SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451135|ref|YP_005238494.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451135|ref|YP_005238494.1|
Domain Number 1 Region: 13-327
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 8.45e-177
Family SCOPe 0.000000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451135|ref|YP_005238494.1|
Sequence length 332
Comment putative oxidoreductase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MIYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENSRALLQRAFDLGITHF
DLANNYGPPPGSAECNFGRILQEDFLPWRDELIISTKAGYTMWDGPYGDWGSRKYLIASL
DQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRHGKALYVGISNYPADLARQAID
ILEDLGTPCLIHQPKYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDRYLNGIPED
SRAASGSRFLKPEQITADKLEKVRRLNELAARRGQKLSQMALAWVLRNDNVTSVLIGASK
PSQIEDAVGMLANRRFSAAECAEIDAILEGRF
Download sequence
Identical sequences A0A0D6FAH0 A0A0F6B4F7 A0A0G2NQG7 A0A0H3NP86 A0A0T9Y5L9 A0A0U1JG09 A0A0W3SXM7 A0A1R2MRS5 A0A221YXM3 A0A249UXF7 A0A2C6FFU1 A0A2H9YGW0 A0A2I6P1Q7 A0A2J0RE43 B5RCN4 E8XF62 Q8ZNA1 S4ICL7
gi|383497105|ref|YP_005397794.1| gi|482904223|ref|YP_007902783.1| gi|378989792|ref|YP_005252956.1| gi|16765732|ref|NP_461347.1| APC7600 IDP01002 gi|205353520|ref|YP_002227321.1| gi|378954243|ref|YP_005211730.1| gi|537435811|ref|YP_008480188.1| gi|378445833|ref|YP_005233465.1| gi|525837508|ref|YP_008254340.1| gi|207857825|ref|YP_002244476.1| gi|378984970|ref|YP_005248125.1| gi|379701641|ref|YP_005243369.1| gi|378451135|ref|YP_005238494.1| gi|526220946|ref|YP_008266655.1| 5t79_A gi|378700315|ref|YP_005182272.1| 550537.SEN2392 550538.SG2442 99287.STM2406 gi|550901840|ref|YP_008670932.1| NP_461347.1.58477 WP_000640293.1.100010 WP_000640293.1.100077 WP_000640293.1.100149 WP_000640293.1.100165 WP_000640293.1.100191 WP_000640293.1.100234 WP_000640293.1.100258 WP_000640293.1.100376 WP_000640293.1.100392 WP_000640293.1.100412 WP_000640293.1.100413 WP_000640293.1.100424 WP_000640293.1.100436 WP_000640293.1.100457 WP_000640293.1.100484 WP_000640293.1.100488 WP_000640293.1.100541 WP_000640293.1.100557 WP_000640293.1.100597 WP_000640293.1.100605 WP_000640293.1.10076 WP_000640293.1.100776 WP_000640293.1.100793 WP_000640293.1.10081 WP_000640293.1.100857 WP_000640293.1.100869 WP_000640293.1.100871 WP_000640293.1.100882 WP_000640293.1.100895 WP_000640293.1.101007 WP_000640293.1.101020 WP_000640293.1.101074 WP_000640293.1.101078 WP_000640293.1.101112 WP_000640293.1.101180 WP_000640293.1.101259 WP_000640293.1.101284 WP_000640293.1.101291 WP_000640293.1.101320 WP_000640293.1.101353 WP_000640293.1.101386 WP_000640293.1.101404 WP_000640293.1.101420 WP_000640293.1.101541 WP_000640293.1.101589 WP_000640293.1.101634 WP_000640293.1.101674 WP_000640293.1.101707 WP_000640293.1.101734 WP_000640293.1.101741 WP_000640293.1.101832 WP_000640293.1.101878 WP_000640293.1.101917 WP_000640293.1.101953 WP_000640293.1.102111 WP_000640293.1.10220 WP_000640293.1.10266 WP_000640293.1.10300 WP_000640293.1.10429 WP_000640293.1.10439 WP_000640293.1.10463 WP_000640293.1.10498 WP_000640293.1.10631 WP_000640293.1.10678 WP_000640293.1.10753 WP_000640293.1.10755 WP_000640293.1.10868 WP_000640293.1.10898 WP_000640293.1.10992 WP_000640293.1.11000 WP_000640293.1.11024 WP_000640293.1.11031 WP_000640293.1.11098 WP_000640293.1.11119 WP_000640293.1.11168 WP_000640293.1.11190 WP_000640293.1.11216 WP_000640293.1.11254 WP_000640293.1.11295 WP_000640293.1.11405 WP_000640293.1.11455 WP_000640293.1.11458 WP_000640293.1.1150 WP_000640293.1.11518 WP_000640293.1.11526 WP_000640293.1.11528 WP_000640293.1.11532 WP_000640293.1.11543 WP_000640293.1.11544 WP_000640293.1.1156 WP_000640293.1.1169 WP_000640293.1.1174 WP_000640293.1.11763 WP_000640293.1.11772 WP_000640293.1.11824 WP_000640293.1.11841 WP_000640293.1.11875 WP_000640293.1.11897 WP_000640293.1.11900 WP_000640293.1.11978 WP_000640293.1.12025 WP_000640293.1.12027 WP_000640293.1.12106 WP_000640293.1.12114 WP_000640293.1.1215 WP_000640293.1.12160 WP_000640293.1.12168 WP_000640293.1.12280 WP_000640293.1.12340 WP_000640293.1.12351 WP_000640293.1.12370 WP_000640293.1.12374 WP_000640293.1.12397 WP_000640293.1.12485 WP_000640293.1.12546 WP_000640293.1.12568 WP_000640293.1.12569 