SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378450981|ref|YP_005238340.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378450981|ref|YP_005238340.1|
Domain Number 1 Region: 30-521
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 6.15e-184
Family Type II DNA topoisomerase 0.0000000000000326
Further Details:      
 
Domain Number 2 Region: 533-850
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.96e-112
Family GyrA/ParC C-terminal domain-like 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378450981|ref|YP_005238340.1|
Sequence length 878
Comment DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN
KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM
RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT
NIPPHNLTEVINGCLAYIDNEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRVEGISALRDESDKDG
MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIISAFVRHRRE
VVTRRTIFELRKARDRAHILEALAIALANIDPIIELIRRAPTPAEAKAALISRPWDLGNV
AAMLERAGDDAARPEWLEPEFGVRDGQYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLEQIAELLHILGSADRLMEVIREEMELIRDQFGDERRTEITANSADINIEDLISQEDVV
VTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSSRGRLY
WMKVYQLPEASRGARGRPIVNLLPLEANERITAILPVREYEEGVNVFMATASGTVKKTAL
TEFSRPRSAGIIAVNLNDGDELIGVDLTSGSDEVMLFSAAGKVVRFKEDAVRAMGRTATG
VRGIKLAGDDKVVSLIIPRGEGAILTVTQNGYGKRTAADEYPTKSRATQGVISIKVTERN
GSVVGAVQVDDCDQIMMITDAGTLVRTRVSEISVVGRNTQGVILIRTAEDENVVGLQRVA
EPVDDEELDAIDGSVAEGDEDIAPEAESDDDVADDADE
Download sequence
Identical sequences A0A0D6FCL4 A0A0F6B403 A0A0F7DJ11 A0A0G2NQ43 A0A0H2WN39 A0A0H3BUV7 A0A0H3NDJ2 A0A0L1SKZ0 A0A0L5XAY3 A0A0M0PIJ3 A0A0R9PNF8 A0A0T7RZF0 A0A0U1IZW0 A0A1C2ZTK5 A0A1S0ZLZ1 A0A1S1AJ91 A0A1S6Q5F6 A0A1S6Q5G3 A0A1S6Q5G8 A0A1X2RK44 A0A1X2UMQ1 A0A1X2Y1I0 A0A1X8W869 A0A221YY06 A0A267SD97 A0A2C6EV84 A0A2D1Y3R7 A0A2D3TUQ4 A0A2G1PEN1 A0A2H9YGH6 A0A2I6M622 A0A2I6MJH6 A0A2I6MXJ9 A0A2I6NBM8 A0A2I6NPD2 A0A2I6P234 B5EYV7 C0Q096 E8XEB4 G4C166 G5L676 G5RY08 P37411 S4IA21 S5HM50 V7IMF3 V7UFE8
gi|386592082|ref|YP_006088482.1| gi|525837628|ref|YP_008254477.1| gi|197361764|ref|YP_002141400.1| gi|528820090|ref|YP_008361293.1| gi|538362885|ref|YP_008506170.1| gi|378450981|ref|YP_005238340.1| gi|409250881|ref|YP_006886688.1| gi|194445296|ref|YP_002041533.1| gi|525946753|ref|YP_008307975.1| gi|452123896|ref|YP_007474144.1| gi|224583243|ref|YP_002637041.1| ABAM02000001|CDS_2835469-2832833 ABAN01000002|CDS_375936-378572 ABEL01000004|CDS_281995-279359 ABEW01000006|CDS_155591-158227 ABFF01000001|CDS_253174-255810 ABFG01000004|CDS_356143-358779 AE006468|CDS_2376347-2373711 AM933172|CDS_2370412-2367776 CP000026|CDS_668921-671557 CP000857|CDS_1503986-1506622 CP000886|CDS_669502-672138 CP001113|CDS_2378110-2375474 CP001120|CDS_2423909-2421273 CP001138|CDS_2327829-2325193 CP001363|CDS_2427900-2425264 FM200053|CDS_668955-671591 FN424405|CDS_2400013-2397377 gi|550901708|ref|YP_008670800.1| IDP04555 gi|207857691|ref|YP_002244342.1| gi|161613010|ref|YP_001586975.1| gi|526220826|ref|YP_008266518.1| NP_461214.1.58477 WP_001281271.1.100002 WP_001281271.1.100007 WP_001281271.1.100010 WP_001281271.1.100031 WP_001281271.1.100077 WP_001281271.1.100115 WP_001281271.1.100129 WP_001281271.1.10013 WP_001281271.1.100137 WP_001281271.1.100149 WP_001281271.1.100165 WP_001281271.1.100191 WP_001281271.1.1002 WP_001281271.1.100234 WP_001281271.1.100258 WP_001281271.1.100266 WP_001281271.1.100376 WP_001281271.1.100392 WP_001281271.1.100412 WP_001281271.1.100413 WP_001281271.1.100436 WP_001281271.1.100438 WP_001281271.1.100457 WP_001281271.1.100472 WP_001281271.1.100484 WP_001281271.1.100488 WP_001281271.1.100502 WP_001281271.1.100519 WP_001281271.1.100521 WP_001281271.1.100557 WP_001281271.1.100589 WP_001281271.1.100597 WP_001281271.1.100605 WP_001281271.1.10065 WP_001281271.1.100650 WP_001281271.1.100707 WP_001281271.1.100711 WP_001281271.1.100714 WP_001281271.1.100721 WP_001281271.1.100730 WP_001281271.1.100773 WP_001281271.1.100776 WP_001281271.1.100790 WP_001281271.1.100793 WP_001281271.1.10081 WP_001281271.1.100857 WP_001281271.1.100865 WP_001281271.1.100869 WP_001281271.1.100870 WP_001281271.1.100871 WP_001281271.1.100882 WP_001281271.1.100895 WP_001281271.1.100932 WP_001281271.1.100948 WP_001281271.1.101020 WP_001281271.1.101042 WP_001281271.1.101074 WP_001281271.1.101078 WP_001281271.1.101094 WP_001281271.1.101112 WP_001281271.1.101123 WP_001281271.1.101126 WP_001281271.1.101199 WP_001281271.1.101223 WP_001281271.1.101239 WP_001281271.1.101259 WP_001281271.1.101284 WP_001281271.1.1013 WP_001281271.1.101320 WP_001281271.1.101353 WP_001281271.1.101386 WP_001281271.1.101404 WP_001281271.1.101420 WP_001281271.1.101425 WP_001281271.1.101454 WP_001281271.1.101473 WP_001281271.1.101520 WP_001281271.1.101541 WP_001281271.1.101589 WP_001281271.1.101609 WP_001281271.1.101636 WP_001281271.1.101639 WP_001281271.1.10164 WP_001281271.1.101666 WP_001281271.1.101707 WP_001281271.1.101724 WP_001281271.1.101734 WP_001281271.1.101740 WP_001281271.1.101741 WP_001281271.1.101744 WP_001281271.1.101759 WP_001281271.1.10177 WP_001281271.1.101815 WP_001281271.1.101832 WP_001281271.1.101841 WP_001281271.1.10191 WP_001281271.1.101917 WP_001281271.1.101953 WP_001281271.1.101975 WP_001281271.1.102009 WP_001281271.1.102103 WP_001281271.1.102111 WP_001281271.1.10220 WP_001281271.1.10231 WP_001281271.1.10237 WP_001281271.1.10266 WP_001281271.1.10276 WP_001281271.1.10293 WP_001281271.1.10300 WP_001281271.1.10310 WP_001281271.1.10394 WP_001281271.1.10429 WP_001281271.1.10439 WP_001281271.1.10465 WP_001281271.1.10498 WP_001281271.1.10507 WP_001281271.1.10521 WP_001281271.1.10562 WP_001281271.1.10566 WP_001281271.1.10568 WP_001281271.1.106 WP_001281271.1.10631 WP_001281271.1.10675 WP_001281271.1.10678 WP_001281271.1.10711 WP_001281271.1.10755 WP_001281271.1.10797 WP_001281271.1.10868 WP_001281271.1.10898 WP_001281271.1.10992 WP_001281271.1.11000 WP_001281271.1.11024 WP_001281271.1.11031 WP_001281271.1.11041 WP_001281271.1.11098 WP_001281271.1.1110 WP_001281271.1.11119 WP_001281271.1.11156 WP_001281271.1.11190 WP_001281271.1.11213 WP_001281271.1.11216 WP_001281271.1.11254 WP_001281271.1.11295 WP_001281271.1.113 WP_001281271.1.11362 WP_001281271.1.11369 WP_001281271.1.1137 WP_001281271.1.11444 WP_001281271.1.11455 WP_001281271.1.11458 WP_001281271.1.11479 WP_001281271.1.1150 WP_001281271.1.11518 WP_001281271.1.11528 WP_001281271.1.11532 WP_001281271.1.11543 WP_001281271.1.1156 WP_001281271.1.11588 WP_001281271.1.11603 WP_001281271.1.11621 WP_001281271.1.11677 WP_001281271.1.11681 WP_001281271.1.11687 WP_001281271.1.11735 WP_001281271.1.11763 WP_001281271.1.11810 WP_001281271.1.11834 WP_001281271.1.11868 WP_001281271.1.11875 WP_001281271.1.11897 WP_001281271.1.11900 WP_001281271.1.11936 WP_001281271.1.11964 WP_001281271.1.11978 WP_001281271.1.12007 WP_001281271.1.12017 WP_001281271.1.12025 WP_001281271.1.12027 WP_001281271.1.12047 WP_001281271.1.12059 WP_001281271.1.12063 WP_001281271.1.12114 WP_001281271.1.1215 WP_001281271.1.12160 WP_001281271.1.12168 WP_001281271.1.12244 WP_001281271.1.12280 WP_001281271.1.12282 WP_001281271.1.12308 WP_001281271.1.12351 WP_001281271.1.12370 WP_001281271.1.12374 WP_001281271.1.12396 WP_001281271.1.12397 WP_001281271.1.12456 WP_001281271.1.1246 WP_001281271.1.12484 WP_001281271.1.1250 WP_001281271.1.12546 WP_001281271.1.12568 WP_001281271.1.12584 WP_001281271.1.12585 WP_001281271.1.1264 WP_001281271.1.12650 WP_001281271.1.12696 WP_001281271.1.12701 WP_001281271.1.12728 WP_001281271.1.12864 WP_001281271.1.12865 WP_001281271.1.12877 WP_001281271.1.12879 WP_001281271.1.12936 WP_001281271.1.1299 WP_001281271.1.12995 WP_001281271.1.1300 WP_001281271.1.13027 WP_001281271.1.13076 WP_001281271.1.13101 WP_001281271.1.13102 WP_001281271.1.13106 WP_001281271.1.13130 WP_001281271.1.13207 WP_001281271.1.13247 WP_001281271.1.1326 WP_001281271.1.13262 WP_001281271.1.13274 WP_001281271.1.13334 WP_001281271.1.13391 WP_001281271.1.13414 WP_001281271.1.1346 WP_001281271.1.13488 WP_001281271.1.13509 WP_001281271.1.13543 WP_001281271.1.13602 WP_001281271.1.13625 WP_001281271.1.13661 WP_001281271.1.13669 WP_001281271.1.13677 WP_001281271.1.13741 WP_001281271.1.13750 WP_001281271.1.13799 WP_001281271.1.13829 WP_001281271.1.13848 WP_001281271.1.1387 WP_001281271.1.13908 WP_001281271.1.13932 WP_001281271.1.13968 WP_001281271.1.14001 WP_001281271.1.14041 WP_001281271.1.14050 WP_001281271.1.14056 WP_001281271.1.1412 WP_001281271.1.14151 WP_001281271.1.14212 WP_001281271.1.14239 WP_001281271.1.14286 WP_001281271.1.14320 WP_001281271.1.14379 WP_001281271.1.1440 WP_001281271.1.14406 WP_001281271.1.14410 WP_001281271.1.14436 WP_001281271.1.14446 WP_001281271.1.14458 WP_001281271.1.14466 WP_001281271.1.14505 WP_001281271.1.14516 WP_001281271.1.14519 WP_001281271.1.14524 WP_001281271.1.14528 WP_001281271.1.14554 WP_001281271.1.146 WP_001281271.1.14618 WP_001281271.1.14688 WP_001281271.1.14725 WP_001281271.1.14737 WP_001281271.1.14789 WP_001281271.1.14793 WP_001281271.1.14808 WP_001281271.1.14819 WP_001281271.1.14852 WP_001281271.1.14876 WP_001281271.1.14884 WP_001281271.1.1489 WP_001281271.1.14917 WP_001281271.1.14932 WP_001281271.1.15046 WP_001281271.1.15055 WP_001281271.1.15059 WP_001281271.1.15079 WP_001281271.1.15100 WP_001281271.1.15102 WP_001281271.1.15223 WP_001281271.1.15226 WP_001281271.1.15276 WP_001281271.1.15316 WP_001281271.1.15318 WP_001281271.1.15353 WP_001281271.1.15369 WP_001281271.1.15468 WP_001281271.1.15479 WP_001281271.1.15483 WP_001281271.1.15508 WP_001281271.1.1551 WP_001281271.1.15585 WP_001281271.1.15586 WP_001281271.1.15616 WP_001281271.1.15625 WP_001281271.1.15627 WP_001281271.1.15637 WP_001281271.1.15644 WP_001281271.1.15708 WP_001281271.1.15775 WP_001281271.1.15795 WP_001281271.1.158 WP_001281271.1.15830 WP_001281271.1.15835 WP_001281271.1.15862 WP_001281271.1.15881 WP_001281271.1.15909 WP_001281271.1.15910 WP_001281271.1.1592 WP_001281271.1.15922 WP_001281271.1.15938 WP_001281271.1.15978 WP_001281271.1.15986 WP_001281271.1.16004 WP_001281271.1.16006 WP_001281271.1.1601 WP_001281271.1.16032 WP_001281271.1.16047 WP_001281271.1.16052 WP_001281271.1.16063 WP_001281271.1.16103 WP_001281271.1.1611 WP_001281271.1.16125 WP_001281271.1.16158 WP_001281271.1.16166 WP_001281271.1.16172 WP_001281271.1.16201 WP_001281271.1.16226 WP_001281271.1.16233 WP_001281271.1.16244 WP_001281271.1.16273 WP_001281271.1.16328 WP_001281271.1.16331 WP_001281271.1.1635 WP_001281271.1.16361 WP_001281271.1.16363 WP_001281271.1.16366 WP_001281271.1.16394 WP_001281271.1.16453 WP_001281271.1.16468 WP_001281271.1.16474 WP_001281271.1.16551 WP_001281271.1.16565 WP_001281271.1.16581 WP_001281271.1.16614 WP_001281271.1.16650 WP_001281271.1.16656 WP_001281271.1.1668 WP_001281271.1.16686 WP_001281271.1.16691 WP_001281271.1.167 WP_001281271.1.16710 WP_001281271.1.16729 WP_001281271.1.16732 