SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451020|ref|YP_005238379.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451020|ref|YP_005238379.1|
Domain Number 1 Region: 8-451
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.35e-95
Family Acetyl-CoA synthetase-like 0.0000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451020|ref|YP_005238379.1|
Sequence length 455
Comment O-succinylbenzoic acid--CoA ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTFTDWPWRHWRQVRSQAPALRLNDEVLSWRALCERIDVLAGGFAAQGVREGDGVLLRAG
NQPRTLLAWLALMQCGARVLPVNPQLPQTLLEALVPKLTLRFALTLEGENAFSGLTALQI
QKSTAAYAVAWQPQRLVSMTLTSGSTGLPKAAVHTCQAHLASAQGVLSLMPFGPQDDWLL
SLPLFHVSGQGIMWRWLFAGARMTVRDKQPLEQMLAGCTHASLVPTQLWRLLANRAAVTL
KAVLLGGAVIPVELTDQASKQGIRCWCGYGLTEFASTVCAKEADGSDDVGAPLPGREIRI
VDNEVWLRAASMAEGYWRDGKLIPLVNDEGWFATRDRGELNHGRLTIAGRLDNLFFSGGE
GIQPEEVERVINAHPLVQQAFVVPVEDKEFGHRPVAVVEYASQAGDVNLAEWVRDKLARF
QQPVRWLTMPSELKNGGIKISRRALQQWVCENCKN
Download sequence
Identical sequences A0A0D6FBP3 A0A0F6B442 A0A0F7J8I0 A0A0H3NNW2 A0A0U1IGP4 A0A0W4Z9B0 A0A249UWG9 A0A2D3AE68 A0A2G1PEN5 A0A2H9YGK5 E8XEE7 P37418
gi|16765632|ref|NP_461247.1| 99287.STM2305 gi|550901741|ref|YP_008670833.1| gi|378989691|ref|YP_005252855.1| gi|378984867|ref|YP_005248022.1| gi|383497006|ref|YP_005397695.1| gi|378445734|ref|YP_005233366.1| gi|378451020|ref|YP_005238379.1| ABAM02000001|CDS_2872162-2870795 ABAO01000015|CDS_89238-87871 AE006468|CDS_2413040-2411673 CP001363|CDS_2464593-2463226 FN424405|CDS_2436706-2435339 gi|525837597|ref|YP_008254444.1| gi|482904119|ref|YP_007902679.1| NP_461247.1.58477 WP_000144677.1.100010 WP_000144677.1.100234 WP_000144677.1.100258 WP_000144677.1.100376 WP_000144677.1.100424 WP_000144677.1.100436 WP_000144677.1.100484 WP_000144677.1.100488 WP_000144677.1.100597 WP_000144677.1.10076 WP_000144677.1.100781 WP_000144677.1.100793 WP_000144677.1.100869 WP_000144677.1.100871 WP_000144677.1.100882 WP_000144677.1.101007 WP_000144677.1.101020 WP_000144677.1.101074 WP_000144677.1.101078 WP_000144677.1.101180 WP_000144677.1.101259 WP_000144677.1.101284 WP_000144677.1.101291 WP_000144677.1.101320 WP_000144677.1.101353 WP_000144677.1.101386 WP_000144677.1.101404 WP_000144677.1.101420 WP_000144677.1.101589 WP_000144677.1.101707 WP_000144677.1.101734 WP_000144677.1.101878 WP_000144677.1.101953 WP_000144677.1.10220 WP_000144677.1.10266 WP_000144677.1.10439 WP_000144677.1.10678 WP_000144677.1.10753 WP_000144677.1.10992 WP_000144677.1.11000 WP_000144677.1.11024 WP_000144677.1.11031 WP_000144677.1.11098 WP_000144677.1.11168 WP_000144677.1.11190 WP_000144677.1.11295 WP_000144677.1.11455 WP_000144677.1.11458 WP_000144677.1.11518 WP_000144677.1.11532 WP_000144677.1.11543 WP_000144677.1.11763 WP_000144677.1.11772 WP_000144677.1.11897 WP_000144677.1.12025 WP_000144677.1.12114 WP_000144677.1.12351 WP_000144677.1.12370 WP_000144677.1.12546 WP_000144677.1.1264 WP_000144677.1.12728 WP_000144677.1.12879 WP_000144677.1.12936 WP_000144677.1.12995 WP_000144677.1.13027 WP_000144677.1.13106 WP_000144677.1.13130 WP_000144677.1.13334 WP_000144677.1.13414 WP_000144677.1.13488 WP_000144677.1.13509 WP_000144677.1.13669 WP_000144677.1.13741 WP_000144677.1.13908 WP_000144677.1.13932 