WP_000640293.1.12585 WP_000640293.1.1264 WP_000640293.1.12696 WP_000640293.1.12728 WP_000640293.1.12879 WP_000640293.1.12936 WP_000640293.1.12995 WP_000640293.1.1300 WP_000640293.1.13027 WP_000640293.1.13076 WP_000640293.1.13102 WP_000640293.1.13106 WP_000640293.1.13130 WP_000640293.1.13247 WP_000640293.1.13274 WP_000640293.1.13334 WP_000640293.1.13367 WP_000640293.1.13391 WP_000640293.1.13414 WP_000640293.1.1346 WP_000640293.1.13488 WP_000640293.1.13509 WP_000640293.1.13573 WP_000640293.1.13625 WP_000640293.1.13669 WP_000640293.1.13741 WP_000640293.1.13819 WP_000640293.1.1387 WP_000640293.1.13908 WP_000640293.1.13932 WP_000640293.1.13968 WP_000640293.1.14001 WP_000640293.1.1412 WP_000640293.1.14151 WP_000640293.1.14239 WP_000640293.1.14320 WP_000640293.1.14379 WP_000640293.1.14406 WP_000640293.1.14410 WP_000640293.1.14466 WP_000640293.1.14524 WP_000640293.1.14554 WP_000640293.1.146 WP_000640293.1.14706 WP_000640293.1.14708 WP_000640293.1.14725 WP_000640293.1.14789 WP_000640293.1.14793 WP_000640293.1.14819 WP_000640293.1.14852 WP_000640293.1.1489 WP_000640293.1.14913 WP_000640293.1.14932 WP_000640293.1.15055 WP_000640293.1.15067 WP_000640293.1.15102 WP_000640293.1.15124 WP_000640293.1.15223 WP_000640293.1.15226 WP_000640293.1.15276 WP_000640293.1.15316 WP_000640293.1.15318 WP_000640293.1.15369 WP_000640293.1.1540 WP_000640293.1.15508 WP_000640293.1.15585 WP_000640293.1.15644 WP_000640293.1.1568 WP_000640293.1.15775 WP_000640293.1.15777 WP_000640293.1.15784 WP_000640293.1.15830 WP_000640293.1.15881 WP_000640293.1.16062 WP_000640293.1.16063 WP_000640293.1.16103 WP_000640293.1.16166 WP_000640293.1.16172 WP_000640293.1.16226 WP_000640293.1.16233 WP_000640293.1.16284 WP_000640293.1.16328 WP_000640293.1.1635 WP_000640293.1.16363 WP_000640293.1.16365 WP_000640293.1.16366 WP_000640293.1.16394 WP_000640293.1.16453 WP_000640293.1.16468 WP_000640293.1.16474 WP_000640293.1.16614 WP_000640293.1.16650 WP_000640293.1.16686 WP_000640293.1.16691 WP_000640293.1.167 WP_000640293.1.16729 WP_000640293.1.16732 WP_000640293.1.16735 WP_000640293.1.16786 WP_000640293.1.16858 WP_000640293.1.16896 WP_000640293.1.16949 WP_000640293.1.16965 WP_000640293.1.16972 WP_000640293.1.17060 WP_000640293.1.17096 WP_000640293.1.17105 WP_000640293.1.17307 WP_000640293.1.1733 WP_000640293.1.174 WP_000640293.1.17480 WP_000640293.1.17482 WP_000640293.1.17525 WP_000640293.1.17546 WP_000640293.1.17583 WP_000640293.1.17693 WP_000640293.1.17702 WP_000640293.1.17705 WP_000640293.1.17732 WP_000640293.1.17747 WP_000640293.1.17886 WP_000640293.1.17914 WP_000640293.1.17936 WP_000640293.1.18019 WP_000640293.1.18056 WP_000640293.1.18061 WP_000640293.1.1807 WP_000640293.1.18092 WP_000640293.1.18109 WP_000640293.1.18111 WP_000640293.1.18149 WP_000640293.1.18163 WP_000640293.1.18265 WP_000640293.1.18267 WP_000640293.1.18282 WP_000640293.1.18384 WP_000640293.1.18468 WP_000640293.1.18607 WP_000640293.1.18641 WP_000640293.1.18686 WP_000640293.1.18705 WP_000640293.1.18715 WP_000640293.1.18737 WP_000640293.1.18776 WP_000640293.1.18822 WP_000640293.1.18847 WP_000640293.1.18886 WP_000640293.1.18940 WP_000640293.1.18949 WP_000640293.1.1895 WP_000640293.1.19053 WP_000640293.1.19055 WP_000640293.1.19093 WP_000640293.1.19320 WP_000640293.1.19373 WP_000640293.1.19433 WP_000640293.1.19458 WP_000640293.1.19460 WP_000640293.1.19461 WP_000640293.1.1955 WP_000640293.1.19614 WP_000640293.1.19642 WP_000640293.1.19656 WP_000640293.1.19702 WP_000640293.1.19706 WP_000640293.1.19724 WP_000640293.1.19749 WP_000640293.1.19784 WP_000640293.1.19802 WP_000640293.1.19809 WP_000640293.1.19823 WP_000640293.1.19834 WP_000640293.1.19867 WP_000640293.1.19938 WP_000640293.1.1998 WP_000640293.1.20 WP_000640293.1.20086 WP_000640293.1.2010 WP_000640293.1.20119 WP_000640293.1.20212 WP_000640293.1.20261 WP_000640293.1.20266 WP_000640293.1.20271 WP_000640293.1.20330 WP_000640293.1.20362 WP_000640293.1.2041 WP_000640293.1.20418 WP_000640293.1.20437 WP_000640293.1.20443 WP_000640293.1.2047 WP_000640293.1.20503 WP_000640293.1.20525 WP_000640293.1.2054 WP_000640293.1.20553 WP_000640293.1.20573 WP_000640293.1.20626 WP_000640293.1.20646 WP_000640293.1.20886 WP_000640293.1.20908 WP_000640293.1.2101 