WP_001281271.1.16735 WP_001281271.1.16736 WP_001281271.1.16786 WP_001281271.1.16817 WP_001281271.1.16819 WP_001281271.1.16826 WP_001281271.1.16855 WP_001281271.1.16873 WP_001281271.1.16896 WP_001281271.1.16903 WP_001281271.1.16910 WP_001281271.1.16916 WP_001281271.1.16941 WP_001281271.1.16942 WP_001281271.1.16944 WP_001281271.1.16965 WP_001281271.1.16998 WP_001281271.1.17031 WP_001281271.1.17060 WP_001281271.1.17093 WP_001281271.1.17098 WP_001281271.1.17188 WP_001281271.1.17285 WP_001281271.1.17307 WP_001281271.1.1733 WP_001281271.1.1737 WP_001281271.1.17390 WP_001281271.1.174 WP_001281271.1.17439 WP_001281271.1.17447 WP_001281271.1.17480 WP_001281271.1.17482 WP_001281271.1.17504 WP_001281271.1.17525 WP_001281271.1.17546 WP_001281271.1.17560 WP_001281271.1.1757 WP_001281271.1.17583 WP_001281271.1.17693 WP_001281271.1.17702 WP_001281271.1.17703 WP_001281271.1.17705 WP_001281271.1.17732 WP_001281271.1.17743 WP_001281271.1.17747 WP_001281271.1.17758 WP_001281271.1.17886 WP_001281271.1.17891 WP_001281271.1.17901 WP_001281271.1.17919 WP_001281271.1.17936 WP_001281271.1.17949 WP_001281271.1.1798 WP_001281271.1.17991 WP_001281271.1.18019 WP_001281271.1.18022 WP_001281271.1.18056 WP_001281271.1.18061 WP_001281271.1.1807 WP_001281271.1.18089 WP_001281271.1.18092 WP_001281271.1.18111 WP_001281271.1.18122 WP_001281271.1.1814 WP_001281271.1.18149 WP_001281271.1.18163 WP_001281271.1.18177 WP_001281271.1.1818 WP_001281271.1.18192 WP_001281271.1.1825 WP_001281271.1.18254 WP_001281271.1.18265 WP_001281271.1.18267 WP_001281271.1.18281 WP_001281271.1.18282 WP_001281271.1.18365 WP_001281271.1.18384 WP_001281271.1.18426 WP_001281271.1.18441 WP_001281271.1.18445 WP_001281271.1.18468 WP_001281271.1.18485 WP_001281271.1.18489 WP_001281271.1.18607 WP_001281271.1.18641 WP_001281271.1.18686 WP_001281271.1.18692 WP_001281271.1.18705 WP_001281271.1.18715 WP_001281271.1.18737 WP_001281271.1.18776 WP_001281271.1.18822 WP_001281271.1.18847 WP_001281271.1.18881 WP_001281271.1.18886 WP_001281271.1.18895 WP_001281271.1.18919 WP_001281271.1.18940 WP_001281271.1.18949 WP_001281271.1.1895 WP_001281271.1.1897 WP_001281271.1.18972 WP_001281271.1.19030 WP_001281271.1.19038 WP_001281271.1.19053 WP_001281271.1.19064 WP_001281271.1.19093 WP_001281271.1.19163 WP_001281271.1.19240 WP_001281271.1.19273 WP_001281271.1.19320 WP_001281271.1.19340 WP_001281271.1.19357 WP_001281271.1.19373 WP_001281271.1.19458 WP_001281271.1.19460 WP_001281271.1.19461 WP_001281271.1.19469 WP_001281271.1.1954 WP_001281271.1.1955 WP_001281271.1.19588 WP_001281271.1.19614 WP_001281271.1.19616 WP_001281271.1.19642 WP_001281271.1.19660 WP_001281271.1.1968 WP_001281271.1.19683 WP_001281271.1.19702 WP_001281271.1.19706 WP_001281271.1.19723 WP_001281271.1.19724 WP_001281271.1.19740 WP_001281271.1.19749 WP_001281271.1.19793 WP_001281271.1.19802 WP_001281271.1.19809 WP_001281271.1.19823 WP_001281271.1.19834 WP_001281271.1.19863 WP_001281271.1.19867 WP_001281271.1.19882 WP_001281271.1.19884 WP_001281271.1.1990 WP_001281271.1.19938 WP_001281271.1.19970 WP_001281271.1.19975 WP_001281271.1.1998 WP_001281271.1.19987 WP_001281271.1.20 WP_001281271.1.20023 WP_001281271.1.20034 WP_001281271.1.20081 WP_001281271.1.20091 WP_001281271.1.2010 WP_001281271.1.20212 WP_001281271.1.20218 WP_001281271.1.2026 WP_001281271.1.20266 WP_001281271.1.20271 WP_001281271.1.20330 WP_001281271.1.20349 WP_001281271.1.20362 WP_001281271.1.20376 WP_001281271.1.20391 WP_001281271.1.2041 WP_001281271.1.20415 WP_001281271.1.20418 WP_001281271.1.20425 WP_001281271.1.20437 WP_001281271.1.20443 WP_001281271.1.20446 WP_001281271.1.20488 WP_001281271.1.20503 WP_001281271.1.20525 WP_001281271.1.2054 WP_001281271.1.20553 WP_001281271.1.20573 WP_001281271.1.20614 WP_001281271.1.20631 WP_001281271.1.20646 WP_001281271.1.20695 WP_001281271.1.20700 WP_001281271.1.20721 WP_001281271.1.20760 WP_001281271.1.20787 WP_001281271.1.20795 WP_001281271.1.20839 WP_001281271.1.20862 WP_001281271.1.20900 WP_001281271.1.20908 WP_001281271.1.2091 WP_001281271.1.2101 WP_001281271.1.21049 WP_001281271.1.21075 WP_001281271.1.21079 WP_001281271.1.21086 WP_001281271.1.21089 WP_001281271.1.21103 WP_001281271.1.21136 WP_001281271.1.21146 WP_001281271.1.2116 WP_001281271.1.21165 WP_001281271.1.21181 WP_001281271.1.21202 WP_001281271.1.21245 WP_001281271.1.21246 WP_001281271.1.21260 WP_001281271.1.2130 WP_001281271.1.21309 WP_001281271.1.21326 WP_001281271.1.21332 WP_001281271.1.21362 WP_001281271.1.21400 WP_001281271.1.21404 WP_001281271.1.21423 WP_001281271.1.21453 WP_001281271.1.2146 WP_001281271.1.21497 WP_001281271.1.21499 WP_001281271.1.21534 WP_001281271.1.21548 WP_001281271.1.21603 WP_001281271.1.21681 WP_001281271.1.21692 WP_001281271.1.21730 WP_001281271.1.21750 WP_001281271.1.21751 WP_001281271.1.21757 WP_001281271.1.21792 WP_001281271.1.21825 WP_001281271.1.21877 WP_001281271.1.21909 WP_001281271.1.21940 WP_001281271.1.21950 WP_001281271.1.21981 WP_001281271.1.21991 WP_001281271.1.22024 WP_001281271.1.22030 WP_001281271.1.2205 WP_001281271.1.22051 WP_001281271.1.22062 WP_001281271.1.22069 WP_001281271.1.22096 WP_001281271.1.22136 WP_001281271.1.22158 WP_001281271.1.22162 WP_001281271.1.2221 WP_001281271.1.22235 WP_001281271.1.2224 WP_001281271.1.22240 WP_001281271.1.22296 WP_001281271.1.22323 WP_001281271.1.22337 WP_001281271.1.22346 WP_001281271.1.2235 WP_001281271.1.22427 WP_001281271.1.22449 WP_001281271.1.22454 WP_001281271.1.2246 WP_001281271.1.22460 WP_001281271.1.22485 WP_001281271.1.22514 WP_001281271.1.22537 WP_001281271.1.22566 WP_001281271.1.22575 WP_001281271.1.22582 WP_001281271.1.22595 WP_001281271.1.22620 WP_001281271.1.22623 WP_001281271.1.22676 WP_001281271.1.22692 WP_001281271.1.22758 WP_001281271.1.22760 WP_001281271.1.2283 WP_001281271.1.22845 WP_001281271.1.22855 WP_001281271.1.22857 WP_001281271.1.22864 WP_001281271.1.22870 WP_001281271.1.22880 WP_001281271.1.22947 WP_001281271.1.22979 WP_001281271.1.23010 WP_001281271.1.23053 WP_001281271.1.23102 WP_001281271.1.23114 WP_001281271.1.2314 WP_001281271.1.23148 WP_001281271.1.23155 WP_001281271.1.23169 WP_001281271.1.23192 WP_001281271.1.23201 WP_001281271.1.2324 WP_001281271.1.23246 WP_001281271.1.23258 WP_001281271.1.23259 WP_001281271.1.23274 WP_001281271.1.23279 WP_001281271.1.23329 WP_001281271.1.23379 WP_001281271.1.2342 WP_001281271.1.23442 WP_001281271.1.23444 WP_001281271.1.23460 WP_001281271.1.23466 WP_001281271.1.23472 WP_001281271.1.23482 WP_001281271.1.23485 WP_001281271.1.235 WP_001281271.1.23509 WP_001281271.1.23513 WP_001281271.1.23529 WP_001281271.1.2358 WP_001281271.1.23587 WP_001281271.1.23621 WP_001281271.1.23631 WP_001281271.1.23634 WP_001281271.1.23639 WP_001281271.1.2364 WP_001281271.1.23643 WP_001281271.1.23646 WP_001281271.1.23675 WP_001281271.1.23685 WP_001281271.1.23707 WP_001281271.1.23736 WP_001281271.1.23746 WP_001281271.1.23755 WP_001281271.1.2376 WP_001281271.1.23819 WP_001281271.1.23932 WP_001281271.1.24017 WP_001281271.1.24082 WP_001281271.1.24145 WP_001281271.1.2415 WP_001281271.1.24158 WP_001281271.1.24163 WP_001281271.1.24250 WP_001281271.1.24259 WP_001281271.1.24297 WP_001281271.1.24303 WP_001281271.1.24325 WP_001281271.1.24361 WP_001281271.1.24392 WP_001281271.1.24394 WP_001281271.1.24409 WP_001281271.1.24419 WP_001281271.1.24433 WP_001281271.1.24450 WP_001281271.1.24494 WP_001281271.1.24555 WP_001281271.1.24567 WP_001281271.1.2467 WP_001281271.1.24696 WP_001281271.1.24723 WP_001281271.1.24727 WP_001281271.1.24737 WP_001281271.1.24779 WP_001281271.1.24837 WP_001281271.1.24873 WP_001281271.1.24901 WP_001281271.1.24944 WP_001281271.1.24995 WP_001281271.1.25015 WP_001281271.1.25119 WP_001281271.1.25159 WP_001281271.1.25175 WP_001281271.1.25205 WP_001281271.1.25206 WP_001281271.1.25217 WP_001281271.1.25297 WP_001281271.1.25354 WP_001281271.1.25426 WP_001281271.1.25454 WP_001281271.1.25493 WP_001281271.1.25498 WP_001281271.1.25514 WP_001281271.1.2554 WP_001281271.1.25546 WP_001281271.1.25596 WP_001281271.1.25690 WP_001281271.1.2570 WP_001281271.1.25700 WP_001281271.1.25703 WP_001281271.1.25708 WP_001281271.1.25722 WP_001281271.1.25740 WP_001281271.1.25780 WP_001281271.1.25809 WP_001281271.1.2581 WP_001281271.1.25814 WP_001281271.1.25928 WP_001281271.1.25932 WP_001281271.1.25951 WP_001281271.1.25988 WP_001281271.1.26030 WP_001281271.1.26034 WP_001281271.1.26075 WP_001281271.1.26083 WP_001281271.1.26093 WP_001281271.1.26122 WP_001281271.1.26129 WP_001281271.1.26194 WP_001281271.1.26199 WP_001281271.1.26213 WP_001281271.1.26224 WP_001281271.1.26269 WP_001281271.1.26311 WP_001281271.1.26319 WP_001281271.1.2634 WP_001281271.1.26363 WP_001281271.1.26384 WP_001281271.1.26426 WP_001281271.1.26429 WP_001281271.1.26440 WP_001281271.1.26441 WP_001281271.1.26493 WP_001281271.1.26512 WP_001281271.1.26551 WP_001281271.1.26567 WP_001281271.1.26576 WP_001281271.1.26582 WP_001281271.1.2660 WP_001281271.1.2667 WP_001281271.1.26687 WP_001281271.1.26709 WP_001281271.1.2672 WP_001281271.1.26741 WP_001281271.1.26750 WP_001281271.1.26758 WP_001281271.1.26787 WP_001281271.1.26794 WP_001281271.1.26856 WP_001281271.1.26882 WP_001281271.1.26883 WP_001281271.1.26919 WP_001281271.1.26924 WP_001281271.1.26936 WP_001281271.1.26980 WP_001281271.1.27010 WP_001281271.1.27051 WP_001281271.1.27055 WP_001281271.1.27072 WP_001281271.1.27084 WP_001281271.1.27122 WP_001281271.1.27169 WP_001281271.1.272 WP_001281271.1.27206 WP_001281271.1.27223 WP_001281271.1.2723 WP_001281271.1.27255 WP_001281271.1.27272 WP_001281271.1.27279 WP_001281271.1.27314 WP_001281271.1.27342 WP_001281271.1.27383 WP_001281271.1.27419 WP_001281271.1.27423 WP_001281271.1.27513 WP_001281271.1.27522 WP_001281271.1.27523 WP_001281271.1.27544 WP_001281271.1.27547 WP_001281271.1.27556 WP_001281271.1.27561 WP_001281271.1.27616 WP_001281271.1.2763 WP_001281271.1.27632 WP_001281271.1.27638 WP_001281271.1.27658 WP_001281271.1.27665 WP_001281271.1.27679 WP_001281271.1.27707 WP_001281271.1.27713 WP_001281271.1.27761 WP_001281271.1.2777 WP_001281271.1.27776 WP_001281271.1.27798 WP_001281271.1.27800 WP_001281271.1.27815 WP_001281271.1.27833 WP_001281271.1.27857 WP_001281271.1.27883 WP_001281271.1.27969 WP_001281271.1.27977 WP_001281271.1.27995 WP_001281271.1.27997 WP_001281271.1.28002 WP_001281271.1.28032 WP_001281271.1.28037 WP_001281271.1.28056 WP_001281271.1.28094 WP_001281271.1.28116 WP_001281271.1.28126 WP_001281271.1.28139 WP_001281271.1.28170 WP_001281271.1.28200 WP_001281271.1.28225 WP_001281271.1.28232 WP_001281271.1.28233 WP_001281271.1.2825 WP_001281271.1.28267 WP_001281271.1.2829 WP_001281271.1.28301 WP_001281271.1.28302 WP_001281271.1.28303 WP_001281271.1.2835 WP_001281271.1.28370 WP_001281271.1.28393 WP_001281271.1.28462 WP_001281271.1.28504 WP_001281271.1.28514 WP_001281271.1.2853 WP_001281271.1.28538 WP_001281271.1.28570 WP_001281271.1.28575 