP_001289857.1.86259 WP_001289857.1.86284 WP_001289857.1.86285 WP_001289857.1.86306 WP_001289857.1.86310 WP_001289857.1.86323 WP_001289857.1.86335 WP_001289857.1.86342 WP_001289857.1.86356 WP_001289857.1.8640 WP_001289857.1.8642 WP_001289857.1.86442 WP_001289857.1.86450 WP_001289857.1.86453 WP_001289857.1.86469 WP_001289857.1.86489 WP_001289857.1.86530 WP_001289857.1.86580 WP_001289857.1.86588 WP_001289857.1.86593 WP_001289857.1.86601 WP_001289857.1.86634 WP_001289857.1.86656 WP_001289857.1.86661 WP_001289857.1.86663 WP_001289857.1.86676 WP_001289857.1.86699 WP_001289857.1.8671 WP_001289857.1.8672 WP_001289857.1.86744 WP_001289857.1.86770 WP_001289857.1.8678 WP_001289857.1.86794 WP_001289857.1.86800 WP_001289857.1.86810 WP_001289857.1.86811 WP_001289857.1.8684 WP_001289857.1.86859 WP_001289857.1.86895 WP_001289857.1.86902 WP_001289857.1.86906 WP_001289857.1.8691 WP_001289857.1.86921 WP_001289857.1.86945 WP_001289857.1.86989 WP_001289857.1.87023 WP_001289857.1.87034 WP_001289857.1.87051 WP_001289857.1.87095 WP_001289857.1.87136 WP_001289857.1.87143 WP_001289857.1.87148 WP_001289857.1.87155 WP_001289857.1.87219 WP_001289857.1.87258 WP_001289857.1.87282 WP_001289857.1.87283 WP_001289857.1.87293 WP_001289857.1.87323 WP_001289857.1.8736 WP_001289857.1.87365 WP_001289857.1.87420 WP_001289857.1.87552 WP_001289857.1.87560 WP_001289857.1.8760 WP_001289857.1.87600 WP_001289857.1.87609 WP_001289857.1.87612 WP_001289857.1.87615 WP_001289857.1.87626 WP_001289857.1.87653 WP_001289857.1.8767 WP_001289857.1.87687 WP_001289857.1.87695 WP_001289857.1.87698 WP_001289857.1.87706 WP_001289857.1.87739 WP_001289857.1.87741 WP_001289857.1.87742 WP_001289857.1.87779 WP_001289857.1.87813 WP_001289857.1.87852 WP_001289857.1.87875 WP_001289857.1.87899 WP_001289857.1.8792 WP_001289857.1.87933 WP_001289857.1.87945 WP_001289857.1.87949 WP_001289857.1.87999 WP_001289857.1.8800 WP_001289857.1.88014 WP_001289857.1.88019 WP_001289857.1.88025 WP_001289857.1.88026 WP_001289857.1.8805 WP_001289857.1.8806 WP_001289857.1.88073 WP_001289857.1.8809 WP_001289857.1.88092 WP_001289857.1.881 WP_001289857.1.88136 WP_001289857.1.88145 WP_001289857.1.88165 WP_001289857.1.88174 WP_001289857.1.88199 WP_001289857.1.88214 WP_001289857.1.88222 WP_001289857.1.88244 WP_001289857.1.88264 WP_001289857.1.88291 WP_001289857.1.88293 WP_001289857.1.88299 WP_001289857.1.88303 WP_001289857.1.88313 WP_001289857.1.88359 WP_001289857.1.8837 WP_001289857.1.88393 WP_001289857.1.88407 WP_001289857.1.88414 WP_001289857.1.88423 WP_001289857.1.88444 WP_001289857.1.88446 WP_001289857.1.88458 WP_001289857.1.88483 WP_001289857.1.8849 WP_001289857.1.88501 WP_001289857.1.88547 WP_001289857.1.886 WP_001289857.1.88609 WP_001289857.1.88620 WP_001289857.1.88647 WP_001289857.1.88648 WP_001289857.1.88651 WP_001289857.1.88683 WP_001289857.1.88692 WP_001289857.1.88703 WP_001289857.1.88707 WP_001289857.1.88727 WP_001289857.1.88762 WP_001289857.1.88772 WP_001289857.1.88776 WP_001289857.1.88792 