WP_000640293.1.21049 WP_000640293.1.2107 WP_000640293.1.21079 WP_000640293.1.21086 WP_000640293.1.21103 WP_000640293.1.2116 WP_000640293.1.21165 WP_000640293.1.21194 WP_000640293.1.21202 WP_000640293.1.21241 WP_000640293.1.21245 WP_000640293.1.21246 WP_000640293.1.21269 WP_000640293.1.21332 WP_000640293.1.21400 WP_000640293.1.21497 WP_000640293.1.21499 WP_000640293.1.21548 WP_000640293.1.21603 WP_000640293.1.21681 WP_000640293.1.21715 WP_000640293.1.21750 WP_000640293.1.21751 WP_000640293.1.21757 WP_000640293.1.21825 WP_000640293.1.21909 WP_000640293.1.21950 WP_000640293.1.22024 WP_000640293.1.2205 WP_000640293.1.22051 WP_000640293.1.22062 WP_000640293.1.22067 WP_000640293.1.22096 WP_000640293.1.22136 WP_000640293.1.22158 WP_000640293.1.22162 WP_000640293.1.2221 WP_000640293.1.22296 WP_000640293.1.22315 WP_000640293.1.22337 WP_000640293.1.22346 WP_000640293.1.2235 WP_000640293.1.22379 WP_000640293.1.22427 WP_000640293.1.22449 WP_000640293.1.22454 WP_000640293.1.2246 WP_000640293.1.22460 WP_000640293.1.22485 WP_000640293.1.22537 WP_000640293.1.22595 WP_000640293.1.22605 WP_000640293.1.22620 WP_000640293.1.22760 WP_000640293.1.22857 WP_000640293.1.22870 WP_000640293.1.22880 WP_000640293.1.22902 WP_000640293.1.22947 WP_000640293.1.22979 WP_000640293.1.23010 WP_000640293.1.23102 WP_000640293.1.23114 WP_000640293.1.2314 WP_000640293.1.23192 WP_000640293.1.2324 WP_000640293.1.23259 WP_000640293.1.23329 WP_000640293.1.23442 WP_000640293.1.23460 WP_000640293.1.23472 WP_000640293.1.23482 WP_000640293.1.23485 WP_000640293.1.23513 WP_000640293.1.2358 WP_000640293.1.23587 WP_000640293.1.23629 WP_000640293.1.23631 WP_000640293.1.23634 WP_000640293.1.2364 WP_000640293.1.23746 WP_000640293.1.24017 WP_000640293.1.24145 WP_000640293.1.24158 WP_000640293.1.24206 WP_000640293.1.24214 WP_000640293.1.24250 WP_000640293.1.24297 WP_000640293.1.24308 WP_000640293.1.24361 WP_000640293.1.24408 WP_000640293.1.24409 WP_000640293.1.24476 WP_000640293.1.24494 WP_000640293.1.24578 WP_000640293.1.24673 WP_000640293.1.24737 WP_000640293.1.24779 WP_000640293.1.24873 WP_000640293.1.24901 WP_000640293.1.24944 WP_000640293.1.25008 WP_000640293.1.25015 WP_000640293.1.25036 WP_000640293.1.25159 WP_000640293.1.25175 WP_000640293.1.25206 WP_000640293.1.25354 WP_000640293.1.25405 WP_000640293.1.25426 WP_000640293.1.25454 WP_000640293.1.25493 WP_000640293.1.25618 WP_000640293.1.25668 WP_000640293.1.25690 WP_000640293.1.2570 WP_000640293.1.25700 WP_000640293.1.25740 WP_000640293.1.25780 WP_000640293.1.25793 WP_000640293.1.25814 WP_000640293.1.25951 WP_000640293.1.25988 WP_000640293.1.26083 WP_000640293.1.26093 WP_000640293.1.26129 WP_000640293.1.26194 WP_000640293.1.26224 WP_000640293.1.26282 WP_000640293.1.26311 WP_000640293.1.26319 WP_000640293.1.26429 WP_000640293.1.26440 WP_000640293.1.26441 WP_000640293.1.26493 WP_000640293.1.26551 WP_000640293.1.26567 WP_000640293.1.26646 WP_000640293.1.26687 WP_000640293.1.26709 WP_000640293.1.2672 WP_000640293.1.26794 WP_000640293.1.26856 WP_000640293.1.26936 WP_000640293.1.26980 WP_000640293.1.27010 WP_000640293.1.27173 WP_000640293.1.27206 WP_000640293.1.27255 WP_000640293.1.27272 WP_000640293.1.27314 WP_000640293.1.27383 WP_000640293.1.27423 WP_000640293.1.27523 WP_000640293.1.27547 WP_000640293.1.27561 WP_000640293.1.2763 WP_000640293.1.27632 WP_000640293.1.27638 WP_000640293.1.27658 WP_000640293.1.27665 WP_000640293.1.27707 WP_000640293.1.27761 WP_000640293.1.2777 WP_000640293.1.27800 WP_000640293.1.27833 WP_000640293.1.27857 WP_000640293.1.27883 WP_000640293.1.27977 WP_000640293.1.27995 WP_000640293.1.28037 WP_000640293.1.28056 WP_000640293.1.28094 WP_000640293.1.28126 WP_000640293.1.28139 WP_000640293.1.28170 WP_000640293.1.28200 WP_000640293.1.28232 WP_000640293.1.28233 WP_000640293.1.28301 WP_000640293.1.28302 WP_000640293.1.28303 WP_000640293.1.2835 WP_000640293.1.28370 WP_000640293.1.28462 WP_000640293.1.2853 WP_000640293.1.28538 WP_000640293.1.28570 WP_000640293.1.28575 WP_000640293.1.28620 WP_000640293.1.28625 WP_000640293.1.28655 WP_000640293.1.28694 WP_000640293.1.28733 WP_000640293.1.28773 WP_000640293.1.2879 WP_000640293.1.2890 WP_000640293.1.28938 WP_000640293.1.28946 