WP_001281271.1.28612 WP_001281271.1.28620 WP_001281271.1.28625 WP_001281271.1.28655 WP_001281271.1.287 WP_001281271.1.28733 WP_001281271.1.28773 WP_001281271.1.28775 WP_001281271.1.28776 WP_001281271.1.2879 WP_001281271.1.28811 WP_001281271.1.28830 WP_001281271.1.2890 WP_001281271.1.28921 WP_001281271.1.28938 WP_001281271.1.28946 WP_001281271.1.28948 WP_001281271.1.29006 WP_001281271.1.29010 WP_001281271.1.29099 WP_001281271.1.2910 WP_001281271.1.29113 WP_001281271.1.29130 WP_001281271.1.29168 WP_001281271.1.29174 WP_001281271.1.29190 WP_001281271.1.29218 WP_001281271.1.2924 WP_001281271.1.29255 WP_001281271.1.2932 WP_001281271.1.29349 WP_001281271.1.29379 WP_001281271.1.29422 WP_001281271.1.29436 WP_001281271.1.29509 WP_001281271.1.29530 WP_001281271.1.29576 WP_001281271.1.29588 WP_001281271.1.29593 WP_001281271.1.29601 WP_001281271.1.29606 WP_001281271.1.29615 WP_001281271.1.29619 WP_001281271.1.29682 WP_001281271.1.29704 WP_001281271.1.29732 WP_001281271.1.29768 WP_001281271.1.29775 WP_001281271.1.29827 WP_001281271.1.2984 WP_001281271.1.29898 WP_001281271.1.29923 WP_001281271.1.29924 WP_001281271.1.29969 WP_001281271.1.29990 WP_001281271.1.30006 WP_001281271.1.30018 WP_001281271.1.30027 WP_001281271.1.30059 WP_001281271.1.30086 WP_001281271.1.30093 WP_001281271.1.3017 WP_001281271.1.30195 WP_001281271.1.30202 WP_001281271.1.30210 WP_001281271.1.30238 WP_001281271.1.30278 WP_001281271.1.30331 WP_001281271.1.30356 WP_001281271.1.30389 WP_001281271.1.30492 WP_001281271.1.30507 WP_001281271.1.30535 WP_001281271.1.30547 WP_001281271.1.30548 WP_001281271.1.30555 WP_001281271.1.30573 WP_001281271.1.30589 WP_001281271.1.30602 WP_001281271.1.30619 WP_001281271.1.30627 WP_001281271.1.30635 WP_001281271.1.3066 WP_001281271.1.3068 WP_001281271.1.30696 WP_001281271.1.3076 WP_001281271.1.30794 WP_001281271.1.3080 WP_001281271.1.30802 WP_001281271.1.30819 WP_001281271.1.30833 WP_001281271.1.30835 WP_001281271.1.30909 WP_001281271.1.30934 WP_001281271.1.3095 WP_001281271.1.30951 WP_001281271.1.30972 WP_001281271.1.31 WP_001281271.1.31001 WP_001281271.1.31042 WP_001281271.1.31086 WP_001281271.1.31092 WP_001281271.1.31107 WP_001281271.1.31111 WP_001281271.1.31122 WP_001281271.1.3114 WP_001281271.1.31155 WP_001281271.1.31156 WP_001281271.1.31167 WP_001281271.1.31171 WP_001281271.1.31185 WP_001281271.1.3119 WP_001281271.1.31190 WP_001281271.1.31196 WP_001281271.1.31210 WP_001281271.1.31214 WP_001281271.1.31219 WP_001281271.1.3124 WP_001281271.1.31251 WP_001281271.1.31262 WP_001281271.1.31281 WP_001281271.1.31435 WP_001281271.1.31451 WP_001281271.1.31476 WP_001281271.1.31504 WP_001281271.1.31515 WP_001281271.1.31578 WP_001281271.1.31585 WP_001281271.1.31658 WP_001281271.1.31665 WP_001281271.1.3167 WP_001281271.1.3170 WP_001281271.1.31720 WP_001281271.1.31725 WP_001281271.1.31762 WP_001281271.1.31782 WP_001281271.1.31845 WP_001281271.1.31854 WP_001281271.1.31895 WP_001281271.1.31901 WP_001281271.1.31927 WP_001281271.1.31952 WP_001281271.1.31967 WP_001281271.1.32006 WP_001281271.1.32038 WP_001281271.1.32054 WP_001281271.1.32109 WP_001281271.1.32116 WP_001281271.1.32192 WP_001281271.1.32204 WP_001281271.1.32206 WP_001281271.1.32252 WP_001281271.1.32255 WP_001281271.1.32260 WP_001281271.1.32274 WP_001281271.1.32275 WP_001281271.1.32277 WP_001281271.1.32309 WP_001281271.1.32357 WP_001281271.1.32408 WP_001281271.1.32424 WP_001281271.1.32434 WP_001281271.1.32459 WP_001281271.1.32491 WP_001281271.1.32493 WP_001281271.1.32519 WP_001281271.1.32527 WP_001281271.1.32629 WP_001281271.1.32643 WP_001281271.1.32660 WP_001281271.1.32668 WP_001281271.1.32702 WP_001281271.1.32714 WP_001281271.1.32740 WP_001281271.1.32747 WP_001281271.1.32750 WP_001281271.1.3278 WP_001281271.1.32786 WP_001281271.1.32804 WP_001281271.1.32860 WP_001281271.1.32881 WP_001281271.1.32902 WP_001281271.1.32907 WP_001281271.1.32961 WP_001281271.1.32977 WP_001281271.1.33010 WP_001281271.1.33030 WP_001281271.1.3304 WP_001281271.1.33078 WP_001281271.1.3310 WP_001281271.1.33106 WP_001281271.1.33114 WP_001281271.1.33127 WP_001281271.1.33144 WP_001281271.1.33248 WP_001281271.1.33261 WP_001281271.1.33270 WP_001281271.1.333 WP_001281271.1.33392 WP_001281271.1.33409 WP_001281271.1.33420 WP_001281271.1.33486 WP_001281271.1.33492 WP_001281271.1.33499 WP_001281271.1.335 WP_001281271.1.33504 WP_001281271.1.33553 WP_001281271.1.3356 WP_001281271.1.33580 WP_001281271.1.33586 WP_001281271.1.33592 WP_001281271.1.33609 WP_001281271.1.3364 WP_001281271.1.33659 WP_001281271.1.33870 WP_001281271.1.33894 WP_001281271.1.3394 WP_001281271.1.3395 WP_001281271.1.3396 WP_001281271.1.33986 WP_001281271.1.34043 WP_001281271.1.34075 WP_001281271.1.34081 WP_001281271.1.34084 WP_001281271.1.34091 WP_001281271.1.34107 WP_001281271.1.34185 WP_001281271.1.34257 WP_001281271.1.34259 WP_001281271.1.34279 WP_001281271.1.34292 WP_001281271.1.34319 WP_001281271.1.34330 WP_001281271.1.3438 WP_001281271.1.34417 WP_001281271.1.34431 WP_001281271.1.3445 WP_001281271.1.34453 WP_001281271.1.34458 WP_001281271.1.34496 WP_001281271.1.34610 WP_001281271.1.34614 WP_001281271.1.34647 WP_001281271.1.34659 WP_001281271.1.34667 WP_001281271.1.34704 WP_001281271.1.34711 WP_001281271.1.3476 WP_001281271.1.34817 WP_001281271.1.34820 WP_001281271.1.34854 WP_001281271.1.34856 WP_001281271.1.34881 WP_001281271.1.34972 WP_001281271.1.34975 WP_001281271.1.34977 WP_001281271.1.35035 WP_001281271.1.35045 WP_001281271.1.35075 WP_001281271.1.35125 WP_001281271.1.35129 WP_001281271.1.35193 WP_001281271.1.35219 WP_001281271.1.35294 WP_001281271.1.35298 WP_001281271.1.35321 WP_001281271.1.35331 WP_001281271.1.35408 WP_001281271.1.35425 WP_001281271.1.35429 WP_001281271.1.35446 WP_001281271.1.35460 WP_001281271.1.35494 WP_001281271.1.35503 WP_001281271.1.35507 WP_001281271.1.35509 WP_001281271.1.3556 WP_001281271.1.35570 WP_001281271.1.35590 WP_001281271.1.35624 WP_001281271.1.35648 WP_001281271.1.35777 WP_001281271.1.35835 WP_001281271.1.35868 WP_001281271.1.35892 WP_001281271.1.35936 WP_001281271.1.35961 WP_001281271.1.35993 WP_001281271.1.36003 WP_001281271.1.3601 WP_001281271.1.36017 WP_001281271.1.36057 WP_001281271.1.36063 WP_001281271.1.36157 WP_001281271.1.36172 WP_001281271.1.36229 WP_001281271.1.36232 WP_001281271.1.36286 WP_001281271.1.36409 WP_001281271.1.36445 WP_001281271.1.36512 WP_001281271.1.36542 WP_001281271.1.36547 WP_001281271.1.36564 WP_001281271.1.36584 WP_001281271.1.36586 WP_001281271.1.36592 WP_001281271.1.36609 WP_001281271.1.36652 WP_001281271.1.36685 WP_001281271.1.36690 WP_001281271.1.3670 WP_001281271.1.36705 WP_001281271.1.36721 WP_001281271.1.36751 WP_001281271.1.36764 WP_001281271.1.36765 WP_001281271.1.36792 WP_001281271.1.36875 WP_001281271.1.3688 WP_001281271.1.36885 WP_001281271.1.36899 WP_001281271.1.36918 WP_001281271.1.36931 WP_001281271.1.36948 WP_001281271.1.36978 WP_001281271.1.37013 WP_001281271.1.37021 WP_001281271.1.37028 WP_001281271.1.37029 WP_001281271.1.37063 WP_001281271.1.37073 WP_001281271.1.37111 WP_001281271.1.37112 WP_001281271.1.37147 WP_001281271.1.37158 WP_001281271.1.37191 WP_001281271.1.3728 WP_001281271.1.37293 WP_001281271.1.37297 WP_001281271.1.37320 WP_001281271.1.3734 WP_001281271.1.37351 WP_001281271.1.37363 WP_001281271.1.37370 WP_001281271.1.37376 WP_001281271.1.3744 WP_001281271.1.37478 WP_001281271.1.3748 WP_001281271.1.37498 WP_001281271.1.37504 WP_001281271.1.37521 WP_001281271.1.37558 WP_001281271.1.3756 WP_001281271.1.37610 WP_001281271.1.37618 WP_001281271.1.37666 WP_001281271.1.37687 WP_001281271.1.3771 WP_001281271.1.37719 WP_001281271.1.3778 WP_001281271.1.37848 WP_001281271.1.37864 WP_001281271.1.3790 WP_001281271.1.37965 WP_001281271.1.37968 WP_001281271.1.37978 WP_001281271.1.38001 WP_001281271.1.38026 WP_001281271.1.38037 WP_001281271.1.38047 WP_001281271.1.38113 WP_001281271.1.38125 WP_001281271.1.38145 WP_001281271.1.38199 WP_001281271.1.38273 WP_001281271.1.3828 WP_001281271.1.383 WP_001281271.1.38341 WP_001281271.1.38344 WP_001281271.1.38393 WP_001281271.1.38408 WP_001281271.1.3848 WP_001281271.1.38609 WP_001281271.1.38613 WP_001281271.1.38620 WP_001281271.1.3869 WP_001281271.1.38693 WP_001281271.1.38740 WP_001281271.1.38781 WP_001281271.1.38797 WP_001281271.1.38857 WP_001281271.1.38881 WP_001281271.1.38882 WP_001281271.1.38895 WP_001281271.1.3891 WP_001281271.1.38913 WP_001281271.1.38942 WP_001281271.1.38995 WP_001281271.1.39003 WP_001281271.1.39038 WP_001281271.1.39055 WP_001281271.1.39059 WP_001281271.1.39065 WP_001281271.1.39075 WP_001281271.1.39082 WP_001281271.1.39113 WP_001281271.1.39136 WP_001281271.1.39146 WP_001281271.1.39229 WP_001281271.1.39265 WP_001281271.1.39311 WP_001281271.1.39312 WP_001281271.1.39385 WP_001281271.1.39395 WP_001281271.1.39405 WP_001281271.1.39449 WP_001281271.1.39466 WP_001281271.1.39471 WP_001281271.1.39497 WP_001281271.1.39503 WP_001281271.1.39512 WP_001281271.1.39556 WP_001281271.1.39576 WP_001281271.1.39584 WP_001281271.1.39609 WP_001281271.1.39629 WP_001281271.1.39632 WP_001281271.1.39722 WP_001281271.1.39724 WP_001281271.1.39763 WP_001281271.1.39862 WP_001281271.1.39921 WP_001281271.1.39923 WP_001281271.1.40017 WP_001281271.1.40072 WP_001281271.1.40073 WP_001281271.1.40081 WP_001281271.1.4011 WP_001281271.1.40111 WP_001281271.1.40155 WP_001281271.1.40170 WP_001281271.1.40171 WP_001281271.1.40205 WP_001281271.1.40208 WP_001281271.1.40224 WP_001281271.1.40229 WP_001281271.1.40240 WP_001281271.1.40254 WP_001281271.1.40257 WP_001281271.1.40258 WP_001281271.1.40292 WP_001281271.1.40305 WP_001281271.1.40307 WP_001281271.1.40311 WP_001281271.1.40341 WP_001281271.1.40374 WP_001281271.1.40380 WP_001281271.1.40395 WP_001281271.1.40465 WP_001281271.1.40492 WP_001281271.1.40493 WP_001281271.1.40528 WP_001281271.1.40533 WP_001281271.1.40577 WP_001281271.1.40583 WP_001281271.1.40605 WP_001281271.1.40622 WP_001281271.1.40648 WP_001281271.1.40688 WP_001281271.1.40695 WP_001281271.1.40710 WP_001281271.1.40745 WP_001281271.1.4075 WP_001281271.1.40771 WP_001281271.1.40788 WP_001281271.1.40849 WP_001281271.1.4087 WP_001281271.1.40877 WP_001281271.1.4088 WP_001281271.1.40910 WP_001281271.1.40930 WP_001281271.1.40979 WP_001281271.1.40996 WP_001281271.1.41017 WP_001281271.1.41018 WP_001281271.1.41048 WP_001281271.1.41050 WP_001281271.1.4109 WP_001281271.1.41116 WP_001281271.1.41128 WP_001281271.1.41192 WP_001281271.1.41225 WP_001281271.1.41226 WP_001281271.1.41265 WP_001281271.1.41277 WP_001281271.1.41279 WP_001281271.1.41299 WP_001281271.1.41308 WP_001281271.1.41310 WP_001281271.1.41345 WP_001281271.1.41375 WP_001281271.1.41427 WP_001281271.1.41440 WP_001281271.1.41468 WP_001281271.1.41516 WP_001281271.1.41528 WP_001281271.1.41554 WP_001281271.1.41572 WP_001281271.1.41591 WP_001281271.1.41593 WP_001281271.1.41610 WP_001281271.1.41628 WP_001281271.1.41688 WP_001281271.1.41690 