WP_000144677.1.13968 WP_000144677.1.14001 WP_000144677.1.14041 WP_000144677.1.14151 WP_000144677.1.14239 WP_000144677.1.14320 WP_000144677.1.14379 WP_000144677.1.14406 WP_000144677.1.14410 WP_000144677.1.14466 WP_000144677.1.14524 WP_000144677.1.14554 WP_000144677.1.14725 WP_000144677.1.14852 WP_000144677.1.1489 WP_000144677.1.14932 WP_000144677.1.15055 WP_000144677.1.15124 WP_000144677.1.15223 WP_000144677.1.15226 WP_000144677.1.15316 WP_000144677.1.15369 WP_000144677.1.15508 WP_000144677.1.15784 WP_000144677.1.15830 WP_000144677.1.16062 WP_000144677.1.16103 WP_000144677.1.16226 WP_000144677.1.16233 WP_000144677.1.16284 WP_000144677.1.1635 WP_000144677.1.16468 WP_000144677.1.16614 WP_000144677.1.16650 WP_000144677.1.16686 WP_000144677.1.16691 WP_000144677.1.167 WP_000144677.1.16732 WP_000144677.1.16735 WP_000144677.1.16786 WP_000144677.1.1689 WP_000144677.1.16896 WP_000144677.1.16965 WP_000144677.1.1700 WP_000144677.1.17307 WP_000144677.1.174 WP_000144677.1.17480 WP_000144677.1.17546 WP_000144677.1.17702 WP_000144677.1.17705 WP_000144677.1.17747 WP_000144677.1.17755 WP_000144677.1.18019 WP_000144677.1.18111 WP_000144677.1.18163 WP_000144677.1.18265 WP_000144677.1.18267 WP_000144677.1.18282 WP_000144677.1.18468 WP_000144677.1.18607 WP_000144677.1.18705 WP_000144677.1.18715 WP_000144677.1.18776 WP_000144677.1.18881 WP_000144677.1.18940 WP_000144677.1.19053 WP_000144677.1.19320 WP_000144677.1.19458 WP_000144677.1.19460 WP_000144677.1.19461 WP_000144677.1.19614 WP_000144677.1.19642 WP_000144677.1.19702 WP_000144677.1.19706 WP_000144677.1.19724 WP_000144677.1.19749 WP_000144677.1.19784 WP_000144677.1.19802 WP_000144677.1.19809 WP_000144677.1.19867 WP_000144677.1.1998 WP_000144677.1.20 WP_000144677.1.2010 WP_000144677.1.20212 WP_000144677.1.20266 WP_000144677.1.20271 WP_000144677.1.20330 WP_000144677.1.20362 WP_000144677.1.20418 WP_000144677.1.20443 WP_000144677.1.20525 WP_000144677.1.2054 WP_000144677.1.20553 WP_000144677.1.20626 WP_000144677.1.20646 WP_000144677.1.20886 WP_000144677.1.20908 WP_000144677.1.21049 WP_000144677.1.21146 WP_000144677.1.21245 WP_000144677.1.21246 WP_000144677.1.21269 WP_000144677.1.21400 WP_000144677.1.21497 WP_000144677.1.21499 WP_000144677.1.21548 WP_000144677.1.21603 WP_000144677.1.21751 WP_000144677.1.21757 WP_000144677.1.22024 WP_000144677.1.2205 WP_000144677.1.22062 WP_000144677.1.22067 WP_000144677.1.2221 WP_000144677.1.2235 WP_000144677.1.22379 WP_000144677.1.22427 WP_000144677.1.22485 WP_000144677.1.22537 WP_000144677.1.22620 WP_000144677.1.22870 WP_000144677.1.22979 WP_000144677.1.23102 WP_000144677.1.23114 WP_000144677.1.2314 WP_000144677.1.23192 WP_000144677.1.23259 WP_000144677.1.23460 WP_000144677.1.23472 WP_000144677.1.23482 WP_000144677.1.23634 WP_000144677.1.2364 WP_000144677.1.23932 WP_000144677.1.24017 WP_000144677.1.24206 WP_000144677.1.24308 WP_000144677.1.24578 WP_000144677.1.24779 WP_000144677.1.25008 WP_000144677.1.25015 WP_000144677.1.25206 WP_000144677.1.25405 WP_000144677.1.25454 WP_000144677.1.25493 WP_000144677.1.25668 WP_000144677.1.25690 WP_000144677.1.2570 WP_000144677.1.25740 WP_000144677.1.25814 WP_000144677.1.25988 WP_000144677.1.26311 WP_000144677.1.26319 