WP_001289857.1.88845 WP_001289857.1.88850 WP_001289857.1.8889 WP_001289857.1.88892 WP_001289857.1.88894 WP_001289857.1.88902 WP_001289857.1.8891 WP_001289857.1.88957 WP_001289857.1.88967 WP_001289857.1.88970 WP_001289857.1.88980 WP_001289857.1.88981 WP_001289857.1.88995 WP_001289857.1.89008 WP_001289857.1.89054 WP_001289857.1.89114 WP_001289857.1.89116 WP_001289857.1.89119 WP_001289857.1.89138 WP_001289857.1.89174 WP_001289857.1.89182 WP_001289857.1.89188 WP_001289857.1.89215 WP_001289857.1.89291 WP_001289857.1.89298 WP_001289857.1.89304 WP_001289857.1.89308 WP_001289857.1.89314 WP_001289857.1.89328 WP_001289857.1.89332 WP_001289857.1.89343 WP_001289857.1.89355 WP_001289857.1.89395 WP_001289857.1.8940 WP_001289857.1.89449 WP_001289857.1.89452 WP_001289857.1.89462 WP_001289857.1.8947 WP_001289857.1.89503 WP_001289857.1.89512 WP_001289857.1.89527 WP_001289857.1.89570 WP_001289857.1.8958 WP_001289857.1.89580 WP_001289857.1.89591 WP_001289857.1.89604 WP_001289857.1.89612 WP_001289857.1.89622 WP_001289857.1.89647 WP_001289857.1.89657 WP_001289857.1.89659 WP_001289857.1.89668 WP_001289857.1.89706 WP_001289857.1.89713 WP_001289857.1.89733 WP_001289857.1.89746 WP_001289857.1.89765 WP_001289857.1.89777 WP_001289857.1.89789 WP_001289857.1.89796 WP_001289857.1.89804 WP_001289857.1.89817 WP_001289857.1.89845 WP_001289857.1.89870 WP_001289857.1.89888 WP_001289857.1.89902 WP_001289857.1.89911 WP_001289857.1.89914 WP_001289857.1.89940 WP_001289857.1.8995 WP_001289857.1.89952 WP_001289857.1.8996 WP_001289857.1.89975 WP_001289857.1.90007 WP_001289857.1.90033 WP_001289857.1.90097 WP_001289857.1.90108 WP_001289857.1.9011 WP_001289857.1.90196 WP_001289857.1.90211 WP_001289857.1.90220 WP_001289857.1.90240 WP_001289857.1.90252 WP_001289857.1.90274 WP_001289857.1.90280 WP_001289857.1.90311 WP_001289857.1.90330 WP_001289857.1.90338 WP_001289857.1.90348 WP_001289857.1.90365 WP_001289857.1.90409 WP_001289857.1.90417 WP_001289857.1.90428 WP_001289857.1.90440 WP_001289857.1.90453 WP_001289857.1.90458 WP_001289857.1.90489 WP_001289857.1.90513 WP_001289857.1.90557 WP_001289857.1.90566 WP_001289857.1.90582 WP_001289857.1.90585 WP_001289857.1.90620 WP_001289857.1.90625 WP_001289857.1.9064 WP_001289857.1.90641 WP_001289857.1.90713 WP_001289857.1.90734 WP_001289857.1.90792 WP_001289857.1.90794 WP_001289857.1.90796 WP_001289857.1.90811 WP_001289857.1.90814 WP_001289857.1.90876 WP_001289857.1.90878 WP_001289857.1.9091 WP_001289857.1.9093 WP_001289857.1.90983 WP_001289857.1.90984 WP_001289857.1.90991 WP_001289857.1.91003 WP_001289857.1.91023 WP_001289857.1.91042 WP_001289857.1.91049 WP_001289857.1.91056 WP_001289857.1.91067 WP_001289857.1.91069 WP_001289857.1.91156 WP_001289857.1.91179 WP_001289857.1.91189 WP_001289857.1.91205 WP_001289857.1.91239 WP_001289857.1.91278 WP_001289857.1.91291 WP_001289857.1.9131 WP_001289857.1.9135 WP_001289857.1.91405 WP_001289857.1.91459 WP_001289857.1.91470 WP_001289857.1.91473 WP_001289857.1.91493 