WP_001281271.1.41708 WP_001281271.1.41724 WP_001281271.1.41761 WP_001281271.1.4178 WP_001281271.1.41802 WP_001281271.1.4184 WP_001281271.1.41859 WP_001281271.1.41862 WP_001281271.1.41877 WP_001281271.1.41882 WP_001281271.1.41897 WP_001281271.1.41911 WP_001281271.1.41931 WP_001281271.1.41938 WP_001281271.1.41978 WP_001281271.1.41979 WP_001281271.1.41985 WP_001281271.1.41994 WP_001281271.1.41998 WP_001281271.1.42009 WP_001281271.1.42104 WP_001281271.1.42136 WP_001281271.1.42156 WP_001281271.1.422 WP_001281271.1.4222 WP_001281271.1.42238 WP_001281271.1.42243 WP_001281271.1.42248 WP_001281271.1.42262 WP_001281271.1.42276 WP_001281271.1.4229 WP_001281271.1.42320 WP_001281271.1.42328 WP_001281271.1.42342 WP_001281271.1.42372 WP_001281271.1.4239 WP_001281271.1.42392 WP_001281271.1.42404 WP_001281271.1.42422 WP_001281271.1.42444 WP_001281271.1.42453 WP_001281271.1.42489 WP_001281271.1.42491 WP_001281271.1.4257 WP_001281271.1.42595 WP_001281271.1.42605 WP_001281271.1.42666 WP_001281271.1.42675 WP_001281271.1.42676 WP_001281271.1.42683 WP_001281271.1.42685 WP_001281271.1.42707 WP_001281271.1.42734 WP_001281271.1.4276 WP_001281271.1.42797 WP_001281271.1.42829 WP_001281271.1.42861 WP_001281271.1.42864 WP_001281271.1.4288 WP_001281271.1.42887 WP_001281271.1.4289 WP_001281271.1.42892 WP_001281271.1.42932 WP_001281271.1.42957 WP_001281271.1.42981 WP_001281271.1.43018 WP_001281271.1.43041 WP_001281271.1.43070 WP_001281271.1.43077 WP_001281271.1.43086 WP_001281271.1.43089 WP_001281271.1.43126 WP_001281271.1.43149 WP_001281271.1.43160 WP_001281271.1.43201 WP_001281271.1.43244 WP_001281271.1.43258 WP_001281271.1.43272 WP_001281271.1.43276 WP_001281271.1.43299 WP_001281271.1.43312 WP_001281271.1.4332 WP_001281271.1.43334 WP_001281271.1.43339 WP_001281271.1.43351 WP_001281271.1.43371 WP_001281271.1.43437 WP_001281271.1.43438 WP_001281271.1.4344 WP_001281271.1.43441 WP_001281271.1.43476 WP_001281271.1.43508 WP_001281271.1.43522 WP_001281271.1.43528 WP_001281271.1.43535 WP_001281271.1.43606 WP_001281271.1.43613 WP_001281271.1.43676 WP_001281271.1.43685 WP_001281271.1.43710 WP_001281271.1.43711 WP_001281271.1.4373 WP_001281271.1.43763 WP_001281271.1.43778 WP_001281271.1.43782 WP_001281271.1.43785 WP_001281271.1.43828 WP_001281271.1.43864 WP_001281271.1.43875 WP_001281271.1.43886 WP_001281271.1.43951 WP_001281271.1.44005 WP_001281271.1.44010 WP_001281271.1.4404 WP_001281271.1.4405 WP_001281271.1.44063 WP_001281271.1.44099 WP_001281271.1.44113 WP_001281271.1.44121 WP_001281271.1.44132 WP_001281271.1.44144 WP_001281271.1.44187 WP_001281271.1.44191 WP_001281271.1.4422 WP_001281271.1.4423 WP_001281271.1.44250 WP_001281271.1.44291 WP_001281271.1.44300 WP_001281271.1.44310 WP_001281271.1.44337 WP_001281271.1.44380 WP_001281271.1.4440 WP_001281271.1.44433 WP_001281271.1.44438 WP_001281271.1.44440 WP_001281271.1.44443 WP_001281271.1.44479 WP_001281271.1.44549 WP_001281271.1.44578 WP_001281271.1.44593 WP_001281271.1.44606 WP_001281271.1.44607 WP_001281271.1.44633 WP_001281271.1.44636 WP_001281271.1.44640 WP_001281271.1.4467 WP_001281271.1.44678 WP_001281271.1.44702 WP_001281271.1.44705 WP_001281271.1.44747 WP_001281271.1.44781 WP_001281271.1.44791 WP_001281271.1.44795 WP_001281271.1.44831 WP_001281271.1.44833 WP_001281271.1.4485 WP_001281271.1.44877 WP_001281271.1.44887 WP_001281271.1.449 WP_001281271.1.44927 WP_001281271.1.44933 WP_001281271.1.44943 WP_001281271.1.44950 WP_001281271.1.44966 WP_001281271.1.44971 WP_001281271.1.44978 WP_001281271.1.44996 WP_001281271.1.44997 WP_001281271.1.4500 WP_001281271.1.45027 WP_001281271.1.45038 WP_001281271.1.45045 WP_001281271.1.45067 WP_001281271.1.45074 WP_001281271.1.45079 WP_001281271.1.45098 WP_001281271.1.45123 WP_001281271.1.45134 WP_001281271.1.45138 WP_001281271.1.45145 WP_001281271.1.45154 WP_001281271.1.45173 WP_001281271.1.45177 WP_001281271.1.45184 WP_001281271.1.45259 WP_001281271.1.45302 WP_001281271.1.4531 WP_001281271.1.45322 WP_001281271.1.45344 WP_001281271.1.45349 WP_001281271.1.4540 WP_001281271.1.45402 WP_001281271.1.45432 WP_001281271.1.45434 WP_001281271.1.45468 WP_001281271.1.45522 WP_001281271.1.45544 WP_001281271.1.45549 WP_001281271.1.45550 WP_001281271.1.45569 WP_001281271.1.45571 WP_001281271.1.45582 WP_001281271.1.45583 WP_001281271.1.45585 WP_001281271.1.45622 WP_001281271.1.45690 WP_001281271.1.45781 WP_001281271.1.458 WP_001281271.1.45848 WP_001281271.1.45906 WP_001281271.1.45918 WP_001281271.1.45984 WP_001281271.1.46011 WP_001281271.1.46028 WP_001281271.1.46069 WP_001281271.1.46091 WP_001281271.1.46112 WP_001281271.1.46124 WP_001281271.1.46174 WP_001281271.1.46187 WP_001281271.1.46205 WP_001281271.1.46215 WP_001281271.1.46232 WP_001281271.1.46243 WP_001281271.1.46278 WP_001281271.1.46286 WP_001281271.1.46299 WP_001281271.1.46303 WP_001281271.1.46322 WP_001281271.1.46323 WP_001281271.1.46345 WP_001281271.1.46358 WP_001281271.1.46406 WP_001281271.1.46444 WP_001281271.1.46572 WP_001281271.1.46574 WP_001281271.1.46578 WP_001281271.1.46595 WP_001281271.1.46620 WP_001281271.1.46637 WP_001281271.1.46666 WP_001281271.1.46675 WP_001281271.1.46689 WP_001281271.1.4671 WP_001281271.1.46726 WP_001281271.1.46730 WP_001281271.1.46732 WP_001281271.1.46749 WP_001281271.1.46803 WP_001281271.1.46804 WP_001281271.1.4686 WP_001281271.1.46930 WP_001281271.1.46961 WP_001281271.1.46967 WP_001281271.1.46976 WP_001281271.1.47005 WP_001281271.1.47008 WP_001281271.1.47014 WP_001281271.1.47023 WP_001281271.1.47057 WP_001281271.1.47061 WP_001281271.1.47214 WP_001281271.1.47243 WP_001281271.1.47257 WP_001281271.1.47389 WP_001281271.1.47429 WP_001281271.1.47442 WP_001281271.1.47448 WP_001281271.1.47460 WP_001281271.1.4747 WP_001281271.1.47472 WP_001281271.1.47478 WP_001281271.1.47492 WP_001281271.1.47506 WP_001281271.1.47507 WP_001281271.1.47542 WP_001281271.1.47567 WP_001281271.1.47576 WP_001281271.1.47579 WP_001281271.1.47587 WP_001281271.1.47614 WP_001281271.1.47621 WP_001281271.1.47649 WP_001281271.1.4769 WP_001281271.1.4770 WP_001281271.1.47714 WP_001281271.1.4775 WP_001281271.1.47767 WP_001281271.1.47799 WP_001281271.1.47814 WP_001281271.1.47817 WP_001281271.1.47849 WP_001281271.1.47850 WP_001281271.1.47875 WP_001281271.1.47911 WP_001281271.1.4795 WP_001281271.1.47988 WP_001281271.1.47992 WP_001281271.1.48124 WP_001281271.1.48132 WP_001281271.1.48209 WP_001281271.1.48215 WP_001281271.1.48218 WP_001281271.1.48242 WP_001281271.1.48247 WP_001281271.1.48253 WP_001281271.1.48262 WP_001281271.1.483 WP_001281271.1.48367 WP_001281271.1.48377 WP_001281271.1.4839 WP_001281271.1.48399 WP_001281271.1.48455 WP_001281271.1.48493 WP_001281271.1.48510 WP_001281271.1.48524 WP_001281271.1.4853 WP_001281271.1.48570 WP_001281271.1.48647 WP_001281271.1.48651 WP_001281271.1.48751 WP_001281271.1.48755 WP_001281271.1.48768 WP_001281271.1.48774 WP_001281271.1.48788 WP_001281271.1.48841 WP_001281271.1.4885 WP_001281271.1.48855 WP_001281271.1.48876 WP_001281271.1.48886 WP_001281271.1.48896 WP_001281271.1.48908 WP_001281271.1.48919 WP_001281271.1.48985 WP_001281271.1.49005 WP_001281271.1.49012 WP_001281271.1.49084 WP_001281271.1.49102 WP_001281271.1.49113 WP_001281271.1.49155 WP_001281271.1.49162 WP_001281271.1.49214 WP_001281271.1.49226 WP_001281271.1.49233 WP_001281271.1.49239 WP_001281271.1.49256 WP_001281271.1.49262 WP_001281271.1.49290 WP_001281271.1.49304 WP_001281271.1.49309 WP_001281271.1.49311 WP_001281271.1.49334 WP_001281271.1.49340 WP_001281271.1.49366 WP_001281271.1.49375 WP_001281271.1.49430 WP_001281271.1.49443 WP_001281271.1.49472 WP_001281271.1.49490 WP_001281271.1.49494 WP_001281271.1.49515 WP_001281271.1.49550 WP_001281271.1.49572 WP_001281271.1.49590 WP_001281271.1.49602 WP_001281271.1.49626 WP_001281271.1.49630 WP_001281271.1.49647 WP_001281271.1.49650 WP_001281271.1.49686 WP_001281271.1.49778 WP_001281271.1.4979 WP_001281271.1.49790 WP_001281271.1.49803 WP_001281271.1.49805 WP_001281271.1.49827 WP_001281271.1.49848 WP_001281271.1.49929 WP_001281271.1.50003 WP_001281271.1.50080 WP_001281271.1.5009 WP_001281271.1.50128 WP_001281271.1.50153 WP_001281271.1.50161 WP_001281271.1.50198 WP_001281271.1.50211 WP_001281271.1.50238 WP_001281271.1.50239 WP_001281271.1.50251 WP_001281271.1.50349 WP_001281271.1.50376 WP_001281271.1.50386 WP_001281271.1.50389 WP_001281271.1.50404 WP_001281271.1.50413 WP_001281271.1.50449 WP_001281271.1.50469 WP_001281271.1.50478 WP_001281271.1.50497 WP_001281271.1.50517 WP_001281271.1.50563 WP_001281271.1.5058 WP_001281271.1.50593 WP_001281271.1.50676 WP_001281271.1.50684 WP_001281271.1.50750 WP_001281271.1.50769 WP_001281271.1.50774 WP_001281271.1.50777 WP_001281271.1.50782 WP_001281271.1.50800 WP_001281271.1.50804 WP_001281271.1.50808 WP_001281271.1.50811 WP_001281271.1.5088 WP_001281271.1.50882 WP_001281271.1.50908 WP_001281271.1.50918 WP_001281271.1.50941 WP_001281271.1.50960 WP_001281271.1.50999 WP_001281271.1.51014 WP_001281271.1.51022 WP_001281271.1.51025 WP_001281271.1.51036 WP_001281271.1.51066 WP_001281271.1.51117 WP_001281271.1.51139 WP_001281271.1.51162 WP_001281271.1.51179 WP_001281271.1.51182 WP_001281271.1.51186 WP_001281271.1.51224 WP_001281271.1.5125 WP_001281271.1.51285 WP_001281271.1.51308 WP_001281271.1.51331 WP_001281271.1.51356 WP_001281271.1.5138 WP_001281271.1.51394 WP_001281271.1.51412 WP_001281271.1.51414 WP_001281271.1.51419 WP_001281271.1.51451 WP_001281271.1.51487 WP_001281271.1.51488 WP_001281271.1.51502 WP_001281271.1.51506 WP_001281271.1.51514 WP_001281271.1.51518 WP_001281271.1.51555 WP_001281271.1.51611 WP_001281271.1.51613 WP_001281271.1.51615 WP_001281271.1.51634 WP_001281271.1.51642 WP_001281271.1.51649 WP_001281271.1.51686 WP_001281271.1.51704 WP_001281271.1.51756 WP_001281271.1.51810 WP_001281271.1.51831 WP_001281271.1.51868 WP_001281271.1.51900 WP_001281271.1.51910 WP_001281271.1.51911 WP_001281271.1.51914 WP_001281271.1.51930 WP_001281271.1.51932 WP_001281271.1.51989 WP_001281271.1.51994 WP_001281271.1.520 WP_001281271.1.52047 WP_001281271.1.5211 WP_001281271.1.52121 WP_001281271.1.52123 WP_001281271.1.52148 WP_001281271.1.52156 WP_001281271.1.5216 WP_001281271.1.52161 WP_001281271.1.52170 WP_001281271.1.52255 WP_001281271.1.52301 WP_001281271.1.52321 WP_001281271.1.52336 WP_001281271.1.52346 WP_001281271.1.52353 WP_001281271.1.52356 WP_001281271.1.52361 WP_001281271.1.52527 WP_001281271.1.52528 WP_001281271.1.52586 WP_001281271.1.52608 WP_001281271.1.52653 WP_001281271.1.52656 WP_001281271.1.5273 WP_001281271.1.52738 WP_001281271.1.52743 WP_001281271.1.52744 WP_001281271.1.52824 WP_001281271.1.52833 WP_001281271.1.52851 WP_001281271.1.52857 WP_001281271.1.52866 WP_001281271.1.52915 WP_001281271.1.52924 WP_001281271.1.52949 WP_001281271.1.5301 WP_001281271.1.53016 WP_001281271.1.53100 WP_001281271.1.53119 WP_001281271.1.5313 WP_001281271.1.53179 WP_001281271.1.53190 WP_001281271.1.53206 