WP_000640293.1.29006 WP_000640293.1.29010 WP_000640293.1.2910 WP_000640293.1.29168 WP_000640293.1.29190 WP_000640293.1.29218 WP_000640293.1.2924 WP_000640293.1.2932 WP_000640293.1.29379 WP_000640293.1.29422 WP_000640293.1.29436 WP_000640293.1.29576 WP_000640293.1.29588 WP_000640293.1.29601 WP_000640293.1.29606 WP_000640293.1.29615 WP_000640293.1.29619 WP_000640293.1.29704 WP_000640293.1.29711 WP_000640293.1.29969 WP_000640293.1.30006 WP_000640293.1.30027 WP_000640293.1.3005 WP_000640293.1.30059 WP_000640293.1.30086 WP_000640293.1.30165 WP_000640293.1.30180 WP_000640293.1.30210 WP_000640293.1.30278 WP_000640293.1.30492 WP_000640293.1.30505 WP_000640293.1.30507 WP_000640293.1.30535 WP_000640293.1.30547 WP_000640293.1.30548 WP_000640293.1.30589 WP_000640293.1.30627 WP_000640293.1.30752 WP_000640293.1.30794 WP_000640293.1.3080 WP_000640293.1.30833 WP_000640293.1.30835 WP_000640293.1.30968 WP_000640293.1.30972 WP_000640293.1.31 WP_000640293.1.3113 WP_000640293.1.31167 WP_000640293.1.31185 WP_000640293.1.3119 WP_000640293.1.31190 WP_000640293.1.31195 WP_000640293.1.31196 WP_000640293.1.31219 WP_000640293.1.31251 WP_000640293.1.31272 WP_000640293.1.31281 WP_000640293.1.31335 WP_000640293.1.31362 WP_000640293.1.31435 WP_000640293.1.31504 WP_000640293.1.31515 WP_000640293.1.31578 WP_000640293.1.31585 WP_000640293.1.31658 WP_000640293.1.3167 WP_000640293.1.31725 WP_000640293.1.31782 WP_000640293.1.31895 WP_000640293.1.31901 WP_000640293.1.31940 WP_000640293.1.31967 WP_000640293.1.31972 WP_000640293.1.32109 WP_000640293.1.32192 WP_000640293.1.32206 WP_000640293.1.32252 WP_000640293.1.32255 WP_000640293.1.32274 WP_000640293.1.32309 WP_000640293.1.32438 WP_000640293.1.32515 WP_000640293.1.32519 WP_000640293.1.32527 WP_000640293.1.32660 WP_000640293.1.32668 WP_000640293.1.32702 WP_000640293.1.32714 WP_000640293.1.32740 WP_000640293.1.32750 WP_000640293.1.32786 WP_000640293.1.32804 WP_000640293.1.32832 WP_000640293.1.32860 WP_000640293.1.32881 WP_000640293.1.32899 WP_000640293.1.32900 WP_000640293.1.32907 WP_000640293.1.32977 WP_000640293.1.33030 WP_000640293.1.33127 WP_000640293.1.33143 WP_000640293.1.33248 WP_000640293.1.33253 WP_000640293.1.33261 WP_000640293.1.33270 WP_000640293.1.333 WP_000640293.1.33392 WP_000640293.1.33409 WP_000640293.1.33492 WP_000640293.1.335 WP_000640293.1.33553 WP_000640293.1.3356 WP_000640293.1.33586 WP_000640293.1.33592 WP_000640293.1.3364 WP_000640293.1.33825 WP_000640293.1.33894 WP_000640293.1.3396 WP_000640293.1.34 WP_000640293.1.34043 WP_000640293.1.34075 WP_000640293.1.34091 WP_000640293.1.34185 WP_000640293.1.34257 WP_000640293.1.34279 WP_000640293.1.34292 WP_000640293.1.34319 WP_000640293.1.34330 WP_000640293.1.3438 WP_000640293.1.34431 WP_000640293.1.34453 WP_000640293.1.34454 WP_000640293.1.34610 WP_000640293.1.34614 WP_000640293.1.34820 WP_000640293.1.34856 WP_000640293.1.34977 WP_000640293.1.35045 WP_000640293.1.35129 WP_000640293.1.35184 WP_000640293.1.35298 WP_000640293.1.35321 WP_000640293.1.35404 WP_000640293.1.35408 WP_000640293.1.35425 WP_000640293.1.35429 WP_000640293.1.35446 WP_000640293.1.35463 WP_000640293.1.35503 WP_000640293.1.35509 WP_000640293.1.35563 WP_000640293.1.35570 WP_000640293.1.35590 WP_000640293.1.35594 WP_000640293.1.35624 WP_000640293.1.35648 WP_000640293.1.35887 WP_000640293.1.35936 WP_000640293.1.35940 WP_000640293.1.35961 WP_000640293.1.36003 WP_000640293.1.3601 WP_000640293.1.36037 WP_000640293.1.36063 WP_000640293.1.36232 WP_000640293.1.36409 WP_000640293.1.36445 WP_000640293.1.36584 WP_000640293.1.36609 WP_000640293.1.36685 WP_000640293.1.36690 WP_000640293.1.3670 WP_000640293.1.36705 WP_000640293.1.36721 WP_000640293.1.36764 WP_000640293.1.36889 WP_000640293.1.36918 WP_000640293.1.36931 WP_000640293.1.37013 WP_000640293.1.37029 WP_000640293.1.37063 WP_000640293.1.37073 WP_000640293.1.37111 WP_000640293.1.37112 WP_000640293.1.37114 WP_000640293.1.37191 WP_000640293.1.37256 WP_000640293.1.37293 WP_000640293.1.37297 WP_000640293.1.37370 WP_000640293.1.37376 WP_000640293.1.37405 WP_000640293.1.3744 WP_000640293.1.3748 WP_000640293.1.37498 WP_000640293.1.37504 WP_000640293.1.37618 WP_000640293.1.37687 WP_000640293.1.3771 WP_000640293.1.3778 