WP_001289857.1.91506 WP_001289857.1.91512 WP_001289857.1.91524 WP_001289857.1.91528 WP_001289857.1.91557 WP_001289857.1.91564 WP_001289857.1.91579 WP_001289857.1.91580 WP_001289857.1.91597 WP_001289857.1.91621 WP_001289857.1.91625 WP_001289857.1.91628 WP_001289857.1.91655 WP_001289857.1.91715 WP_001289857.1.91724 WP_001289857.1.91732 WP_001289857.1.91736 WP_001289857.1.91788 WP_001289857.1.91806 WP_001289857.1.91864 WP_001289857.1.9187 WP_001289857.1.91870 WP_001289857.1.91880 WP_001289857.1.91903 WP_001289857.1.91914 WP_001289857.1.92013 WP_001289857.1.92018 WP_001289857.1.92039 WP_001289857.1.92044 WP_001289857.1.92060 WP_001289857.1.92067 WP_001289857.1.92087 WP_001289857.1.92093 WP_001289857.1.92098 WP_001289857.1.92099 WP_001289857.1.92108 WP_001289857.1.92122 WP_001289857.1.92149 WP_001289857.1.92156 WP_001289857.1.92165 WP_001289857.1.92171 WP_001289857.1.92172 WP_001289857.1.92183 WP_001289857.1.92208 WP_001289857.1.92213 WP_001289857.1.92240 WP_001289857.1.92243 WP_001289857.1.92268 WP_001289857.1.92270 WP_001289857.1.92299 WP_001289857.1.92310 WP_001289857.1.92318 WP_001289857.1.92327 WP_001289857.1.92375 WP_001289857.1.92394 WP_001289857.1.92399 WP_001289857.1.92408 WP_001289857.1.92411 WP_001289857.1.92443 WP_001289857.1.92470 WP_001289857.1.92477 WP_001289857.1.92482 WP_001289857.1.92529 WP_001289857.1.9253 WP_001289857.1.92531 WP_001289857.1.92545 WP_001289857.1.92562 WP_001289857.1.92570 WP_001289857.1.92575 WP_001289857.1.92588 WP_001289857.1.926 WP_001289857.1.92633 WP_001289857.1.92649 WP_001289857.1.92659 WP_001289857.1.92669 WP_001289857.1.92671 WP_001289857.1.92676 WP_001289857.1.92705 WP_001289857.1.9271 WP_001289857.1.92729 WP_001289857.1.92738 WP_001289857.1.92758 WP_001289857.1.92823 WP_001289857.1.92827 WP_001289857.1.92832 WP_001289857.1.92836 WP_001289857.1.92879 WP_001289857.1.92883 WP_001289857.1.92893 WP_001289857.1.92895 WP_001289857.1.92926 WP_001289857.1.92939 WP_001289857.1.92947 WP_001289857.1.92975 WP_001289857.1.92987 WP_001289857.1.93007 WP_001289857.1.93022 WP_001289857.1.93059 WP_001289857.1.93061 WP_001289857.1.93086 WP_001289857.1.93101 WP_001289857.1.93103 WP_001289857.1.93105 WP_001289857.1.93111 WP_001289857.1.93121 WP_001289857.1.93136 WP_001289857.1.93155 WP_001289857.1.93168 WP_001289857.1.93184 WP_001289857.1.93213 WP_001289857.1.93221 WP_001289857.1.93223 WP_001289857.1.93239 WP_001289857.1.93275 WP_001289857.1.93302 WP_001289857.1.93322 WP_001289857.1.93339 WP_001289857.1.9336 WP_001289857.1.93365 WP_001289857.1.93376 WP_001289857.1.93387 WP_001289857.1.93469 WP_001289857.1.93511 WP_001289857.1.93512 WP_001289857.1.93543 WP_001289857.1.93604 WP_001289857.1.93635 WP_001289857.1.93648 WP_001289857.1.93650 WP_001289857.1.93656 WP_001289857.1.93657 WP_001289857.1.93662 WP_001289857.1.93671 WP_001289857.1.937 WP_001289857.1.93705 WP_001289857.1.9374 WP_001289857.1.93741 WP_001289857.1.9375 WP_001289857.1.93754 WP_001289857.1.93767 WP_001289857.1.93804 