WP_000144677.1.26429 WP_000144677.1.26440 WP_000144677.1.26493 WP_000144677.1.26551 WP_000144677.1.26567 WP_000144677.1.27010 WP_000144677.1.27173 WP_000144677.1.27206 WP_000144677.1.27423 WP_000144677.1.2763 WP_000144677.1.27665 WP_000144677.1.27707 WP_000144677.1.27755 WP_000144677.1.27761 WP_000144677.1.2777 WP_000144677.1.27857 WP_000144677.1.27977 WP_000144677.1.28094 WP_000144677.1.28126 WP_000144677.1.28170 WP_000144677.1.28302 WP_000144677.1.2835 WP_000144677.1.28370 WP_000144677.1.28538 WP_000144677.1.28575 WP_000144677.1.28625 WP_000144677.1.28655 WP_000144677.1.28694 WP_000144677.1.2879 WP_000144677.1.2890 WP_000144677.1.28938 WP_000144677.1.28946 WP_000144677.1.29006 WP_000144677.1.29010 WP_000144677.1.2910 WP_000144677.1.29588 WP_000144677.1.29601 WP_000144677.1.29606 WP_000144677.1.29615 WP_000144677.1.29619 WP_000144677.1.29704 WP_000144677.1.29969 WP_000144677.1.30006 WP_000144677.1.30027 WP_000144677.1.30469 WP_000144677.1.30505 WP_000144677.1.30507 WP_000144677.1.30535 WP_000144677.1.30547 WP_000144677.1.30794 WP_000144677.1.30833 WP_000144677.1.30835 WP_000144677.1.30972 WP_000144677.1.31 WP_000144677.1.3113 WP_000144677.1.31171 WP_000144677.1.31185 WP_000144677.1.3119 WP_000144677.1.31190 WP_000144677.1.31195 WP_000144677.1.31196 WP_000144677.1.31219 WP_000144677.1.31281 WP_000144677.1.31504 WP_000144677.1.31515 WP_000144677.1.31578 WP_000144677.1.31658 WP_000144677.1.31940 WP_000144677.1.31967 WP_000144677.1.31972 WP_000144677.1.32192 WP_000144677.1.32206 WP_000144677.1.32438 WP_000144677.1.32515 WP_000144677.1.32527 WP_000144677.1.32660 WP_000144677.1.32702 WP_000144677.1.32714 WP_000144677.1.32786 WP_000144677.1.32804 WP_000144677.1.32860 WP_000144677.1.32907 WP_000144677.1.33030 WP_000144677.1.33127 WP_000144677.1.33143 WP_000144677.1.33248 WP_000144677.1.33261 WP_000144677.1.333 WP_000144677.1.33492 WP_000144677.1.33553 WP_000144677.1.33592 WP_000144677.1.33825 WP_000144677.1.33894 WP_000144677.1.34043 WP_000144677.1.34075 WP_000144677.1.34257 WP_000144677.1.34279 WP_000144677.1.34319 WP_000144677.1.34453 WP_000144677.1.34610 WP_000144677.1.34856 WP_000144677.1.34975 WP_000144677.1.34977 WP_000144677.1.35045 WP_000144677.1.35129 WP_000144677.1.35184 WP_000144677.1.35404 WP_000144677.1.35408 WP_000144677.1.35425 WP_000144677.1.35429 WP_000144677.1.35446 WP_000144677.1.35463 WP_000144677.1.35503 WP_000144677.1.35509 WP_000144677.1.35590 WP_000144677.1.35940 WP_000144677.1.36003 WP_000144677.1.3601 WP_000144677.1.36609 WP_000144677.1.36690 WP_000144677.1.3670 WP_000144677.1.36705 WP_000144677.1.36918 WP_000144677.1.36931 WP_000144677.1.37063 WP_000144677.1.37073 WP_000144677.1.37111 WP_000144677.1.37112 WP_000144677.1.37256 WP_000144677.1.37293 WP_000144677.1.37370 WP_000144677.1.37376 WP_000144677.1.3744 WP_000144677.1.37498 WP_000144677.1.37504 WP_000144677.1.37618 WP_000144677.1.37687 WP_000144677.1.37968 WP_000144677.1.37978 WP_000144677.1.38026 WP_000144677.1.38125 WP_000144677.1.38145 WP_000144677.1.383 WP_000144677.1.3848 WP_000144677.1.38613 WP_000144677.1.38673 WP_000144677.1.3869 WP_000144677.1.38693 WP_000144677.1.38773 WP_000144677.1.38882 WP_000144677.1.38913 WP_000144677.1.39003 