WP_001281271.1.53272 WP_001281271.1.53274 WP_001281271.1.53286 WP_001281271.1.53315 WP_001281271.1.53316 WP_001281271.1.53328 WP_001281271.1.5333 WP_001281271.1.53362 WP_001281271.1.53385 WP_001281271.1.53406 WP_001281271.1.53436 WP_001281271.1.53454 WP_001281271.1.53466 WP_001281271.1.53529 WP_001281271.1.53534 WP_001281271.1.53543 WP_001281271.1.53567 WP_001281271.1.53664 WP_001281271.1.53675 WP_001281271.1.53694 WP_001281271.1.53757 WP_001281271.1.53778 WP_001281271.1.53790 WP_001281271.1.53812 WP_001281271.1.53814 WP_001281271.1.53896 WP_001281271.1.53905 WP_001281271.1.5392 WP_001281271.1.53935 WP_001281271.1.53961 WP_001281271.1.54033 WP_001281271.1.54061 WP_001281271.1.54075 WP_001281271.1.54082 WP_001281271.1.54085 WP_001281271.1.54136 WP_001281271.1.5415 WP_001281271.1.54159 WP_001281271.1.542 WP_001281271.1.54209 WP_001281271.1.54271 WP_001281271.1.54273 WP_001281271.1.54319 WP_001281271.1.54324 WP_001281271.1.54364 WP_001281271.1.54366 WP_001281271.1.54400 WP_001281271.1.54500 WP_001281271.1.54522 WP_001281271.1.54526 WP_001281271.1.54558 WP_001281271.1.5456 WP_001281271.1.54569 WP_001281271.1.54607 WP_001281271.1.54615 WP_001281271.1.5462 WP_001281271.1.54644 WP_001281271.1.54662 WP_001281271.1.54694 WP_001281271.1.54722 WP_001281271.1.54764 WP_001281271.1.54814 WP_001281271.1.54822 WP_001281271.1.54827 WP_001281271.1.54833 WP_001281271.1.54845 WP_001281271.1.54877 WP_001281271.1.5493 WP_001281271.1.54936 WP_001281271.1.54984 WP_001281271.1.54992 WP_001281271.1.55008 WP_001281271.1.55073 WP_001281271.1.55152 WP_001281271.1.55156 WP_001281271.1.55166 WP_001281271.1.5517 WP_001281271.1.55200 WP_001281271.1.55223 WP_001281271.1.55224 WP_001281271.1.5523 WP_001281271.1.5525 WP_001281271.1.5527 WP_001281271.1.55285 WP_001281271.1.55325 WP_001281271.1.55418 WP_001281271.1.55430 WP_001281271.1.55461 WP_001281271.1.55475 WP_001281271.1.55545 WP_001281271.1.55554 WP_001281271.1.55557 WP_001281271.1.55559 WP_001281271.1.5560 WP_001281271.1.55614 WP_001281271.1.55623 WP_001281271.1.55647 WP_001281271.1.55680 WP_001281271.1.5572 WP_001281271.1.55743 WP_001281271.1.55768 WP_001281271.1.5577 WP_001281271.1.55782 WP_001281271.1.55796 WP_001281271.1.55803 WP_001281271.1.55948 WP_001281271.1.55973 WP_001281271.1.55993 WP_001281271.1.56002 WP_001281271.1.56012 WP_001281271.1.56026 WP_001281271.1.56059 WP_001281271.1.56069 WP_001281271.1.56070 WP_001281271.1.56082 WP_001281271.1.56097 WP_001281271.1.56100 WP_001281271.1.56105 WP_001281271.1.56130 WP_001281271.1.56222 WP_001281271.1.56235 WP_001281271.1.56238 WP_001281271.1.56244 WP_001281271.1.56247 WP_001281271.1.56261 WP_001281271.1.56263 WP_001281271.1.56303 WP_001281271.1.56304 WP_001281271.1.56305 WP_001281271.1.56354 WP_001281271.1.56368 WP_001281271.1.56370 WP_001281271.1.56385 WP_001281271.1.56393 WP_001281271.1.56396 WP_001281271.1.56413 WP_001281271.1.56414 WP_001281271.1.56420 WP_001281271.1.56438 WP_001281271.1.56468 WP_001281271.1.56512 WP_001281271.1.56559 WP_001281271.1.56597 WP_001281271.1.56601 WP_001281271.1.56614 WP_001281271.1.56642 WP_001281271.1.56647 WP_001281271.1.56651 WP_001281271.1.56660 WP_001281271.1.56671 WP_001281271.1.5668 WP_001281271.1.56682 WP_001281271.1.56824 WP_001281271.1.56853 WP_001281271.1.56861 WP_001281271.1.56875 WP_001281271.1.56893 WP_001281271.1.56898 WP_001281271.1.56905 WP_001281271.1.56942 WP_001281271.1.57000 WP_001281271.1.57026 WP_001281271.1.57039 WP_001281271.1.57076 WP_001281271.1.57084 WP_001281271.1.5711 WP_001281271.1.57143 WP_001281271.1.57149 WP_001281271.1.57168 WP_001281271.1.57187 WP_001281271.1.57232 WP_001281271.1.57233 WP_001281271.1.57244 WP_001281271.1.57246 WP_001281271.1.57296 WP_001281271.1.57307 WP_001281271.1.57344 WP_001281271.1.57356 WP_001281271.1.57357 WP_001281271.1.57377 WP_001281271.1.57399 WP_001281271.1.57418 WP_001281271.1.57433 WP_001281271.1.57510 WP_001281271.1.57515 WP_001281271.1.57529 WP_001281271.1.5753 WP_001281271.1.57534 WP_001281271.1.57559 WP_001281271.1.57576 WP_001281271.1.57601 WP_001281271.1.57607 WP_001281271.1.5761 WP_001281271.1.57641 WP_001281271.1.57735 WP_001281271.1.5774 WP_001281271.1.57763 WP_001281271.1.57778 WP_001281271.1.57781 WP_001281271.1.5781 WP_001281271.1.57835 WP_001281271.1.57857 WP_001281271.1.57862 WP_001281271.1.57890 WP_001281271.1.57891 WP_001281271.1.57893 WP_001281271.1.57978 WP_001281271.1.5801 WP_001281271.1.58040 WP_001281271.1.58041 WP_001281271.1.58090 WP_001281271.1.58131 WP_001281271.1.58157 WP_001281271.1.58239 WP_001281271.1.58249 WP_001281271.1.58251 WP_001281271.1.5828 WP_001281271.1.58301 WP_001281271.1.58334 WP_001281271.1.58358 WP_001281271.1.58372 WP_001281271.1.58407 WP_001281271.1.58416 WP_001281271.1.58418 WP_001281271.1.58442 WP_001281271.1.58443 WP_001281271.1.58451 WP_001281271.1.58486 WP_001281271.1.58489 WP_001281271.1.5854 WP_001281271.1.58548 WP_001281271.1.58564 WP_001281271.1.5858 WP_001281271.1.58633 WP_001281271.1.58662 WP_001281271.1.58669 WP_001281271.1.58675 WP_001281271.1.58698 WP_001281271.1.587 WP_001281271.1.58729 WP_001281271.1.58745 WP_001281271.1.5878 WP_001281271.1.58803 WP_001281271.1.58834 WP_001281271.1.58836 WP_001281271.1.5886 WP_001281271.1.58861 WP_001281271.1.58884 WP_001281271.1.58932 WP_001281271.1.59006 WP_001281271.1.59012 WP_001281271.1.59068 WP_001281271.1.59084 WP_001281271.1.59094 WP_001281271.1.59097 WP_001281271.1.59125 WP_001281271.1.59136 WP_001281271.1.59142 WP_001281271.1.59148 WP_001281271.1.59163 WP_001281271.1.59224 WP_001281271.1.59236 WP_001281271.1.59276 WP_001281271.1.5929 WP_001281271.1.59294 WP_001281271.1.59295 WP_001281271.1.59321 WP_001281271.1.59336 WP_001281271.1.59375 WP_001281271.1.59381 WP_001281271.1.59420 WP_001281271.1.59427 WP_001281271.1.59439 WP_001281271.1.59458 WP_001281271.1.59490 WP_001281271.1.59508 WP_001281271.1.59512 WP_001281271.1.59521 WP_001281271.1.5953 WP_001281271.1.59538 WP_001281271.1.59548 WP_001281271.1.59562 WP_001281271.1.59636 WP_001281271.1.59641 WP_001281271.1.59646 WP_001281271.1.59648 WP_001281271.1.59684 WP_001281271.1.59694 WP_001281271.1.59709 WP_001281271.1.59710 WP_001281271.1.59771 WP_001281271.1.59830 WP_001281271.1.59848 WP_001281271.1.59928 WP_001281271.1.59953 WP_001281271.1.59979 WP_001281271.1.60004 WP_001281271.1.60008 WP_001281271.1.60015 WP_001281271.1.60021 WP_001281271.1.60069 WP_001281271.1.60106 WP_001281271.1.60137 WP_001281271.1.60140 WP_001281271.1.60155 WP_001281271.1.60209 WP_001281271.1.60213 WP_001281271.1.60226 WP_001281271.1.60231 WP_001281271.1.60285 WP_001281271.1.6033 WP_001281271.1.60379 WP_001281271.1.60425 WP_001281271.1.60464 WP_001281271.1.60503 WP_001281271.1.60507 WP_001281271.1.6052 WP_001281271.1.60560 WP_001281271.1.60561 WP_001281271.1.60608 WP_001281271.1.60622 WP_001281271.1.60643 WP_001281271.1.60661 WP_001281271.1.60713 WP_001281271.1.60760 WP_001281271.1.60772 WP_001281271.1.60809 WP_001281271.1.60838 WP_001281271.1.60851 WP_001281271.1.60857 WP_001281271.1.60863 WP_001281271.1.60874 WP_001281271.1.60919 WP_001281271.1.60926 WP_001281271.1.60941 WP_001281271.1.60988 WP_001281271.1.60990 WP_001281271.1.61045 WP_001281271.1.61078 WP_001281271.1.6108 WP_001281271.1.61087 WP_001281271.1.61114 WP_001281271.1.6114 WP_001281271.1.61146 WP_001281271.1.61184 WP_001281271.1.61200 WP_001281271.1.61201 WP_001281271.1.61232 WP_001281271.1.61233 WP_001281271.1.6129 WP_001281271.1.61345 WP_001281271.1.61356 WP_001281271.1.61381 WP_001281271.1.61417 WP_001281271.1.6143 WP_001281271.1.61434 WP_001281271.1.61501 WP_001281271.1.61509 WP_001281271.1.61574 WP_001281271.1.61594 WP_001281271.1.61595 WP_001281271.1.61609 WP_001281271.1.6164 WP_001281271.1.61662 WP_001281271.1.61712 WP_001281271.1.61730 WP_001281271.1.61732 WP_001281271.1.61737 WP_001281271.1.61857 WP_001281271.1.61908 WP_001281271.1.61918 WP_001281271.1.61922 WP_001281271.1.61924 WP_001281271.1.61952 WP_001281271.1.62007 WP_001281271.1.62020 WP_001281271.1.62025 WP_001281271.1.6209 WP_001281271.1.6210 WP_001281271.1.62108 WP_001281271.1.62184 WP_001281271.1.62201 WP_001281271.1.62204 WP_001281271.1.62210 WP_001281271.1.62219 WP_001281271.1.62222 WP_001281271.1.62241 WP_001281271.1.62257 WP_001281271.1.62271 WP_001281271.1.62304 WP_001281271.1.62310 WP_001281271.1.62339 WP_001281271.1.62344 WP_001281271.1.62361 WP_001281271.1.62364 WP_001281271.1.62374 WP_001281271.1.62403 WP_001281271.1.62404 WP_001281271.1.62486 WP_001281271.1.62504 WP_001281271.1.62570 WP_001281271.1.62648 WP_001281271.1.62677 WP_001281271.1.62693 WP_001281271.1.627 WP_001281271.1.62757 WP_001281271.1.62798 WP_001281271.1.62828 WP_001281271.1.62903 WP_001281271.1.62910 WP_001281271.1.62955 WP_001281271.1.62983 WP_001281271.1.62988 WP_001281271.1.63043 WP_001281271.1.63045 WP_001281271.1.63063 WP_001281271.1.63102 WP_001281271.1.63118 WP_001281271.1.63129 WP_001281271.1.63135 WP_001281271.1.63155 WP_001281271.1.63181 WP_001281271.1.63186 WP_001281271.1.63203 WP_001281271.1.63229 WP_001281271.1.63234 WP_001281271.1.63243 WP_001281271.1.63250 WP_001281271.1.63256 WP_001281271.1.63290 WP_001281271.1.63358 WP_001281271.1.63382 WP_001281271.1.63422 WP_001281271.1.63432 WP_001281271.1.63479 WP_001281271.1.63497 WP_001281271.1.63499 WP_001281271.1.63509 WP_001281271.1.63513 WP_001281271.1.63525 WP_001281271.1.63529 WP_001281271.1.63532 WP_001281271.1.63568 WP_001281271.1.63585 WP_001281271.1.63603 WP_001281271.1.63633 WP_001281271.1.63664 WP_001281271.1.6367 WP_001281271.1.63677 WP_001281271.1.63690 WP_001281271.1.6370 WP_001281271.1.63718 WP_001281271.1.63748 WP_001281271.1.6375 WP_001281271.1.63757 WP_001281271.1.63766 WP_001281271.1.63782 WP_001281271.1.63797 WP_001281271.1.63824 WP_001281271.1.63831 WP_001281271.1.63834 WP_001281271.1.63851 WP_001281271.1.63863 WP_001281271.1.63864 WP_001281271.1.63866 WP_001281271.1.63903 WP_001281271.1.63912 WP_001281271.1.63934 WP_001281271.1.63958 WP_001281271.1.63977 WP_001281271.1.6399 WP_001281271.1.63992 WP_001281271.1.64007 WP_001281271.1.64010 WP_001281271.1.64018 WP_001281271.1.64034 WP_001281271.1.64072 WP_001281271.1.64085 WP_001281271.1.64109 WP_001281271.1.64157 WP_001281271.1.64208 WP_001281271.1.64217 WP_001281271.1.64229 WP_001281271.1.64242 WP_001281271.1.64244 WP_001281271.1.64266 WP_001281271.1.64350 WP_001281271.1.6437 WP_001281271.1.64374 WP_001281271.1.64385 WP_001281271.1.64387 WP_001281271.1.64403 WP_001281271.1.64412 WP_001281271.1.64462 WP_001281271.1.6451 WP_001281271.1.64569 WP_001281271.1.64597 WP_001281271.1.64645 WP_001281271.1.64649 WP_001281271.1.64667 WP_001281271.1.64690 WP_001281271.1.64702 WP_001281271.1.64711 WP_001281271.1.64757 WP_001281271.1.64758 WP_001281271.1.64781 WP_001281271.1.64798 WP_001281271.1.64831 WP_001281271.1.6489 WP_001281271.1.64894 WP_001281271.1.64919 WP_001281271.1.64920 WP_001281271.1.64944 WP_001281271.1.64972 