WP_000640293.1.37848 WP_000640293.1.37864 WP_000640293.1.3790 WP_000640293.1.37968 WP_000640293.1.37978 WP_000640293.1.38037 WP_000640293.1.38047 WP_000640293.1.38125 WP_000640293.1.38145 WP_000640293.1.383 WP_000640293.1.38341 WP_000640293.1.38344 WP_000640293.1.3848 WP_000640293.1.38613 WP_000640293.1.38673 WP_000640293.1.3869 WP_000640293.1.38693 WP_000640293.1.38773 WP_000640293.1.38882 WP_000640293.1.38913 WP_000640293.1.39003 WP_000640293.1.39048 WP_000640293.1.39055 WP_000640293.1.39065 WP_000640293.1.39113 WP_000640293.1.39136 WP_000640293.1.39197 WP_000640293.1.39229 WP_000640293.1.39312 WP_000640293.1.39395 WP_000640293.1.39405 WP_000640293.1.39420 WP_000640293.1.39449 WP_000640293.1.39466 WP_000640293.1.39471 WP_000640293.1.39512 WP_000640293.1.39556 WP_000640293.1.39629 WP_000640293.1.39722 WP_000640293.1.39763 WP_000640293.1.39862 WP_000640293.1.39921 WP_000640293.1.39923 WP_000640293.1.40017 WP_000640293.1.40072 WP_000640293.1.40073 WP_000640293.1.40081 WP_000640293.1.4011 WP_000640293.1.40155 WP_000640293.1.40171 WP_000640293.1.40208 WP_000640293.1.40240 WP_000640293.1.40257 WP_000640293.1.40292 WP_000640293.1.40305 WP_000640293.1.40307 WP_000640293.1.40311 WP_000640293.1.40380 WP_000640293.1.40395 WP_000640293.1.40465 WP_000640293.1.40493 WP_000640293.1.40508 WP_000640293.1.40533 WP_000640293.1.40577 WP_000640293.1.40622 WP_000640293.1.40695 WP_000640293.1.40710 WP_000640293.1.40745 WP_000640293.1.4075 WP_000640293.1.40771 WP_000640293.1.40849 WP_000640293.1.4087 WP_000640293.1.40877 WP_000640293.1.40930 WP_000640293.1.40973 WP_000640293.1.40979 WP_000640293.1.41017 WP_000640293.1.41086 WP_000640293.1.41091 WP_000640293.1.41116 WP_000640293.1.41128 WP_000640293.1.41192 WP_000640293.1.41225 WP_000640293.1.41226 WP_000640293.1.41277 WP_000640293.1.41279 WP_000640293.1.41310 WP_000640293.1.41375 WP_000640293.1.41427 WP_000640293.1.41440 WP_000640293.1.41516 WP_000640293.1.41528 WP_000640293.1.41554 WP_000640293.1.41572 WP_000640293.1.41591 WP_000640293.1.41610 WP_000640293.1.41662 WP_000640293.1.41690 WP_000640293.1.41708 WP_000640293.1.41761 WP_000640293.1.41799 WP_000640293.1.41802 WP_000640293.1.41859 WP_000640293.1.41882 WP_000640293.1.41911 WP_000640293.1.41949 WP_000640293.1.41978 WP_000640293.1.41979 WP_000640293.1.41985 WP_000640293.1.42104 WP_000640293.1.42136 WP_000640293.1.422 WP_000640293.1.42263 WP_000640293.1.42320 WP_000640293.1.42322 WP_000640293.1.42342 WP_000640293.1.42392 WP_000640293.1.42422 WP_000640293.1.42595 WP_000640293.1.42666 WP_000640293.1.42675 WP_000640293.1.42683 WP_000640293.1.42707 WP_000640293.1.42734 WP_000640293.1.4276 WP_000640293.1.42864 WP_000640293.1.4288 WP_000640293.1.4289 WP_000640293.1.42892 WP_000640293.1.42932 WP_000640293.1.43018 WP_000640293.1.43041 WP_000640293.1.43201 WP_000640293.1.43244 WP_000640293.1.43312 WP_000640293.1.43334 WP_000640293.1.43351 WP_000640293.1.43437 WP_000640293.1.43438 WP_000640293.1.4344 WP_000640293.1.43522 WP_000640293.1.43613 WP_000640293.1.43668 WP_000640293.1.43685 WP_000640293.1.43710 WP_000640293.1.43711 WP_000640293.1.43785 WP_000640293.1.43886 WP_000640293.1.44010 WP_000640293.1.4404 WP_000640293.1.44043 WP_000640293.1.44099 WP_000640293.1.44121 WP_000640293.1.44187 WP_000640293.1.44291 WP_000640293.1.44310 WP_000640293.1.44337 WP_000640293.1.44386 WP_000640293.1.44474 WP_000640293.1.44479 WP_000640293.1.44607 WP_000640293.1.44640 WP_000640293.1.4467 WP_000640293.1.44705 WP_000640293.1.44747 WP_000640293.1.44791 WP_000640293.1.44831 WP_000640293.1.4485 WP_000640293.1.44877 WP_000640293.1.44927 WP_000640293.1.44966 WP_000640293.1.44971 WP_000640293.1.44978 WP_000640293.1.44997 WP_000640293.1.4500 WP_000640293.1.45067 WP_000640293.1.45074 WP_000640293.1.45079 WP_000640293.1.45098 WP_000640293.1.45138 WP_000640293.1.45173 WP_000640293.1.45177 WP_000640293.1.45184 WP_000640293.1.45259 WP_000640293.1.45302 WP_000640293.1.4531 WP_000640293.1.45344 WP_000640293.1.45349 WP_000640293.1.45365 WP_000640293.1.45432 WP_000640293.1.45549 WP_000640293.1.45550 WP_000640293.1.45569 WP_000640293.1.45571 WP_000640293.1.45583 WP_000640293.1.45585 WP_000640293.1.45660 WP_000640293.1.45690 WP_000640293.1.45706 WP_000640293.1.45797 