WP_000144677.1.39136 WP_000144677.1.39197 WP_000144677.1.39229 WP_000144677.1.39405 WP_000144677.1.39420 WP_000144677.1.39449 WP_000144677.1.39512 WP_000144677.1.39556 WP_000144677.1.39629 WP_000144677.1.39763 WP_000144677.1.39862 WP_000144677.1.39921 WP_000144677.1.39923 WP_000144677.1.40017 WP_000144677.1.40072 WP_000144677.1.40073 WP_000144677.1.4011 WP_000144677.1.40208 WP_000144677.1.40224 WP_000144677.1.40240 WP_000144677.1.40257 WP_000144677.1.40292 WP_000144677.1.40380 WP_000144677.1.40395 WP_000144677.1.40465 WP_000144677.1.40508 WP_000144677.1.40710 WP_000144677.1.4075 WP_000144677.1.4087 WP_000144677.1.40877 WP_000144677.1.41017 WP_000144677.1.41091 WP_000144677.1.41226 WP_000144677.1.41279 WP_000144677.1.41516 WP_000144677.1.41554 WP_000144677.1.41572 WP_000144677.1.41591 WP_000144677.1.41662 WP_000144677.1.41708 WP_000144677.1.41761 WP_000144677.1.41859 WP_000144677.1.41882 WP_000144677.1.41985 WP_000144677.1.42104 WP_000144677.1.42320 WP_000144677.1.42342 WP_000144677.1.42422 WP_000144677.1.4276 WP_000144677.1.42864 WP_000144677.1.4288 WP_000144677.1.43018 WP_000144677.1.43041 WP_000144677.1.43244 WP_000144677.1.43312 WP_000144677.1.43334 WP_000144677.1.43351 WP_000144677.1.43437 WP_000144677.1.43522 WP_000144677.1.43613 WP_000144677.1.43668 WP_000144677.1.43886 WP_000144677.1.44005 WP_000144677.1.44043 WP_000144677.1.44099 WP_000144677.1.44121 WP_000144677.1.44291 WP_000144677.1.44310 WP_000144677.1.44479 WP_000144677.1.44578 WP_000144677.1.44640 WP_000144677.1.4467 WP_000144677.1.44747 WP_000144677.1.4485 WP_000144677.1.44877 WP_000144677.1.44927 WP_000144677.1.44971 WP_000144677.1.45067 WP_000144677.1.45074 WP_000144677.1.45079 WP_000144677.1.45098 WP_000144677.1.45177 WP_000144677.1.45184 WP_000144677.1.45259 WP_000144677.1.45344 WP_000144677.1.45349 WP_000144677.1.45365 WP_000144677.1.45550 WP_000144677.1.45585 WP_000144677.1.45660 WP_000144677.1.45690 WP_000144677.1.45797 WP_000144677.1.458 WP_000144677.1.46011 WP_000144677.1.46069 WP_000144677.1.46112 WP_000144677.1.46173 WP_000144677.1.46174 WP_000144677.1.46187 WP_000144677.1.46303 WP_000144677.1.46595 WP_000144677.1.46675 WP_000144677.1.46930 WP_000144677.1.47057 WP_000144677.1.47214 WP_000144677.1.47429 WP_000144677.1.47448 WP_000144677.1.4747 WP_000144677.1.47472 WP_000144677.1.47478 WP_000144677.1.47621 WP_000144677.1.47799 WP_000144677.1.48242 WP_000144677.1.48253 WP_000144677.1.483 WP_000144677.1.48367 WP_000144677.1.48377 WP_000144677.1.4853 WP_000144677.1.48788 WP_000144677.1.4885 WP_000144677.1.48894 WP_000144677.1.48919 WP_000144677.1.49084 WP_000144677.1.49155 WP_000144677.1.49175 WP_000144677.1.49204 WP_000144677.1.49239 WP_000144677.1.49256 WP_000144677.1.49290 WP_000144677.1.49309 WP_000144677.1.49340 WP_000144677.1.49366 WP_000144677.1.49490 WP_000144677.1.49515 WP_000144677.1.49572 WP_000144677.1.4979 WP_000144677.1.49803 WP_000144677.1.49805 WP_000144677.1.49929 WP_000144677.1.50080 WP_000144677.1.50161 WP_000144677.1.50211 WP_000144677.1.50376 WP_000144677.1.50389 WP_000144677.1.50676 WP_000144677.1.50774 WP_000144677.1.50804 WP_000144677.1.50808 WP_000144677.1.5088 WP_000144677.1.50908 WP_000144677.1.50941 WP_000144677.1.51014 