WP_001281271.1.64977 WP_001281271.1.65011 WP_001281271.1.65016 WP_001281271.1.65018 WP_001281271.1.65022 WP_001281271.1.65027 WP_001281271.1.65028 WP_001281271.1.65052 WP_001281271.1.65163 WP_001281271.1.65168 WP_001281271.1.65171 WP_001281271.1.65185 WP_001281271.1.65238 WP_001281271.1.65248 WP_001281271.1.6525 WP_001281271.1.65269 WP_001281271.1.65295 WP_001281271.1.6535 WP_001281271.1.65357 WP_001281271.1.65394 WP_001281271.1.65475 WP_001281271.1.6550 WP_001281271.1.65508 WP_001281271.1.65538 WP_001281271.1.65558 WP_001281271.1.65572 WP_001281271.1.6560 WP_001281271.1.65601 WP_001281271.1.6561 WP_001281271.1.65633 WP_001281271.1.6565 WP_001281271.1.65696 WP_001281271.1.65698 WP_001281271.1.6572 WP_001281271.1.6575 WP_001281271.1.65771 WP_001281271.1.65782 WP_001281271.1.65795 WP_001281271.1.65818 WP_001281271.1.65838 WP_001281271.1.65849 WP_001281271.1.65876 WP_001281271.1.65881 WP_001281271.1.65883 WP_001281271.1.65901 WP_001281271.1.6594 WP_001281271.1.65940 WP_001281271.1.6595 WP_001281271.1.65956 WP_001281271.1.65968 WP_001281271.1.66049 WP_001281271.1.66074 WP_001281271.1.66085 WP_001281271.1.66129 WP_001281271.1.66167 WP_001281271.1.66171 WP_001281271.1.66235 WP_001281271.1.66250 WP_001281271.1.66270 WP_001281271.1.66272 WP_001281271.1.6630 WP_001281271.1.66314 WP_001281271.1.66315 WP_001281271.1.66330 WP_001281271.1.66358 WP_001281271.1.66362 WP_001281271.1.66365 WP_001281271.1.6638 WP_001281271.1.66385 WP_001281271.1.6640 WP_001281271.1.66400 WP_001281271.1.66428 WP_001281271.1.66446 WP_001281271.1.66462 WP_001281271.1.6647 WP_001281271.1.66492 WP_001281271.1.66534 WP_001281271.1.66539 WP_001281271.1.66600 WP_001281271.1.66630 WP_001281271.1.66678 WP_001281271.1.66702 WP_001281271.1.66733 WP_001281271.1.66779 WP_001281271.1.66807 WP_001281271.1.66820 WP_001281271.1.66834 WP_001281271.1.66901 WP_001281271.1.6692 WP_001281271.1.66959 WP_001281271.1.67 WP_001281271.1.67037 WP_001281271.1.67045 WP_001281271.1.67075 WP_001281271.1.67173 WP_001281271.1.67175 WP_001281271.1.67181 WP_001281271.1.67184 WP_001281271.1.67235 WP_001281271.1.67268 WP_001281271.1.67279 WP_001281271.1.67288 WP_001281271.1.67347 WP_001281271.1.67374 WP_001281271.1.6739 WP_001281271.1.67405 WP_001281271.1.67465 WP_001281271.1.67552 WP_001281271.1.6760 WP_001281271.1.67603 WP_001281271.1.67637 WP_001281271.1.67682 WP_001281271.1.67707 WP_001281271.1.67731 WP_001281271.1.67772 WP_001281271.1.67803 WP_001281271.1.67814 WP_001281271.1.6782 WP_001281271.1.67825 WP_001281271.1.67827 WP_001281271.1.67829 WP_001281271.1.67887 WP_001281271.1.67924 WP_001281271.1.67932 WP_001281271.1.67969 WP_001281271.1.67970 WP_001281271.1.67988 WP_001281271.1.68036 WP_001281271.1.68073 WP_001281271.1.68075 WP_001281271.1.6809 WP_001281271.1.68115 WP_001281271.1.68140 WP_001281271.1.68147 WP_001281271.1.68201 WP_001281271.1.68206 WP_001281271.1.6827 WP_001281271.1.68275 WP_001281271.1.6833 WP_001281271.1.68401 WP_001281271.1.68477 WP_001281271.1.68478 WP_001281271.1.6849 WP_001281271.1.68532 WP_001281271.1.68547 WP_001281271.1.6857 WP_001281271.1.68589 WP_001281271.1.68629 WP_001281271.1.68652 WP_001281271.1.68655 WP_001281271.1.68656 WP_001281271.1.68677 WP_001281271.1.6869 WP_001281271.1.68690 WP_001281271.1.6875 WP_001281271.1.68787 WP_001281271.1.6879 WP_001281271.1.68818 WP_001281271.1.6882 WP_001281271.1.6883 WP_001281271.1.68893 WP_001281271.1.68894 WP_001281271.1.68895 WP_001281271.1.68928 WP_001281271.1.68958 WP_001281271.1.68975 WP_001281271.1.68999 WP_001281271.1.69001 WP_001281271.1.69006 WP_001281271.1.69011 WP_001281271.1.69029 WP_001281271.1.6904 WP_001281271.1.6905 WP_001281271.1.69058 WP_001281271.1.69086 WP_001281271.1.6913 WP_001281271.1.69131 WP_001281271.1.69139 WP_001281271.1.69146 WP_001281271.1.69151 WP_001281271.1.69236 WP_001281271.1.69255 WP_001281271.1.69273 WP_001281271.1.69288 WP_001281271.1.69296 WP_001281271.1.69320 WP_001281271.1.69346 WP_001281271.1.69357 WP_001281271.1.69359 WP_001281271.1.69371 WP_001281271.1.69385 WP_001281271.1.69397 WP_001281271.1.69433 WP_001281271.1.69465 WP_001281271.1.69485 WP_001281271.1.6954 WP_001281271.1.69554 WP_001281271.1.69564 WP_001281271.1.69575 WP_001281271.1.69588 WP_001281271.1.69592 WP_001281271.1.69597 WP_001281271.1.69616 WP_001281271.1.69636 WP_001281271.1.69644 WP_001281271.1.69696 WP_001281271.1.69704 WP_001281271.1.69754 WP_001281271.1.69758 WP_001281271.1.69767 WP_001281271.1.69785 WP_001281271.1.69787 WP_001281271.1.69790 WP_001281271.1.69807 WP_001281271.1.69808 WP_001281271.1.69839 WP_001281271.1.69848 WP_001281271.1.69890 WP_001281271.1.69965 WP_001281271.1.69975 WP_001281271.1.69982 WP_001281271.1.70003 WP_001281271.1.7010 WP_001281271.1.7014 WP_001281271.1.70169 WP_001281271.1.70183 WP_001281271.1.7021 WP_001281271.1.70241 WP_001281271.1.70248 WP_001281271.1.70269 WP_001281271.1.70272 WP_001281271.1.70289 WP_001281271.1.70290 WP_001281271.1.70321 WP_001281271.1.70326 WP_001281271.1.70327 WP_001281271.1.70440 WP_001281271.1.70447 WP_001281271.1.70523 WP_001281271.1.70531 WP_001281271.1.70547 WP_001281271.1.7055 WP_001281271.1.70596 WP_001281271.1.7060 WP_001281271.1.70643 WP_001281271.1.70644 WP_001281271.1.70662 WP_001281271.1.70678 WP_001281271.1.70683 WP_001281271.1.70712 WP_001281271.1.70761 WP_001281271.1.70785 WP_001281271.1.70792 WP_001281271.1.70797 WP_001281271.1.70837 WP_001281271.1.70869 WP_001281271.1.70883 WP_001281271.1.70899 WP_001281271.1.70914 WP_001281271.1.70922 WP_001281271.1.70948 WP_001281271.1.70959 WP_001281271.1.70969 WP_001281271.1.70971 WP_001281271.1.70985 WP_001281271.1.71007 WP_001281271.1.71010 WP_001281271.1.71023 WP_001281271.1.71069 WP_001281271.1.71088 WP_001281271.1.7110 WP_001281271.1.71120 WP_001281271.1.71146 WP_001281271.1.71150 WP_001281271.1.71165 WP_001281271.1.71172 WP_001281271.1.71184 WP_001281271.1.71188 WP_001281271.1.71201 WP_001281271.1.71202 WP_001281271.1.71248 WP_001281271.1.71268 WP_001281271.1.71299 WP_001281271.1.71305 WP_001281271.1.71337 WP_001281271.1.71363 WP_001281271.1.71378 WP_001281271.1.71407 WP_001281271.1.71418 WP_001281271.1.7142 WP_001281271.1.71446 WP_001281271.1.71481 WP_001281271.1.71500 WP_001281271.1.71626 WP_001281271.1.71636 WP_001281271.1.71649 WP_001281271.1.71656 WP_001281271.1.71667 WP_001281271.1.71691 WP_001281271.1.71702 WP_001281271.1.7174 WP_001281271.1.71746 WP_001281271.1.71750 WP_001281271.1.71756 WP_001281271.1.71798 WP_001281271.1.71845 WP_001281271.1.71848 WP_001281271.1.71881 WP_001281271.1.71908 WP_001281271.1.71941 WP_001281271.1.71952 WP_001281271.1.71973 WP_001281271.1.71979 WP_001281271.1.71984 WP_001281271.1.720 WP_001281271.1.72065 WP_001281271.1.72100 WP_001281271.1.72105 WP_001281271.1.72119 WP_001281271.1.72121 WP_001281271.1.72190 WP_001281271.1.72203 WP_001281271.1.72221 WP_001281271.1.72226 WP_001281271.1.72243 WP_001281271.1.72254 WP_001281271.1.72281 WP_001281271.1.72300 WP_001281271.1.72307 WP_001281271.1.72325 WP_001281271.1.72351 WP_001281271.1.72372 WP_001281271.1.72376 WP_001281271.1.72382 WP_001281271.1.72403 WP_001281271.1.72412 WP_001281271.1.72438 WP_001281271.1.72532 WP_001281271.1.72602 WP_001281271.1.72642 WP_001281271.1.72689 WP_001281271.1.72716 WP_001281271.1.72718 WP_001281271.1.72728 WP_001281271.1.72793 WP_001281271.1.72827 WP_001281271.1.72850 WP_001281271.1.72865 WP_001281271.1.72871 WP_001281271.1.72872 WP_001281271.1.72892 WP_001281271.1.72897 WP_001281271.1.72946 WP_001281271.1.7295 WP_001281271.1.72975 WP_001281271.1.7304 WP_001281271.1.73062 WP_001281271.1.73068 WP_001281271.1.73125 WP_001281271.1.73144 WP_001281271.1.7315 WP_001281271.1.7316 WP_001281271.1.73164 WP_001281271.1.73200 WP_001281271.1.73270 WP_001281271.1.7334 WP_001281271.1.73362 WP_001281271.1.73377 WP_001281271.1.73379 WP_001281271.1.7341 WP_001281271.1.73461 WP_001281271.1.73481 WP_001281271.1.73512 WP_001281271.1.73535 WP_001281271.1.7356 WP_001281271.1.73561 WP_001281271.1.73581 WP_001281271.1.73617 WP_001281271.1.73667 WP_001281271.1.73708 WP_001281271.1.73753 WP_001281271.1.73758 WP_001281271.1.73794 WP_001281271.1.73804 WP_001281271.1.73831 WP_001281271.1.73847 WP_001281271.1.7386 WP_001281271.1.7387 WP_001281271.1.73924 WP_001281271.1.73926 WP_001281271.1.7394 WP_001281271.1.73945 WP_001281271.1.73958 WP_001281271.1.73965 WP_001281271.1.74029 WP_001281271.1.74040 WP_001281271.1.74049 WP_001281271.1.7405 WP_001281271.1.74089 WP_001281271.1.74117 WP_001281271.1.74174 WP_001281271.1.74181 WP_001281271.1.74191 WP_001281271.1.74207 WP_001281271.1.74228 WP_001281271.1.74248 WP_001281271.1.743 WP_001281271.1.74300 WP_001281271.1.7433 WP_001281271.1.74379 WP_001281271.1.74402 WP_001281271.1.74410 WP_001281271.1.74414 WP_001281271.1.74422 WP_001281271.1.7444 WP_001281271.1.74454 WP_001281271.1.74466 WP_001281271.1.74481 WP_001281271.1.745 WP_001281271.1.74529 WP_001281271.1.74545 WP_001281271.1.74570 WP_001281271.1.74578 WP_001281271.1.7458 WP_001281271.1.74620 WP_001281271.1.74639 WP_001281271.1.74644 WP_001281271.1.74661 WP_001281271.1.74702 WP_001281271.1.74741 WP_001281271.1.74745 WP_001281271.1.74757 WP_001281271.1.74806 WP_001281271.1.74807 WP_001281271.1.74826 WP_001281271.1.74876 WP_001281271.1.74884 WP_001281271.1.7491 WP_001281271.1.74972 WP_001281271.1.74992 WP_001281271.1.74996 WP_001281271.1.75009 WP_001281271.1.75051 WP_001281271.1.75056 WP_001281271.1.75058 WP_001281271.1.75129 WP_001281271.1.75134 WP_001281271.1.75159 WP_001281271.1.75180 WP_001281271.1.75187 WP_001281271.1.75288 WP_001281271.1.75301 WP_001281271.1.7531 WP_001281271.1.75334 WP_001281271.1.75362 WP_001281271.1.75371 WP_001281271.1.75385 WP_001281271.1.75392 WP_001281271.1.75400 WP_001281271.1.75402 WP_001281271.1.7543 WP_001281271.1.75450 WP_001281271.1.75494 WP_001281271.1.7558 WP_001281271.1.75585 WP_001281271.1.75607 WP_001281271.1.75609 WP_001281271.1.75626 WP_001281271.1.75664 WP_001281271.1.75716 WP_001281271.1.75740 WP_001281271.1.75751 WP_001281271.1.75760 WP_001281271.1.75764 WP_001281271.1.75793 WP_001281271.1.75794 WP_001281271.1.75810 WP_001281271.1.75902 WP_001281271.1.75932 WP_001281271.1.75957 WP_001281271.1.76020 WP_001281271.1.76055 WP_001281271.1.76097 WP_001281271.1.76102 WP_001281271.1.76115 WP_001281271.1.76137 WP_001281271.1.76156 WP_001281271.1.76170 WP_001281271.1.76186 WP_001281271.1.76197 WP_001281271.1.76208 WP_001281271.1.76252 WP_001281271.1.7629 WP_001281271.1.76301 WP_001281271.1.76327 WP_001281271.1.7634 WP_001281271.1.76345 WP_001281271.1.76346 WP_001281271.1.76364 WP_001281271.1.76434 WP_001281271.1.76445 WP_001281271.1.76471 WP_001281271.1.76529 WP_001281271.1.76532 WP_001281271.1.76548 WP_001281271.1.7657 WP_001281271.1.76576 WP_001281271.1.7660 WP_001281271.1.76611 WP_001281271.1.76673 WP_001281271.1.76706 WP_001281271.1.7672 WP_001281271.1.76721 WP_001281271.1.76724 WP_001281271.1.76738 WP_001281271.1.76756 