WP_000640293.1.458 WP_000640293.1.45844 WP_000640293.1.45906 WP_000640293.1.45918 WP_000640293.1.46011 WP_000640293.1.46069 WP_000640293.1.46112 WP_000640293.1.46173 WP_000640293.1.46174 WP_000640293.1.46187 WP_000640293.1.46215 WP_000640293.1.46303 WP_000640293.1.46578 WP_000640293.1.46595 WP_000640293.1.46675 WP_000640293.1.46693 WP_000640293.1.46726 WP_000640293.1.46732 WP_000640293.1.4674 WP_000640293.1.46749 WP_000640293.1.4686 WP_000640293.1.46930 WP_000640293.1.46967 WP_000640293.1.46976 WP_000640293.1.47057 WP_000640293.1.47067 WP_000640293.1.47214 WP_000640293.1.47429 WP_000640293.1.47448 WP_000640293.1.4747 WP_000640293.1.47472 WP_000640293.1.47478 WP_000640293.1.47507 WP_000640293.1.47567 WP_000640293.1.47576 WP_000640293.1.4758 WP_000640293.1.4769 WP_000640293.1.47799 WP_000640293.1.47829 WP_000640293.1.47849 WP_000640293.1.47850 WP_000640293.1.47875 WP_000640293.1.47911 WP_000640293.1.4795 WP_000640293.1.47988 WP_000640293.1.48242 WP_000640293.1.48244 WP_000640293.1.48253 WP_000640293.1.483 WP_000640293.1.48367 WP_000640293.1.48377 WP_000640293.1.4839 WP_000640293.1.48399 WP_000640293.1.48493 WP_000640293.1.48524 WP_000640293.1.4853 WP_000640293.1.48788 WP_000640293.1.48797 WP_000640293.1.4885 WP_000640293.1.48894 WP_000640293.1.48896 WP_000640293.1.48919 WP_000640293.1.49084 WP_000640293.1.49155 WP_000640293.1.49204 WP_000640293.1.49239 WP_000640293.1.49256 WP_000640293.1.49290 WP_000640293.1.49311 WP_000640293.1.49334 WP_000640293.1.49340 WP_000640293.1.49366 WP_000640293.1.49490 WP_000640293.1.49515 WP_000640293.1.49572 WP_000640293.1.49595 WP_000640293.1.49630 WP_000640293.1.49770 WP_000640293.1.4979 WP_000640293.1.49803 WP_000640293.1.49805 WP_000640293.1.49929 WP_000640293.1.50080 WP_000640293.1.50128 WP_000640293.1.50161 WP_000640293.1.50211 WP_000640293.1.50332 WP_000640293.1.50374 WP_000640293.1.50376 WP_000640293.1.50389 WP_000640293.1.50449 WP_000640293.1.50652 WP_000640293.1.50676 WP_000640293.1.50684 WP_000640293.1.50774 WP_000640293.1.50804 WP_000640293.1.50808 WP_000640293.1.5088 WP_000640293.1.50882 WP_000640293.1.50908 WP_000640293.1.50941 WP_000640293.1.50960 WP_000640293.1.51014 WP_000640293.1.51022 WP_000640293.1.51179 WP_000640293.1.51182 WP_000640293.1.51186 WP_000640293.1.51356 WP_000640293.1.5138 WP_000640293.1.51394 WP_000640293.1.51412 WP_000640293.1.51451 WP_000640293.1.51487 WP_000640293.1.51488 WP_000640293.1.51502 WP_000640293.1.51518 WP_000640293.1.51613 WP_000640293.1.51634 WP_000640293.1.51642 WP_000640293.1.51649 WP_000640293.1.51686 WP_000640293.1.51700 WP_000640293.1.51756 WP_000640293.1.51764 WP_000640293.1.51810 WP_000640293.1.51868 WP_000640293.1.51911 WP_000640293.1.51930 WP_000640293.1.51932 WP_000640293.1.51989 WP_000640293.1.51994 WP_000640293.1.520 WP_000640293.1.5211 WP_000640293.1.52121 WP_000640293.1.52148 WP_000640293.1.52161 WP_000640293.1.52301 WP_000640293.1.52321 WP_000640293.1.52346 WP_000640293.1.52353 WP_000640293.1.52361 WP_000640293.1.52446 WP_000640293.1.52582 WP_000640293.1.52586 WP_000640293.1.52653 WP_000640293.1.52656 WP_000640293.1.52738 WP_000640293.1.52743 WP_000640293.1.52833 WP_000640293.1.52857 WP_000640293.1.52898 WP_000640293.1.52915 WP_000640293.1.53107 WP_000640293.1.53119 WP_000640293.1.5313 WP_000640293.1.53190 WP_000640293.1.53198 WP_000640293.1.53234 WP_000640293.1.53362 WP_000640293.1.53385 WP_000640293.1.53406 WP_000640293.1.53436 WP_000640293.1.53466 WP_000640293.1.53529 WP_000640293.1.53543 WP_000640293.1.53567 WP_000640293.1.53664 WP_000640293.1.53757 WP_000640293.1.53778 WP_000640293.1.53781 WP_000640293.1.53790 WP_000640293.1.53812 WP_000640293.1.53896 WP_000640293.1.53961 WP_000640293.1.54033 WP_000640293.1.54068 WP_000640293.1.54075 WP_000640293.1.54085 WP_000640293.1.54196 WP_000640293.1.542 WP_000640293.1.54209 WP_000640293.1.54271 WP_000640293.1.54273 WP_000640293.1.54274 WP_000640293.1.54283 WP_000640293.1.54319 WP_000640293.1.54324 WP_000640293.1.54364 WP_000640293.1.54366 WP_000640293.1.54400 WP_000640293.1.54615 WP_000640293.1.54644 WP_000640293.1.54662 WP_000640293.1.54694 WP_000640293.1.54722 WP_000640293.1.54749 WP_000640293.1.54764 WP_000640293.1.54833 WP_000640293.1.54877 WP_000640293.1.54936 