WP_000144677.1.51022 WP_000144677.1.51179 WP_000144677.1.51182 WP_000144677.1.51186 WP_000144677.1.51487 WP_000144677.1.51488 WP_000144677.1.51634 WP_000144677.1.51649 WP_000144677.1.51686 WP_000144677.1.51756 WP_000144677.1.51911 WP_000144677.1.51932 WP_000144677.1.51989 WP_000144677.1.52121 WP_000144677.1.52148 WP_000144677.1.52346 WP_000144677.1.52353 WP_000144677.1.52361 WP_000144677.1.52653 WP_000144677.1.52656 WP_000144677.1.52743 WP_000144677.1.52857 WP_000144677.1.52898 WP_000144677.1.52915 WP_000144677.1.53190 WP_000144677.1.53406 WP_000144677.1.53436 WP_000144677.1.53529 WP_000144677.1.53543 WP_000144677.1.53757 WP_000144677.1.53812 WP_000144677.1.54033 WP_000144677.1.54075 WP_000144677.1.54196 WP_000144677.1.542 WP_000144677.1.54209 WP_000144677.1.54271 WP_000144677.1.54273 WP_000144677.1.54274 WP_000144677.1.54319 WP_000144677.1.54364 WP_000144677.1.54400 WP_000144677.1.54644 WP_000144677.1.54662 WP_000144677.1.54722 WP_000144677.1.54749 WP_000144677.1.54764 WP_000144677.1.55008 WP_000144677.1.55152 WP_000144677.1.55156 WP_000144677.1.55285 WP_000144677.1.55475 WP_000144677.1.55647 WP_000144677.1.55706 WP_000144677.1.55743 WP_000144677.1.55768 WP_000144677.1.55782 WP_000144677.1.55796 WP_000144677.1.55993 WP_000144677.1.56002 WP_000144677.1.56012 WP_000144677.1.56105 WP_000144677.1.56238 WP_000144677.1.56286 WP_000144677.1.56304 WP_000144677.1.56414 WP_000144677.1.56438 WP_000144677.1.56560 WP_000144677.1.56597 WP_000144677.1.56601 WP_000144677.1.56614 WP_000144677.1.56671 WP_000144677.1.56682 WP_000144677.1.56875 WP_000144677.1.56877 WP_000144677.1.57125 WP_000144677.1.57168 WP_000144677.1.57187 WP_000144677.1.57232 WP_000144677.1.57377 WP_000144677.1.57418 WP_000144677.1.57433 WP_000144677.1.57515 WP_000144677.1.57529 WP_000144677.1.57576 WP_000144677.1.57601 WP_000144677.1.57607 WP_000144677.1.57763 WP_000144677.1.57862 WP_000144677.1.57890 WP_000144677.1.57891 WP_000144677.1.57978 WP_000144677.1.5801 WP_000144677.1.58041 WP_000144677.1.58418 WP_000144677.1.5854 WP_000144677.1.58548 WP_000144677.1.5858 WP_000144677.1.58662 WP_000144677.1.58669 WP_000144677.1.58745 WP_000144677.1.58803 WP_000144677.1.5886 WP_000144677.1.59094 WP_000144677.1.59224 WP_000144677.1.59375 WP_000144677.1.59458 WP_000144677.1.59490 WP_000144677.1.59508 WP_000144677.1.5953 WP_000144677.1.59684 WP_000144677.1.59694 WP_000144677.1.59771 WP_000144677.1.5979 WP_000144677.1.59953 WP_000144677.1.60008 WP_000144677.1.60021 WP_000144677.1.60069 WP_000144677.1.60140 WP_000144677.1.60155 WP_000144677.1.60285 WP_000144677.1.60379 WP_000144677.1.60464 WP_000144677.1.60874 WP_000144677.1.60941 WP_000144677.1.61078 WP_000144677.1.6114 WP_000144677.1.61232 WP_000144677.1.6129 WP_000144677.1.61296 WP_000144677.1.61345 WP_000144677.1.61417 WP_000144677.1.61574 WP_000144677.1.61609 WP_000144677.1.61712 WP_000144677.1.61714 WP_000144677.1.61730 WP_000144677.1.61857 WP_000144677.1.61918 WP_000144677.1.61952 WP_000144677.1.62007 WP_000144677.1.62025 WP_000144677.1.62204 WP_000144677.1.62304 WP_000144677.1.62364 WP_000144677.1.62374 WP_000144677.1.62403 WP_000144677.1.6253 WP_000144677.1.62570 WP_000144677.1.62853 WP_000144677.1.62903 