WP_001281271.1.76760 WP_001281271.1.76776 WP_001281271.1.76799 WP_001281271.1.76806 WP_001281271.1.7684 WP_001281271.1.76875 WP_001281271.1.76880 WP_001281271.1.76899 WP_001281271.1.76913 WP_001281271.1.76968 WP_001281271.1.77017 WP_001281271.1.77038 WP_001281271.1.77047 WP_001281271.1.77177 WP_001281271.1.77180 WP_001281271.1.77193 WP_001281271.1.77241 WP_001281271.1.77244 WP_001281271.1.77267 WP_001281271.1.77271 WP_001281271.1.77292 WP_001281271.1.77306 WP_001281271.1.77313 WP_001281271.1.77349 WP_001281271.1.77356 WP_001281271.1.77390 WP_001281271.1.77436 WP_001281271.1.77475 WP_001281271.1.77514 WP_001281271.1.77529 WP_001281271.1.77543 WP_001281271.1.77549 WP_001281271.1.77555 WP_001281271.1.77575 WP_001281271.1.77596 WP_001281271.1.77646 WP_001281271.1.77692 WP_001281271.1.77710 WP_001281271.1.77729 WP_001281271.1.77754 WP_001281271.1.77761 WP_001281271.1.7782 WP_001281271.1.7784 WP_001281271.1.77846 WP_001281271.1.77851 WP_001281271.1.77871 WP_001281271.1.77898 WP_001281271.1.77918 WP_001281271.1.7792 WP_001281271.1.7793 WP_001281271.1.77951 WP_001281271.1.77960 WP_001281271.1.77971 WP_001281271.1.77983 WP_001281271.1.77987 WP_001281271.1.77989 WP_001281271.1.78 WP_001281271.1.78016 WP_001281271.1.78026 WP_001281271.1.78033 WP_001281271.1.78051 WP_001281271.1.78053 WP_001281271.1.78076 WP_001281271.1.78096 WP_001281271.1.78100 WP_001281271.1.78110 WP_001281271.1.78120 WP_001281271.1.7814 WP_001281271.1.78170 WP_001281271.1.78180 WP_001281271.1.78201 WP_001281271.1.78245 WP_001281271.1.78301 WP_001281271.1.78339 WP_001281271.1.78372 WP_001281271.1.78383 WP_001281271.1.78407 WP_001281271.1.78443 WP_001281271.1.78501 WP_001281271.1.78502 WP_001281271.1.78602 WP_001281271.1.78603 WP_001281271.1.78618 WP_001281271.1.78658 WP_001281271.1.78735 WP_001281271.1.78738 WP_001281271.1.7877 WP_001281271.1.78771 WP_001281271.1.78789 WP_001281271.1.78802 WP_001281271.1.78815 WP_001281271.1.78830 WP_001281271.1.78835 WP_001281271.1.78838 WP_001281271.1.78862 WP_001281271.1.78874 WP_001281271.1.78881 WP_001281271.1.78896 WP_001281271.1.7891 WP_001281271.1.78913 WP_001281271.1.7893 WP_001281271.1.78930 WP_001281271.1.79011 WP_001281271.1.79032 WP_001281271.1.79140 WP_001281271.1.79167 WP_001281271.1.79189 WP_001281271.1.79203 WP_001281271.1.79289 WP_001281271.1.79297 WP_001281271.1.79302 WP_001281271.1.79335 WP_001281271.1.79427 WP_001281271.1.79462 WP_001281271.1.79466 WP_001281271.1.79490 WP_001281271.1.79529 WP_001281271.1.7956 WP_001281271.1.79570 WP_001281271.1.79580 WP_001281271.1.79586 WP_001281271.1.79635 WP_001281271.1.7964 WP_001281271.1.79645 WP_001281271.1.79659 WP_001281271.1.79668 WP_001281271.1.79708 WP_001281271.1.7972 WP_001281271.1.79734 WP_001281271.1.7979 WP_001281271.1.7982 WP_001281271.1.79832 WP_001281271.1.79845 WP_001281271.1.79867 WP_001281271.1.79892 WP_001281271.1.79910 WP_001281271.1.79914 WP_001281271.1.79929 WP_001281271.1.79934 WP_001281271.1.79942 WP_001281271.1.79951 WP_001281271.1.79966 WP_001281271.1.79974 WP_001281271.1.79977 WP_001281271.1.79996 WP_001281271.1.80077 WP_001281271.1.80137 WP_001281271.1.80149 WP_001281271.1.80182 WP_001281271.1.80236 WP_001281271.1.80249 WP_001281271.1.80250 WP_001281271.1.80254 WP_001281271.1.80293 WP_001281271.1.80296 WP_001281271.1.80307 WP_001281271.1.80366 WP_001281271.1.80380 WP_001281271.1.80441 WP_001281271.1.80473 WP_001281271.1.80479 WP_001281271.1.80480 WP_001281271.1.80529 WP_001281271.1.80586 WP_001281271.1.80651 WP_001281271.1.80667 WP_001281271.1.80674 WP_001281271.1.80707 WP_001281271.1.80725 WP_001281271.1.80741 WP_001281271.1.80750 WP_001281271.1.80760 WP_001281271.1.80803 WP_001281271.1.80827 WP_001281271.1.80831 WP_001281271.1.80840 WP_001281271.1.80850 WP_001281271.1.80868 WP_001281271.1.80874 WP_001281271.1.80881 WP_001281271.1.80913 WP_001281271.1.80959 WP_001281271.1.8096 WP_001281271.1.80973 WP_001281271.1.81037 WP_001281271.1.81041 WP_001281271.1.8106 WP_001281271.1.81069 WP_001281271.1.81084 WP_001281271.1.81109 WP_001281271.1.81110 WP_001281271.1.81149 WP_001281271.1.81175 WP_001281271.1.8119 WP_001281271.1.81193 WP_001281271.1.81197 WP_001281271.1.81225 WP_001281271.1.81305 WP_001281271.1.81320 WP_001281271.1.81321 WP_001281271.1.81328 WP_001281271.1.8134 WP_001281271.1.81354 WP_001281271.1.81388 WP_001281271.1.81404 WP_001281271.1.81410 WP_001281271.1.81425 WP_001281271.1.81472 WP_001281271.1.81504 WP_001281271.1.81528 WP_001281271.1.81568 WP_001281271.1.81667 WP_001281271.1.81668 WP_001281271.1.81727 WP_001281271.1.81735 WP_001281271.1.81736 WP_001281271.1.81743 WP_001281271.1.81750 WP_001281271.1.81760 WP_001281271.1.81768 WP_001281271.1.81785 WP_001281271.1.81902 WP_001281271.1.81941 WP_001281271.1.81965 WP_001281271.1.81974 WP_001281271.1.81977 WP_001281271.1.81995 WP_001281271.1.82037 WP_001281271.1.82099 WP_001281271.1.82141 WP_001281271.1.82144 WP_001281271.1.82149 WP_001281271.1.82192 WP_001281271.1.82232 WP_001281271.1.82269 WP_001281271.1.82337 WP_001281271.1.82352 WP_001281271.1.82395 WP_001281271.1.82401 WP_001281271.1.82420 WP_001281271.1.82434 WP_001281271.1.82464 WP_001281271.1.8247 WP_001281271.1.82474 WP_001281271.1.82503 WP_001281271.1.82515 WP_001281271.1.82530 WP_001281271.1.82562 WP_001281271.1.82569 WP_001281271.1.82584 WP_001281271.1.82637 WP_001281271.1.82676 WP_001281271.1.82692 WP_001281271.1.82761 WP_001281271.1.8282 WP_001281271.1.82841 WP_001281271.1.82843 WP_001281271.1.82886 WP_001281271.1.82895 WP_001281271.1.82899 WP_001281271.1.82908 WP_001281271.1.82937 WP_001281271.1.82944 WP_001281271.1.82946 WP_001281271.1.82956 WP_001281271.1.82964 WP_001281271.1.82992 WP_001281271.1.83005 WP_001281271.1.83006 WP_001281271.1.83061 WP_001281271.1.83092 WP_001281271.1.83119 WP_001281271.1.83128 WP_001281271.1.83139 WP_001281271.1.83163 WP_001281271.1.83204 WP_001281271.1.8322 WP_001281271.1.83247 WP_001281271.1.83258 WP_001281271.1.83280 WP_001281271.1.83301 WP_001281271.1.83305 WP_001281271.1.83331 WP_001281271.1.83354 WP_001281271.1.83356 WP_001281271.1.83360 WP_001281271.1.83365 WP_001281271.1.83378 WP_001281271.1.83382 WP_001281271.1.83388 WP_001281271.1.83413 WP_001281271.1.83491 WP_001281271.1.83510 WP_001281271.1.83516 WP_001281271.1.83523 WP_001281271.1.8354 WP_001281271.1.83558 WP_001281271.1.83572 WP_001281271.1.83598 WP_001281271.1.83650 WP_001281271.1.83651 WP_001281271.1.83710 WP_001281271.1.83721 WP_001281271.1.83739 WP_001281271.1.83759 WP_001281271.1.83760 WP_001281271.1.83854 WP_001281271.1.83897 WP_001281271.1.83960 WP_001281271.1.83979 WP_001281271.1.8399 WP_001281271.1.83995 WP_001281271.1.84000 WP_001281271.1.84011 WP_001281271.1.84031 WP_001281271.1.84075 WP_001281271.1.84077 WP_001281271.1.84083 WP_001281271.1.84086 WP_001281271.1.84103 WP_001281271.1.84106 WP_001281271.1.84115 WP_001281271.1.84154 WP_001281271.1.84168 WP_001281271.1.84179 WP_001281271.1.84198 WP_001281271.1.84205 WP_001281271.1.84209 WP_001281271.1.84229 WP_001281271.1.84283 WP_001281271.1.84291 WP_001281271.1.84325 WP_001281271.1.84355 WP_001281271.1.84359 WP_001281271.1.84397 WP_001281271.1.84403 WP_001281271.1.84461 WP_001281271.1.84475 WP_001281271.1.84497 WP_001281271.1.84515 WP_001281271.1.84523 WP_001281271.1.84532 WP_001281271.1.84551 WP_001281271.1.84572 WP_001281271.1.84598 WP_001281271.1.84644 WP_001281271.1.84659 WP_001281271.1.84683 WP_001281271.1.84693 WP_001281271.1.84711 WP_001281271.1.84721 WP_001281271.1.84745 WP_001281271.1.84872 WP_001281271.1.84876 WP_001281271.1.84879 WP_001281271.1.84899 WP_001281271.1.849 WP_001281271.1.8497 WP_001281271.1.850 WP_001281271.1.85014 WP_001281271.1.85031 WP_001281271.1.85040 WP_001281271.1.85079 WP_001281271.1.85120 WP_001281271.1.85126 WP_001281271.1.85134 WP_001281271.1.85147 WP_001281271.1.85178 WP_001281271.1.85180 WP_001281271.1.85190 WP_001281271.1.85192 WP_001281271.1.85217 WP_001281271.1.8526 WP_001281271.1.85271 WP_001281271.1.85301 WP_001281271.1.8537 WP_001281271.1.85408 WP_001281271.1.8545 WP_001281271.1.85456 WP_001281271.1.85481 WP_001281271.1.85483 WP_001281271.1.8552 WP_001281271.1.85568 WP_001281271.1.85615 WP_001281271.1.85617 WP_001281271.1.85654 WP_001281271.1.85663 WP_001281271.1.85675 WP_001281271.1.85742 WP_001281271.1.85759 WP_001281271.1.85780 WP_001281271.1.85784 WP_001281271.1.85797 WP_001281271.1.85855 WP_001281271.1.85864 WP_001281271.1.85886 WP_001281271.1.85900 WP_001281271.1.85904 WP_001281271.1.8591 WP_001281271.1.85943 WP_001281271.1.85976 WP_001281271.1.85982 WP_001281271.1.86007 WP_001281271.1.86017 WP_001281271.1.86043 WP_001281271.1.86092 WP_001281271.1.86120 WP_001281271.1.86126 WP_001281271.1.86138 WP_001281271.1.86157 WP_001281271.1.8616 WP_001281271.1.86173 WP_001281271.1.86224 WP_001281271.1.86259 WP_001281271.1.86284 WP_001281271.1.86310 WP_001281271.1.86335 WP_001281271.1.86347 WP_001281271.1.86356 WP_001281271.1.86380 WP_001281271.1.86389 WP_001281271.1.86450 WP_001281271.1.86453 WP_001281271.1.86466 WP_001281271.1.86469 WP_001281271.1.8647 WP_001281271.1.86514 WP_001281271.1.86580 WP_001281271.1.86588 WP_001281271.1.86601 WP_001281271.1.86610 WP_001281271.1.86634 WP_001281271.1.86656 WP_001281271.1.86658 WP_001281271.1.86661 WP_001281271.1.8671 WP_001281271.1.86735 WP_001281271.1.8678 WP_001281271.1.86807 WP_001281271.1.86810 WP_001281271.1.86859 WP_001281271.1.86860 WP_001281271.1.86895 WP_001281271.1.86906 WP_001281271.1.8691 WP_001281271.1.86921 WP_001281271.1.86982 WP_001281271.1.87051 WP_001281271.1.87095 WP_001281271.1.87143 WP_001281271.1.87148 WP_001281271.1.87187 WP_001281271.1.87219 WP_001281271.1.8722 WP_001281271.1.87265 WP_001281271.1.87282 WP_001281271.1.87283 WP_001281271.1.87323 WP_001281271.1.87346 WP_001281271.1.8736 WP_001281271.1.87370 WP_001281271.1.87376 WP_001281271.1.87493 WP_001281271.1.87500 WP_001281271.1.87552 WP_001281271.1.87583 WP_001281271.1.87626 WP_001281271.1.87651 WP_001281271.1.87687 WP_001281271.1.87695 WP_001281271.1.87712 WP_001281271.1.87779 WP_001281271.1.87813 WP_001281271.1.87875 WP_001281271.1.87899 WP_001281271.1.87905 WP_001281271.1.8792 WP_001281271.1.87945 WP_001281271.1.8800 WP_001281271.1.88014 WP_001281271.1.88019 WP_001281271.1.88073 WP_001281271.1.8809 WP_001281271.1.88092 WP_001281271.1.88165 WP_001281271.1.88174 WP_001281271.1.88214 WP_001281271.1.88222 WP_001281271.1.88244 WP_001281271.1.88264 WP_001281271.1.88275 WP_001281271.1.88291 WP_001281271.1.88293 WP_001281271.1.88303 WP_001281271.1.88356 WP_001281271.1.8837 WP_001281271.1.88393 WP_001281271.1.88423 WP_001281271.1.88474 WP_001281271.1.88483 WP_001281271.1.8849 WP_001281271.1.88508 WP_001281271.1.88609 WP_001281271.1.88624 WP_001281271.1.88651 WP_001281271.1.88675 WP_001281271.1.88683 WP_001281271.1.88698 WP_001281271.1.88731 WP_001281271.1.88762 WP_001281271.1.88776 WP_001281271.1.88792 WP_001281271.1.88817 WP_001281271.1.88845 