WP_000640293.1.55008 WP_000640293.1.55152 WP_000640293.1.55156 WP_000640293.1.5523 WP_000640293.1.55285 WP_000640293.1.55475 WP_000640293.1.55528 WP_000640293.1.5555 WP_000640293.1.55559 WP_000640293.1.55640 WP_000640293.1.55647 WP_000640293.1.5572 WP_000640293.1.55743 WP_000640293.1.55768 WP_000640293.1.5577 WP_000640293.1.55782 WP_000640293.1.55796 WP_000640293.1.55948 WP_000640293.1.55993 WP_000640293.1.55995 WP_000640293.1.56002 WP_000640293.1.56012 WP_000640293.1.56105 WP_000640293.1.56235 WP_000640293.1.56238 WP_000640293.1.56263 WP_000640293.1.56286 WP_000640293.1.56304 WP_000640293.1.5633 WP_000640293.1.56396 WP_000640293.1.56414 WP_000640293.1.56438 WP_000640293.1.56560 WP_000640293.1.56597 WP_000640293.1.56601 WP_000640293.1.56614 WP_000640293.1.56651 WP_000640293.1.56671 WP_000640293.1.5668 WP_000640293.1.56682 WP_000640293.1.56824 WP_000640293.1.56851 WP_000640293.1.56861 WP_000640293.1.56875 WP_000640293.1.56877 WP_000640293.1.56898 WP_000640293.1.57026 WP_000640293.1.57039 WP_000640293.1.57056 WP_000640293.1.5711 WP_000640293.1.57143 WP_000640293.1.57168 WP_000640293.1.57187 WP_000640293.1.57232 WP_000640293.1.57246 WP_000640293.1.57296 WP_000640293.1.57362 WP_000640293.1.57377 WP_000640293.1.57433 WP_000640293.1.57515 WP_000640293.1.57559 WP_000640293.1.57576 WP_000640293.1.57601 WP_000640293.1.57607 WP_000640293.1.57631 WP_000640293.1.57763 WP_000640293.1.57835 WP_000640293.1.57862 WP_000640293.1.57890 WP_000640293.1.57891 WP_000640293.1.57893 WP_000640293.1.57978 WP_000640293.1.5801 WP_000640293.1.58041 WP_000640293.1.58090 WP_000640293.1.5828 WP_000640293.1.58290 WP_000640293.1.58418 WP_000640293.1.58442 WP_000640293.1.58443 WP_000640293.1.58486 WP_000640293.1.58489 WP_000640293.1.5854 WP_000640293.1.58548 WP_000640293.1.5858 WP_000640293.1.58662 WP_000640293.1.58669 WP_000640293.1.58675 WP_000640293.1.587 WP_000640293.1.58745 WP_000640293.1.58803 WP_000640293.1.58836 WP_000640293.1.5886 WP_000640293.1.58884 WP_000640293.1.58926 WP_000640293.1.59094 WP_000640293.1.59136 WP_000640293.1.59142 WP_000640293.1.59163 WP_000640293.1.59224 WP_000640293.1.59321 WP_000640293.1.59375 WP_000640293.1.59427 WP_000640293.1.59458 WP_000640293.1.59490 WP_000640293.1.59508 WP_000640293.1.5953 WP_000640293.1.59538 WP_000640293.1.59548 WP_000640293.1.59646 WP_000640293.1.59684 WP_000640293.1.59694 WP_000640293.1.59848 WP_000640293.1.59953 WP_000640293.1.60008 WP_000640293.1.60021 WP_000640293.1.60069 WP_000640293.1.60126 WP_000640293.1.60137 WP_000640293.1.60140 WP_000640293.1.60155 WP_000640293.1.60285 WP_000640293.1.60320 WP_000640293.1.6033 WP_000640293.1.60379 WP_000640293.1.60425 WP_000640293.1.60464 WP_000640293.1.60560 WP_000640293.1.60713 WP_000640293.1.60794 WP_000640293.1.608 WP_000640293.1.60866 WP_000640293.1.60874 WP_000640293.1.60897 WP_000640293.1.60941 WP_000640293.1.61078 WP_000640293.1.6114 WP_000640293.1.61232 WP_000640293.1.6129 WP_000640293.1.61296 WP_000640293.1.61345 WP_000640293.1.61356 WP_000640293.1.61381 WP_000640293.1.61417 WP_000640293.1.61501 WP_000640293.1.61519 WP_000640293.1.61574 WP_000640293.1.61594 WP_000640293.1.61595 WP_000640293.1.61609 WP_000640293.1.61662 WP_000640293.1.61671 WP_000640293.1.61712 WP_000640293.1.61730 WP_000640293.1.61857 WP_000640293.1.61908 WP_000640293.1.61918 WP_000640293.1.61952 WP_000640293.1.62007 WP_000640293.1.62025 WP_000640293.1.62158 WP_000640293.1.62201 WP_000640293.1.62204 WP_000640293.1.62210 WP_000640293.1.62304 WP_000640293.1.62364 WP_000640293.1.62374 WP_000640293.1.62403 WP_000640293.1.62412 WP_000640293.1.6253 WP_000640293.1.62570 WP_000640293.1.627 WP_000640293.1.62745 WP_000640293.1.62757 WP_000640293.1.62853 WP_000640293.1.62903 WP_000640293.1.62910 WP_000640293.1.6292 WP_000640293.1.62955 WP_000640293.1.62983 WP_000640293.1.62988 WP_000640293.1.63045 WP_000640293.1.63063 WP_000640293.1.63102 WP_000640293.1.63181 WP_000640293.1.63203 WP_000640293.1.63229 WP_000640293.1.63243 WP_000640293.1.63256 WP_000640293.1.63290 WP_000640293.1.63358 WP_000640293.1.63382 WP_000640293.1.63432 WP_000640293.1.63461 WP_000640293.1.63479 WP_000640293.1.63497 WP_000640293.1.63509 WP_000640293.1.63529 WP_000640293.1.63577 WP_000640293.1.63585 