WP_000144677.1.62910 WP_000144677.1.62955 WP_000144677.1.63063 WP_000144677.1.63181 WP_000144677.1.63203 WP_000144677.1.63256 WP_000144677.1.63290 WP_000144677.1.63382 WP_000144677.1.63461 WP_000144677.1.63479 WP_000144677.1.63577 WP_000144677.1.63664 WP_000144677.1.63718 WP_000144677.1.6375 WP_000144677.1.63757 WP_000144677.1.63834 WP_000144677.1.64046 WP_000144677.1.6423 WP_000144677.1.64244 WP_000144677.1.64403 WP_000144677.1.64649 WP_000144677.1.64702 WP_000144677.1.64757 WP_000144677.1.64781 WP_000144677.1.64831 WP_000144677.1.6489 WP_000144677.1.65028 WP_000144677.1.65171 WP_000144677.1.65248 WP_000144677.1.6535 WP_000144677.1.65474 WP_000144677.1.65572 WP_000144677.1.65633 WP_000144677.1.6565 WP_000144677.1.65696 WP_000144677.1.6575 WP_000144677.1.65782 WP_000144677.1.6630 WP_000144677.1.66314 WP_000144677.1.66358 WP_000144677.1.66362 WP_000144677.1.6638 WP_000144677.1.66600 WP_000144677.1.6680 WP_000144677.1.66820 WP_000144677.1.66834 WP_000144677.1.66901 WP_000144677.1.66962 WP_000144677.1.67037 WP_000144677.1.67268 WP_000144677.1.67347 WP_000144677.1.67552 WP_000144677.1.67682 WP_000144677.1.67829 WP_000144677.1.67887 WP_000144677.1.68073 WP_000144677.1.68201 WP_000144677.1.68206 WP_000144677.1.6827 WP_000144677.1.68275 WP_000144677.1.6849 WP_000144677.1.68547 WP_000144677.1.68589 WP_000144677.1.68655 WP_000144677.1.68656 WP_000144677.1.68787 WP_000144677.1.68894 WP_000144677.1.68928 WP_000144677.1.68975 WP_000144677.1.69006 WP_000144677.1.6913 WP_000144677.1.69146 WP_000144677.1.69255 WP_000144677.1.69397 WP_000144677.1.69644 WP_000144677.1.69704 WP_000144677.1.7016 WP_000144677.1.7021 WP_000144677.1.70241 WP_000144677.1.70269 WP_000144677.1.70289 WP_000144677.1.70447 WP_000144677.1.70485 WP_000144677.1.70643 WP_000144677.1.70683 WP_000144677.1.70883 WP_000144677.1.70922 WP_000144677.1.70948 WP_000144677.1.71116 WP_000144677.1.71146 WP_000144677.1.71165 WP_000144677.1.71188 WP_000144677.1.71202 WP_000144677.1.71243 WP_000144677.1.71306 WP_000144677.1.71337 WP_000144677.1.71378 WP_000144677.1.71401 WP_000144677.1.71481 WP_000144677.1.71691 WP_000144677.1.71702 WP_000144677.1.71750 WP_000144677.1.71845 WP_000144677.1.71881 WP_000144677.1.71908 WP_000144677.1.71952 WP_000144677.1.71973 WP_000144677.1.72105 WP_000144677.1.72203 WP_000144677.1.72372 WP_000144677.1.72376 WP_000144677.1.72594 WP_000144677.1.72871 WP_000144677.1.72975 WP_000144677.1.73062 WP_000144677.1.7315 WP_000144677.1.73200 WP_000144677.1.7334 WP_000144677.1.73377 WP_000144677.1.73481 WP_000144677.1.7356 WP_000144677.1.73561 WP_000144677.1.73581 WP_000144677.1.73617 WP_000144677.1.73667 WP_000144677.1.73753 WP_000144677.1.73758 WP_000144677.1.73794 WP_000144677.1.7387 WP_000144677.1.73924 WP_000144677.1.73926 WP_000144677.1.73945 WP_000144677.1.74029 WP_000144677.1.74181 WP_000144677.1.74191 WP_000144677.1.7433 WP_000144677.1.74410 WP_000144677.1.74466 WP_000144677.1.74529 WP_000144677.1.74545 WP_000144677.1.74745 WP_000144677.1.75129 WP_000144677.1.75187 WP_000144677.1.75288 WP_000144677.1.75334 WP_000144677.1.75362 WP_000144677.1.75385 WP_000144677.1.75392 WP_000144677.1.75760 WP_000144677.1.75764 WP_000144677.1.75828 WP_000144677.1.75837 