WP_001289857.1.93828 WP_001289857.1.93837 WP_001289857.1.93842 WP_001289857.1.93843 WP_001289857.1.93875 WP_001289857.1.9389 WP_001289857.1.93909 WP_001289857.1.93937 WP_001289857.1.93938 WP_001289857.1.93984 WP_001289857.1.93986 WP_001289857.1.9399 WP_001289857.1.93994 WP_001289857.1.94056 WP_001289857.1.94064 WP_001289857.1.94070 WP_001289857.1.94072 WP_001289857.1.94079 WP_001289857.1.94097 WP_001289857.1.94107 WP_001289857.1.94132 WP_001289857.1.94142 WP_001289857.1.94162 WP_001289857.1.94167 WP_001289857.1.94168 WP_001289857.1.94181 WP_001289857.1.94198 WP_001289857.1.94215 WP_001289857.1.94303 WP_001289857.1.9432 WP_001289857.1.94354 WP_001289857.1.94365 WP_001289857.1.94379 WP_001289857.1.94380 WP_001289857.1.94383 WP_001289857.1.94390 WP_001289857.1.94412 WP_001289857.1.94415 WP_001289857.1.94458 WP_001289857.1.94492 WP_001289857.1.94510 WP_001289857.1.94527 WP_001289857.1.94557 WP_001289857.1.94565 WP_001289857.1.94573 WP_001289857.1.94579 WP_001289857.1.94584 WP_001289857.1.94586 WP_001289857.1.94588 WP_001289857.1.94593 WP_001289857.1.94622 WP_001289857.1.9463 WP_001289857.1.94650 WP_001289857.1.94655 WP_001289857.1.94659 WP_001289857.1.94662 WP_001289857.1.94669 WP_001289857.1.94674 WP_001289857.1.94700 WP_001289857.1.94717 WP_001289857.1.94722 WP_001289857.1.94745 WP_001289857.1.94785 WP_001289857.1.94796 WP_001289857.1.94798 WP_001289857.1.9481 WP_001289857.1.94815 WP_001289857.1.94820 WP_001289857.1.94849 WP_001289857.1.94850 WP_001289857.1.94851 WP_001289857.1.94862 WP_001289857.1.94864 WP_001289857.1.94947 WP_001289857.1.94952 WP_001289857.1.94959 WP_001289857.1.94967 WP_001289857.1.94971 WP_001289857.1.94987 WP_001289857.1.95006 WP_001289857.1.95051 WP_001289857.1.95055 WP_001289857.1.95076 WP_001289857.1.95085 WP_001289857.1.95094 WP_001289857.1.95099 WP_001289857.1.95121 WP_001289857.1.95152 WP_001289857.1.95165 WP_001289857.1.95171 WP_001289857.1.95235 WP_001289857.1.95239 WP_001289857.1.95246 WP_001289857.1.95248 WP_001289857.1.95249 WP_001289857.1.9525 WP_001289857.1.95255 WP_001289857.1.95265 WP_001289857.1.95277 WP_001289857.1.95282 WP_001289857.1.95289 WP_001289857.1.95320 WP_001289857.1.95388 WP_001289857.1.95404 WP_001289857.1.95465 WP_001289857.1.95530 WP_001289857.1.95546 WP_001289857.1.95547 WP_001289857.1.95579 WP_001289857.1.95590 WP_001289857.1.95623 WP_001289857.1.95625 WP_001289857.1.95630 WP_001289857.1.95641 WP_001289857.1.95670 WP_001289857.1.95675 WP_001289857.1.95691 WP_001289857.1.95701 WP_001289857.1.95703 WP_001289857.1.95716 WP_001289857.1.95729 WP_001289857.1.9574 WP_001289857.1.95744 WP_001289857.1.95776 WP_001289857.1.95803 WP_001289857.1.95805 WP_001289857.1.95826 WP_001289857.1.95840 WP_001289857.1.95884 WP_001289857.1.95906 WP_001289857.1.95911 WP_001289857.1.95939 WP_001289857.1.95940 WP_001289857.1.96004 WP_001289857.1.96025 WP_001289857.1.96042 WP_001289857.1.96044 WP_001289857.1.96045 WP_001289857.1.9609 WP_001289857.1.96094 WP_001289857.1.96127 