WP_001281271.1.88854 WP_001281271.1.88902 WP_001281271.1.88942 WP_001281271.1.88957 WP_001281271.1.88966 WP_001281271.1.88967 WP_001281271.1.88968 WP_001281271.1.88970 WP_001281271.1.88980 WP_001281271.1.88981 WP_001281271.1.88995 WP_001281271.1.88998 WP_001281271.1.89008 WP_001281271.1.89054 WP_001281271.1.89114 WP_001281271.1.89116 WP_001281271.1.89119 WP_001281271.1.89120 WP_001281271.1.89177 WP_001281271.1.89188 WP_001281271.1.89215 WP_001281271.1.89291 WP_001281271.1.89304 WP_001281271.1.89355 WP_001281271.1.89362 WP_001281271.1.89408 WP_001281271.1.89452 WP_001281271.1.89462 WP_001281271.1.89512 WP_001281271.1.89527 WP_001281271.1.89570 WP_001281271.1.8958 WP_001281271.1.89580 WP_001281271.1.89604 WP_001281271.1.89606 WP_001281271.1.8961 WP_001281271.1.89622 WP_001281271.1.89632 WP_001281271.1.89657 WP_001281271.1.89680 WP_001281271.1.89746 WP_001281271.1.89765 WP_001281271.1.89789 WP_001281271.1.89815 WP_001281271.1.89817 WP_001281271.1.89832 WP_001281271.1.89870 WP_001281271.1.89902 WP_001281271.1.89940 WP_001281271.1.8996 WP_001281271.1.89965 WP_001281271.1.89975 WP_001281271.1.9003 WP_001281271.1.90033 WP_001281271.1.90084 WP_001281271.1.90108 WP_001281271.1.90211 WP_001281271.1.90220 WP_001281271.1.90252 WP_001281271.1.90293 WP_001281271.1.90311 WP_001281271.1.90348 WP_001281271.1.90363 WP_001281271.1.90417 WP_001281271.1.90421 WP_001281271.1.90440 WP_001281271.1.90453 WP_001281271.1.90458 WP_001281271.1.90472 WP_001281271.1.90521 WP_001281271.1.90522 WP_001281271.1.90557 WP_001281271.1.90563 WP_001281271.1.90620 WP_001281271.1.90625 WP_001281271.1.9064 WP_001281271.1.90641 WP_001281271.1.90686 WP_001281271.1.90701 WP_001281271.1.90748 WP_001281271.1.90759 WP_001281271.1.90859 WP_001281271.1.90866 WP_001281271.1.90878 WP_001281271.1.9089 WP_001281271.1.90959 WP_001281271.1.90983 WP_001281271.1.90984 WP_001281271.1.91003 WP_001281271.1.91023 WP_001281271.1.91042 WP_001281271.1.91049 WP_001281271.1.91056 WP_001281271.1.91107 WP_001281271.1.91156 WP_001281271.1.91179 WP_001281271.1.91215 WP_001281271.1.91278 WP_001281271.1.9131 WP_001281271.1.91312 WP_001281271.1.91331 WP_001281271.1.91334 WP_001281271.1.9137 WP_001281271.1.91372 WP_001281271.1.91381 WP_001281271.1.91424 WP_001281271.1.91459 WP_001281271.1.91470 WP_001281271.1.91473 WP_001281271.1.91493 WP_001281271.1.91505 WP_001281271.1.91524 WP_001281271.1.91528 WP_001281271.1.91564 WP_001281271.1.91579 WP_001281271.1.91580 WP_001281271.1.91621 WP_001281271.1.91625 WP_001281271.1.91628 WP_001281271.1.91655 WP_001281271.1.9166 WP_001281271.1.91702 WP_001281271.1.91724 WP_001281271.1.91732 WP_001281271.1.91736 WP_001281271.1.91742 WP_001281271.1.91772 WP_001281271.1.91776 WP_001281271.1.91788 WP_001281271.1.91795 WP_001281271.1.91806 WP_001281271.1.91864 WP_001281271.1.91880 WP_001281271.1.91898 WP_001281271.1.91903 WP_001281271.1.91904 WP_001281271.1.91914 WP_001281271.1.91984 WP_001281271.1.92013 WP_001281271.1.92039 WP_001281271.1.92044 WP_001281271.1.92047 WP_001281271.1.92060 WP_001281271.1.92068 WP_001281271.1.92082 WP_001281271.1.92093 WP_001281271.1.92099 WP_001281271.1.92108 WP_001281271.1.92129 WP_001281271.1.92149 WP_001281271.1.92165 WP_001281271.1.92171 WP_001281271.1.92183 WP_001281271.1.92208 WP_001281271.1.92213 WP_001281271.1.9222 WP_001281271.1.92268 WP_001281271.1.92270 WP_001281271.1.92299 WP_001281271.1.92310 WP_001281271.1.92318 WP_001281271.1.92375 WP_001281271.1.92394 WP_001281271.1.92399 WP_001281271.1.92408 WP_001281271.1.92411 WP_001281271.1.92439 WP_001281271.1.92443 WP_001281271.1.92452 WP_001281271.1.92482 WP_001281271.1.9253 WP_001281271.1.92531 WP_001281271.1.92557 WP_001281271.1.92562 WP_001281271.1.92575 WP_001281271.1.92628 WP_001281271.1.92646 WP_001281271.1.92659 WP_001281271.1.92671 WP_001281271.1.92729 WP_001281271.1.92738 WP_001281271.1.92758 WP_001281271.1.92806 WP_001281271.1.92827 WP_001281271.1.92832 WP_001281271.1.92842 WP_001281271.1.92843 WP_001281271.1.92875 WP_001281271.1.92879 WP_001281271.1.92890 WP_001281271.1.92893 WP_001281271.1.92895 WP_001281271.1.92926 WP_001281271.1.92936 WP_001281271.1.92939 WP_001281271.1.92975 WP_001281271.1.92988 WP_001281271.1.93059 WP_001281271.1.93086 WP_001281271.1.93136 WP_001281271.1.93155 WP_001281271.1.93213 WP_001281271.1.93215 WP_001281271.1.93275 WP_001281271.1.93322 WP_001281271.1.93339 WP_001281271.1.93350 WP_001281271.1.93365 WP_001281271.1.93376 WP_001281271.1.93524 WP_001281271.1.93543 WP_001281271.1.93577 WP_001281271.1.93596 WP_001281271.1.93650 WP_001281271.1.93662 WP_001281271.1.93671 WP_001281271.1.93691 WP_001281271.1.937 WP_001281271.1.93741 WP_001281271.1.9380 WP_001281271.1.93803 WP_001281271.1.93804 WP_001281271.1.93809 WP_001281271.1.93937 WP_001281271.1.93956 WP_001281271.1.93994 WP_001281271.1.94039 WP_001281271.1.94064 WP_001281271.1.94132 WP_001281271.1.94162 WP_001281271.1.94167 WP_001281271.1.94168 WP_001281271.1.94198 WP_001281271.1.9432 WP_001281271.1.94352 WP_001281271.1.94354 WP_001281271.1.94379 WP_001281271.1.94380 WP_001281271.1.9440 WP_001281271.1.94458 WP_001281271.1.94473 WP_001281271.1.94557 WP_001281271.1.94562 WP_001281271.1.94584 WP_001281271.1.94588 WP_001281271.1.94598 WP_001281271.1.94649 WP_001281271.1.94655 WP_001281271.1.94674 WP_001281271.1.94717 WP_001281271.1.94722 WP_001281271.1.94796 WP_001281271.1.94798 WP_001281271.1.9481 WP_001281271.1.94817 WP_001281271.1.94835 WP_001281271.1.94849 WP_001281271.1.94862 WP_001281271.1.94947 WP_001281271.1.94959 WP_001281271.1.94967 WP_001281271.1.94971 WP_001281271.1.94982 WP_001281271.1.94986 WP_001281271.1.94987 WP_001281271.1.9503 WP_001281271.1.95051 WP_001281271.1.95085 WP_001281271.1.95121 WP_001281271.1.95133 WP_001281271.1.95136 WP_001281271.1.95152 WP_001281271.1.9516 WP_001281271.1.95171 WP_001281271.1.95235 WP_001281271.1.95248 WP_001281271.1.95249 WP_001281271.1.9527 WP_001281271.1.95277 WP_001281271.1.95282 WP_001281271.1.95289 WP_001281271.1.9530 WP_001281271.1.95320 WP_001281271.1.95388 WP_001281271.1.95404 WP_001281271.1.95434 WP_001281271.1.95456 WP_001281271.1.95465 WP_001281271.1.95546 WP_001281271.1.95607 WP_001281271.1.95623 WP_001281271.1.95630 WP_001281271.1.95641 WP_001281271.1.95656 WP_001281271.1.95670 WP_001281271.1.95691 WP_001281271.1.95701 WP_001281271.1.95703 WP_001281271.1.95729 WP_001281271.1.95757 WP_001281271.1.95803 WP_001281271.1.95826 WP_001281271.1.9586 WP_001281271.1.95866 WP_001281271.1.95901 WP_001281271.1.95911 WP_001281271.1.95939 WP_001281271.1.95940 WP_001281271.1.96004 WP_001281271.1.96042 WP_001281271.1.96045 WP_001281271.1.96107 WP_001281271.1.96139 WP_001281271.1.96141 WP_001281271.1.96162 WP_001281271.1.96172 WP_001281271.1.96190 WP_001281271.1.96203 WP_001281271.1.96206 WP_001281271.1.9624 WP_001281271.1.96317 WP_001281271.1.96335 WP_001281271.1.96340 WP_001281271.1.96348 WP_001281271.1.96380 WP_001281271.1.96429 WP_001281271.1.9644 WP_001281271.1.96469 WP_001281271.1.96497 WP_001281271.1.96500 WP_001281271.1.96521 WP_001281271.1.96533 WP_001281271.1.96537 WP_001281271.1.96555 WP_001281271.1.96563 WP_001281271.1.96590 WP_001281271.1.96642 WP_001281271.1.96721 WP_001281271.1.96731 WP_001281271.1.96732 WP_001281271.1.96735 WP_001281271.1.9674 WP_001281271.1.96758 WP_001281271.1.96761 WP_001281271.1.96771 WP_001281271.1.96798 WP_001281271.1.96810 WP_001281271.1.9686 WP_001281271.1.96876 WP_001281271.1.96890 WP_001281271.1.96917 WP_001281271.1.96993 WP_001281271.1.97005 WP_001281271.1.97015 WP_001281271.1.97043 WP_001281271.1.97047 WP_001281271.1.97089 WP_001281271.1.97103 WP_001281271.1.97109 WP_001281271.1.97143 WP_001281271.1.97145 WP_001281271.1.97185 WP_001281271.1.97190 WP_001281271.1.97260 WP_001281271.1.97297 WP_001281271.1.97318 WP_001281271.1.97322 WP_001281271.1.97328 WP_001281271.1.97337 WP_001281271.1.97368 WP_001281271.1.97386 WP_001281271.1.97413 WP_001281271.1.97477 WP_001281271.1.97480 WP_001281271.1.97487 WP_001281271.1.97496 WP_001281271.1.97534 WP_001281271.1.97594 WP_001281271.1.97597 WP_001281271.1.97613 WP_001281271.1.97620 WP_001281271.1.97626 WP_001281271.1.97631 WP_001281271.1.97656 WP_001281271.1.97691 WP_001281271.1.97704 WP_001281271.1.97725 WP_001281271.1.97726 WP_001281271.1.97727 WP_001281271.1.97732 WP_001281271.1.97736 WP_001281271.1.9774 WP_001281271.1.97772 WP_001281271.1.97800 WP_001281271.1.97846 WP_001281271.1.97873 WP_001281271.1.97907 WP_001281271.1.97981 WP_001281271.1.97983 WP_001281271.1.9799 WP_001281271.1.98019 WP_001281271.1.98022 WP_001281271.1.98107 WP_001281271.1.9811 WP_001281271.1.98110 WP_001281271.1.98119 WP_001281271.1.98124 WP_001281271.1.98146 WP_001281271.1.98170 WP_001281271.1.98201 WP_001281271.1.98219 WP_001281271.1.98236 WP_001281271.1.98250 WP_001281271.1.9826 WP_001281271.1.98314 WP_001281271.1.98403 WP_001281271.1.9841 WP_001281271.1.98438 WP_001281271.1.98440 WP_001281271.1.98472 WP_001281271.1.98483 WP_001281271.1.98495 WP_001281271.1.98513 WP_001281271.1.98531 WP_001281271.1.98551 WP_001281271.1.98570 WP_001281271.1.98577 WP_001281271.1.98608 WP_001281271.1.98627 WP_001281271.1.9863 WP_001281271.1.98634 WP_001281271.1.98676 WP_001281271.1.98677 WP_001281271.1.98726 WP_001281271.1.98760 WP_001281271.1.98763 WP_001281271.1.9887 WP_001281271.1.98899 WP_001281271.1.98931 WP_001281271.1.98947 WP_001281271.1.9898 WP_001281271.1.9899 WP_001281271.1.99040 WP_001281271.1.99057 WP_001281271.1.99071 WP_001281271.1.99072 WP_001281271.1.99073 WP_001281271.1.99083 WP_001281271.1.99097 WP_001281271.1.99098 WP_001281271.1.99107 WP_001281271.1.99184 WP_001281271.1.9919 WP_001281271.1.99197 WP_001281271.1.99215 WP_001281271.1.99267 WP_001281271.1.99276 WP_001281271.1.99278 WP_001281271.1.99339 WP_001281271.1.99370 WP_001281271.1.99456 WP_001281271.1.99490 WP_001281271.1.99493 WP_001281271.1.99531 WP_001281271.1.9954 WP_001281271.1.99561 WP_001281271.1.99626 WP_001281271.1.99637 WP_001281271.1.99646 WP_001281271.1.99657 WP_001281271.1.99660 WP_001281271.1.99712 WP_001281271.1.99725 WP_001281271.1.99783 WP_001281271.1.99889 WP_001281271.1.99924 WP_001281271.1.99958 WP_001281271.1.99961 gi|383496973|ref|YP_005397662.1| gi|378445701|ref|YP_005233333.1| gi|378700182|ref|YP_005182139.1| gi|197248208|ref|YP_002147228.1| gi|378954378|ref|YP_005211865.1| gi|379701503|ref|YP_005243231.1| gi|549479916|ref|YP_008614042.1| gi|378989658|ref|YP_005252822.1| gi|525818161|ref|YP_008248179.1| 272994.SPAB_00716 295319.SPA0592 423368.SNSL254_A2457 454166.SeAg_B2408 454169.SeHA_C2512 476213.SPC_1440 550537.SEN2254 554290.SSPA0557 99287.STM2272 gi|525858275|ref|YP_008261549.1| gi|56412831|ref|YP_149906.1| gi|537435947|ref|YP_008480324.1| gi|549724928|ref|YP_008645118.1| gi|16765599|ref|NP_461214.1| gi|525829686|ref|YP_008252837.1| gi|563653731|ref|YP_008861806.1| gi|194450393|ref|YP_002046326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]