WP_000144677.1.75874 WP_000144677.1.75945 WP_000144677.1.76020 WP_000144677.1.76252 WP_000144677.1.76445 WP_000144677.1.7660 WP_000144677.1.76673 WP_000144677.1.76706 WP_000144677.1.76721 WP_000144677.1.76756 WP_000144677.1.76760 WP_000144677.1.76875 WP_000144677.1.76899 WP_000144677.1.77038 WP_000144677.1.77047 WP_000144677.1.77080 WP_000144677.1.7712 WP_000144677.1.77180 WP_000144677.1.77244 WP_000144677.1.77349 WP_000144677.1.77514 WP_000144677.1.77529 WP_000144677.1.77549 WP_000144677.1.7782 WP_000144677.1.77851 WP_000144677.1.77898 WP_000144677.1.77918 WP_000144677.1.77960 WP_000144677.1.78076 WP_000144677.1.78096 WP_000144677.1.78100 WP_000144677.1.78110 WP_000144677.1.78120 WP_000144677.1.78383 WP_000144677.1.78407 WP_000144677.1.7861 WP_000144677.1.78673 WP_000144677.1.78735 WP_000144677.1.78802 WP_000144677.1.78830 WP_000144677.1.78835 WP_000144677.1.78871 WP_000144677.1.78874 WP_000144677.1.78930 WP_000144677.1.79151 WP_000144677.1.79167 WP_000144677.1.79335 WP_000144677.1.79462 WP_000144677.1.79472 WP_000144677.1.79490 WP_000144677.1.79495 WP_000144677.1.79529 WP_000144677.1.79570 WP_000144677.1.7964 WP_000144677.1.79659 WP_000144677.1.79668 WP_000144677.1.79708 WP_000144677.1.79845 WP_000144677.1.80077 WP_000144677.1.80137 WP_000144677.1.80182 WP_000144677.1.80366 WP_000144677.1.80780 WP_000144677.1.80831 WP_000144677.1.80850 WP_000144677.1.80881 WP_000144677.1.80939 WP_000144677.1.8096 WP_000144677.1.81037 WP_000144677.1.81069 WP_000144677.1.81149 WP_000144677.1.81175 WP_000144677.1.8119 WP_000144677.1.81193 WP_000144677.1.81354 WP_000144677.1.81410 WP_000144677.1.81425 WP_000144677.1.81750 WP_000144677.1.81785 WP_000144677.1.81902 WP_000144677.1.81974 WP_000144677.1.82337 WP_000144677.1.82479 WP_000144677.1.82503 WP_000144677.1.82515 WP_000144677.1.82676 WP_000144677.1.82761 WP_000144677.1.8282 WP_000144677.1.82944 WP_000144677.1.82956 WP_000144677.1.83092 WP_000144677.1.83163 WP_000144677.1.83305 WP_000144677.1.83365 WP_000144677.1.83413 WP_000144677.1.83491 WP_000144677.1.83523 WP_000144677.1.8354 WP_000144677.1.83651 WP_000144677.1.83721 WP_000144677.1.83760 WP_000144677.1.83995 WP_000144677.1.84103 WP_000144677.1.84283 WP_000144677.1.84392 WP_000144677.1.8441 WP_000144677.1.84532 WP_000144677.1.84659 WP_000144677.1.84693 WP_000144677.1.84899 WP_000144677.1.8497 WP_000144677.1.85040 WP_000144677.1.85134 WP_000144677.1.85178 WP_000144677.1.85180 WP_000144677.1.85190 WP_000144677.1.8533 WP_000144677.1.85483 WP_000144677.1.85541 WP_000144677.1.8556 WP_000144677.1.85615 WP_000144677.1.85617 WP_000144677.1.85663 WP_000144677.1.85671 WP_000144677.1.85672 WP_000144677.1.85777 WP_000144677.1.85855 WP_000144677.1.85886 WP_000144677.1.85900 WP_000144677.1.85904 WP_000144677.1.85976 WP_000144677.1.86306 WP_000144677.1.86356 WP_000144677.1.86450 WP_000144677.1.86469 WP_000144677.1.86588 WP_000144677.1.86661 WP_000144677.1.8672 WP_000144677.1.8678 WP_000144677.1.86810 WP_000144677.1.8684 WP_000144677.1.86895 WP_000144677.1.86906 WP_000144677.1.87323 WP_000144677.1.8736 WP_000144677.1.87460 WP_000144677.1.87552 WP_000144677.1.87945 WP_000144677.1.88019 WP_000144677.1.88073 WP_000144677.1.8809 WP_000144677.1.88291 