WP_001289857.1.96139 WP_001289857.1.96144 WP_001289857.1.96162 WP_001289857.1.96172 WP_001289857.1.96188 WP_001289857.1.96190 WP_001289857.1.96203 WP_001289857.1.96206 WP_001289857.1.96211 WP_001289857.1.96212 WP_001289857.1.96260 WP_001289857.1.9627 WP_001289857.1.96317 WP_001289857.1.96319 WP_001289857.1.9633 WP_001289857.1.96335 WP_001289857.1.96343 WP_001289857.1.96359 WP_001289857.1.96404 WP_001289857.1.96429 WP_001289857.1.9644 WP_001289857.1.96469 WP_001289857.1.96497 WP_001289857.1.96500 WP_001289857.1.96533 WP_001289857.1.96539 WP_001289857.1.96552 WP_001289857.1.96555 WP_001289857.1.96563 WP_001289857.1.96590 WP_001289857.1.96600 WP_001289857.1.96610 WP_001289857.1.96625 WP_001289857.1.96635 WP_001289857.1.9664 WP_001289857.1.96640 WP_001289857.1.96642 WP_001289857.1.96675 WP_001289857.1.9670 WP_001289857.1.96721 WP_001289857.1.96732 WP_001289857.1.9674 WP_001289857.1.96750 WP_001289857.1.96758 WP_001289857.1.96771 WP_001289857.1.96792 WP_001289857.1.96801 WP_001289857.1.96803 WP_001289857.1.96810 WP_001289857.1.9686 WP_001289857.1.96890 WP_001289857.1.96902 WP_001289857.1.96925 WP_001289857.1.96938 WP_001289857.1.96957 WP_001289857.1.96978 WP_001289857.1.97015 WP_001289857.1.97026 WP_001289857.1.97028 WP_001289857.1.97043 WP_001289857.1.97047 WP_001289857.1.97079 WP_001289857.1.97089 WP_001289857.1.97109 WP_001289857.1.97143 WP_001289857.1.97145 WP_001289857.1.97154 WP_001289857.1.97184 WP_001289857.1.97185 WP_001289857.1.97190 WP_001289857.1.97224 WP_001289857.1.97287 WP_001289857.1.97291 WP_001289857.1.97297 WP_001289857.1.97318 WP_001289857.1.97337 WP_001289857.1.97369 WP_001289857.1.97386 WP_001289857.1.97413 WP_001289857.1.97422 WP_001289857.1.97441 WP_001289857.1.97477 WP_001289857.1.97487 WP_001289857.1.97497 WP_001289857.1.97505 WP_001289857.1.97534 WP_001289857.1.97594 WP_001289857.1.97597 WP_001289857.1.97599 WP_001289857.1.97606 WP_001289857.1.97613 WP_001289857.1.97615 WP_001289857.1.97620 WP_001289857.1.97626 WP_001289857.1.97628 WP_001289857.1.97631 WP_001289857.1.97640 WP_001289857.1.97646 WP_001289857.1.97690 WP_001289857.1.97691 WP_001289857.1.97693 WP_001289857.1.97725 WP_001289857.1.97726 WP_001289857.1.97727 WP_001289857.1.97732 WP_001289857.1.97736 WP_001289857.1.9775 WP_001289857.1.97768 WP_001289857.1.97772 WP_001289857.1.97819 WP_001289857.1.97846 WP_001289857.1.97873 WP_001289857.1.97938 WP_001289857.1.97986 WP_001289857.1.9799 WP_001289857.1.98006 WP_001289857.1.98019 WP_001289857.1.98022 WP_001289857.1.98036 WP_001289857.1.9805 WP_001289857.1.98080 WP_001289857.1.98086 WP_001289857.1.98107 WP_001289857.1.9811 WP_001289857.1.98110 WP_001289857.1.98124 WP_001289857.1.98146 WP_001289857.1.98158 WP_001289857.1.98170 WP_001289857.1.98219 WP_001289857.1.98236 WP_001289857.1.98250 WP_001289857.1.9826 WP_001289857.1.98263 WP_001289857.1.98402 WP_001289857.1.98403 WP_001289857.1.9841 WP_001289857.1.98418 WP_001289857.1.98438 WP_001289857.1.98446 WP_001289857.1.98448 WP_001289857.1.98457 