WP_000144677.1.88293 WP_000144677.1.8837 WP_000144677.1.88703 WP_000144677.1.88792 WP_000144677.1.88902 WP_000144677.1.8891 WP_000144677.1.88981 WP_000144677.1.89008 WP_000144677.1.89116 WP_000144677.1.89138 WP_000144677.1.89304 WP_000144677.1.89512 WP_000144677.1.89527 WP_000144677.1.89570 WP_000144677.1.89604 WP_000144677.1.89622 WP_000144677.1.89659 WP_000144677.1.89902 WP_000144677.1.8996 WP_000144677.1.90097 WP_000144677.1.90252 WP_000144677.1.90417 WP_000144677.1.90453 WP_000144677.1.90458 WP_000144677.1.90557 WP_000144677.1.90585 WP_000144677.1.90641 WP_000144677.1.90734 WP_000144677.1.91003 WP_000144677.1.91069 WP_000144677.1.91278 WP_000144677.1.9131 WP_000144677.1.91512 WP_000144677.1.91524 WP_000144677.1.91564 WP_000144677.1.91628 WP_000144677.1.91655 WP_000144677.1.91724 WP_000144677.1.91732 WP_000144677.1.91788 WP_000144677.1.92013 WP_000144677.1.92060 WP_000144677.1.92093 WP_000144677.1.92108 WP_000144677.1.92171 WP_000144677.1.92183 WP_000144677.1.92208 WP_000144677.1.92268 WP_000144677.1.92310 WP_000144677.1.92318 WP_000144677.1.92443 WP_000144677.1.92482 WP_000144677.1.92529 WP_000144677.1.92531 WP_000144677.1.92669 WP_000144677.1.92671 WP_000144677.1.92738 WP_000144677.1.93101 WP_000144677.1.93136 WP_000144677.1.93155 WP_000144677.1.93213 WP_000144677.1.93275 WP_000144677.1.93365 WP_000144677.1.93376 WP_000144677.1.93543 WP_000144677.1.93650 WP_000144677.1.93656 WP_000144677.1.93662 WP_000144677.1.937 WP_000144677.1.93705 WP_000144677.1.93804 WP_000144677.1.9389 WP_000144677.1.93994 WP_000144677.1.94072 WP_000144677.1.94162 WP_000144677.1.94168 WP_000144677.1.94198 WP_000144677.1.9432 WP_000144677.1.94354 WP_000144677.1.94380 WP_000144677.1.94458 WP_000144677.1.94565 WP_000144677.1.94584 WP_000144677.1.94674 WP_000144677.1.94796 WP_000144677.1.94959 WP_000144677.1.95051 WP_000144677.1.95085 WP_000144677.1.95121 WP_000144677.1.95282 WP_000144677.1.95546 WP_000144677.1.95630 WP_000144677.1.95911 WP_000144677.1.96139 WP_000144677.1.96317 WP_000144677.1.96343 WP_000144677.1.9644 WP_000144677.1.96469 WP_000144677.1.96497 WP_000144677.1.96500 WP_000144677.1.96555 WP_000144677.1.96563 WP_000144677.1.96732 WP_000144677.1.96771 WP_000144677.1.97015 WP_000144677.1.97145 WP_000144677.1.97190 WP_000144677.1.97318 WP_000144677.1.97369 WP_000144677.1.97594 WP_000144677.1.97613 WP_000144677.1.97620 WP_000144677.1.97727 WP_000144677.1.97732 WP_000144677.1.97736 WP_000144677.1.9775 WP_000144677.1.97846 WP_000144677.1.98006 WP_000144677.1.98019 WP_000144677.1.98022 WP_000144677.1.98110 WP_000144677.1.98146 WP_000144677.1.98219 WP_000144677.1.98236 WP_000144677.1.9841 WP_000144677.1.98531 WP_000144677.1.98577 WP_000144677.1.98676 WP_000144677.1.98677 WP_000144677.1.98760 WP_000144677.1.98843 WP_000144677.1.9898 WP_000144677.1.99072 WP_000144677.1.99098 WP_000144677.1.99184 WP_000144677.1.99267 WP_000144677.1.99276 WP_000144677.1.99646 WP_000144677.1.99657 WP_000144677.1.99660 WP_000144677.1.99712 WP_000144677.1.99813 WP_000144677.1.99858 WP_000144677.1.99889 WP_000144677.1.99958 gi|378700215|ref|YP_005182172.1| gi|526220857|ref|YP_008266551.1| gi|379701536|ref|YP_005243264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]