WP_001289857.1.98483 WP_001289857.1.98495 WP_001289857.1.9850 WP_001289857.1.98502 WP_001289857.1.98531 WP_001289857.1.98551 WP_001289857.1.98577 WP_001289857.1.98607 WP_001289857.1.98608 WP_001289857.1.9863 WP_001289857.1.98634 WP_001289857.1.98676 WP_001289857.1.98677 WP_001289857.1.98731 WP_001289857.1.98751 WP_001289857.1.98760 WP_001289857.1.98762 WP_001289857.1.98763 WP_001289857.1.9877 WP_001289857.1.98779 WP_001289857.1.98801 WP_001289857.1.98818 WP_001289857.1.98843 WP_001289857.1.9887 WP_001289857.1.98899 WP_001289857.1.98931 WP_001289857.1.98947 WP_001289857.1.9898 WP_001289857.1.99071 WP_001289857.1.99072 WP_001289857.1.99098 WP_001289857.1.99107 WP_001289857.1.99163 WP_001289857.1.99184 WP_001289857.1.9919 WP_001289857.1.99197 WP_001289857.1.99198 WP_001289857.1.99219 WP_001289857.1.99255 WP_001289857.1.99267 WP_001289857.1.99276 WP_001289857.1.99278 WP_001289857.1.99327 WP_001289857.1.99335 WP_001289857.1.99339 WP_001289857.1.99350 WP_001289857.1.99360 WP_001289857.1.99363 WP_001289857.1.99369 WP_001289857.1.99370 WP_001289857.1.99388 WP_001289857.1.99397 WP_001289857.1.99426 WP_001289857.1.99463 WP_001289857.1.99483 WP_001289857.1.9954 WP_001289857.1.99546 WP_001289857.1.99561 WP_001289857.1.99579 WP_001289857.1.99595 WP_001289857.1.99626 WP_001289857.1.99637 WP_001289857.1.99646 WP_001289857.1.99657 WP_001289857.1.99660 WP_001289857.1.99671 WP_001289857.1.99676 WP_001289857.1.99712 WP_001289857.1.99747 WP_001289857.1.99764 WP_001289857.1.99783 WP_001289857.1.99813 WP_001289857.1.99824 WP_001289857.1.99829 WP_001289857.1.99837 WP_001289857.1.99841 WP_001289857.1.99858 WP_001289857.1.99889 WP_001289857.1.9992 WP_001289857.1.99958 WP_001289857.1.99996 gi|378958828|ref|YP_005216314.1| gi|525818068|ref|YP_008248086.1| gi|452119617|ref|YP_007469865.1| gi|526220755|ref|YP_008266428.1| gi|409250789|ref|YP_006886597.1| gi|378700091|ref|YP_005182048.1| gi|194736424|ref|YP_002115268.1| gi|378989565|ref|YP_005252729.1| gi|563653657|ref|YP_008861731.1| 209261.t0677 321314.SC2195 439843.SeSA_A2417 454166.SeAg_B2324 454169.SeHA_C2413 550538.SG2214 99287.STM2178 gi|525837698|ref|YP_008254567.1| gi|379701406|ref|YP_005243134.1| gi|538362801|ref|YP_008506086.1| gi|378954463|ref|YP_005211950.1| gi|29141184|ref|NP_804526.1| gi|386591989|ref|YP_006088389.1| gi|197249829|ref|YP_002147150.1| ABAK02000001|CDS_1677457-1676420 ABAM02000001|CDS_2734488-2733451 ABAO01000005|CDS_179172-178135 ABEH02000005|CDS_203457-202420 ABEI01000001|CDS_201358-200321 ABEJ01000005|CDS_150377-149340 ABEL01000004|CDS_181053-180016 ABEW01000006|CDS_247094-248131 ABFF01000001|CDS_347373-348410 ABFG01000001|CDS_27991-29028 AE006468|CDS_2275386-2274349 AE014613|CDS_762968-764005 AE017220|CDS_2297900-2296863 AM933173|CDS_2269915-2268878 CP001120|CDS_2322974-2321937 CP001127|CDS_2295852-2294815 CP001138|CDS_2240976-2239939 CP001363|CDS_2326939-2325902 FN424405|CDS_2299042-2298005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]