WP_000640293.1.63603 WP_000640293.1.63664 WP_000640293.1.6370 WP_000640293.1.63718 WP_000640293.1.63731 WP_000640293.1.63748 WP_000640293.1.6375 WP_000640293.1.63757 WP_000640293.1.63834 WP_000640293.1.63851 WP_000640293.1.63863 WP_000640293.1.64010 WP_000640293.1.64046 WP_000640293.1.64072 WP_000640293.1.64085 WP_000640293.1.64109 WP_000640293.1.64157 WP_000640293.1.64208 WP_000640293.1.64229 WP_000640293.1.6423 WP_000640293.1.64244 WP_000640293.1.64350 WP_000640293.1.64385 WP_000640293.1.64403 WP_000640293.1.64462 WP_000640293.1.64500 WP_000640293.1.64597 WP_000640293.1.64645 WP_000640293.1.64649 WP_000640293.1.64702 WP_000640293.1.64711 WP_000640293.1.64757 WP_000640293.1.64781 WP_000640293.1.64831 WP_000640293.1.6489 WP_000640293.1.65011 WP_000640293.1.65018 WP_000640293.1.65028 WP_000640293.1.65168 WP_000640293.1.65171 WP_000640293.1.65238 WP_000640293.1.65248 WP_000640293.1.6535 WP_000640293.1.65357 WP_000640293.1.65474 WP_000640293.1.65508 WP_000640293.1.65572 WP_000640293.1.65601 WP_000640293.1.65633 WP_000640293.1.6565 WP_000640293.1.65696 WP_000640293.1.65698 WP_000640293.1.6575 WP_000640293.1.65771 WP_000640293.1.65782 WP_000640293.1.65881 WP_000640293.1.65883 WP_000640293.1.65901 WP_000640293.1.6595 WP_000640293.1.66129 WP_000640293.1.66171 WP_000640293.1.6630 WP_000640293.1.66314 WP_000640293.1.66315 WP_000640293.1.66358 WP_000640293.1.66362 WP_000640293.1.66365 WP_000640293.1.6638 WP_000640293.1.66385 WP_000640293.1.6640 WP_000640293.1.66400 WP_000640293.1.66428 WP_000640293.1.66446 WP_000640293.1.66539 WP_000640293.1.66600 WP_000640293.1.66698 WP_000640293.1.66733 WP_000640293.1.6680 WP_000640293.1.66834 WP_000640293.1.66901 WP_000640293.1.66959 WP_000640293.1.66962 WP_000640293.1.67037 WP_000640293.1.67045 WP_000640293.1.67075 WP_000640293.1.6710 WP_000640293.1.67173 WP_000640293.1.67181 WP_000640293.1.67268 WP_000640293.1.67279 WP_000640293.1.67347 WP_000640293.1.67552 WP_000640293.1.6760 WP_000640293.1.67682 WP_000640293.1.6782 WP_000640293.1.67887 WP_000640293.1.67932 WP_000640293.1.68073 WP_000640293.1.68140 WP_000640293.1.68159 WP_000640293.1.68201 WP_000640293.1.68206 WP_000640293.1.6827 WP_000640293.1.68275 WP_000640293.1.6849 WP_000640293.1.68547 WP_000640293.1.6857 WP_000640293.1.68589 WP_000640293.1.68591 WP_000640293.1.68652 WP_000640293.1.68655 WP_000640293.1.68656 WP_000640293.1.68677 WP_000640293.1.68778 WP_000640293.1.68787 WP_000640293.1.68893 WP_000640293.1.68894 WP_000640293.1.68895 WP_000640293.1.68928 WP_000640293.1.68966 WP_000640293.1.68975 WP_000640293.1.69006 WP_000640293.1.69029 WP_000640293.1.69080 WP_000640293.1.69086 WP_000640293.1.6913 WP_000640293.1.69131 WP_000640293.1.69146 WP_000640293.1.69236 WP_000640293.1.69255 WP_000640293.1.69273 WP_000640293.1.69320 WP_000640293.1.69357 WP_000640293.1.69397 WP_000640293.1.69485 WP_000640293.1.69564 WP_000640293.1.69575 WP_000640293.1.69616 WP_000640293.1.69644 WP_000640293.1.69704 WP_000640293.1.69767 WP_000640293.1.69787 WP_000640293.1.69807 WP_000640293.1.69965 WP_000640293.1.69977 WP_000640293.1.70088 WP_000640293.1.7021 WP_000640293.1.70241 WP_000640293.1.70269 WP_000640293.1.70272 WP_000640293.1.70289 WP_000640293.1.70440 WP_000640293.1.70447 WP_000640293.1.70485 WP_000640293.1.70531 WP_000640293.1.70596 WP_000640293.1.70643 WP_000640293.1.70678 WP_000640293.1.70683 WP_000640293.1.70785 WP_000640293.1.70837 WP_000640293.1.70883 WP_000640293.1.70922 WP_000640293.1.70948 WP_000640293.1.70985 WP_000640293.1.71116 WP_000640293.1.71146 WP_000640293.1.71165 WP_000640293.1.71172 WP_000640293.1.71184 WP_000640293.1.71188 WP_000640293.1.71201 WP_000640293.1.71202 WP_000640293.1.71305 WP_000640293.1.71306 WP_000640293.1.71337 WP_000640293.1.71368 WP_000640293.1.71378 WP_000640293.1.71401 WP_000640293.1.71481 WP_000640293.1.71626 WP_000640293.1.71649 WP_000640293.1.71691 WP_000640293.1.71702 WP_000640293.1.71750 WP_000640293.1.71845 WP_000640293.1.71881 WP_000640293.1.71908 WP_000640293.1.71929 WP_000640293.1.71952 WP_000640293.1.71973 WP_000640293.1.71979 WP_000640293.1.71984 WP_000640293.1.720 WP_000640293.1.72100 WP_000640293.1.72105 WP_000640293.1.72119 WP_000640293.1.72190 WP_000640293.1.72203 WP_000640293.1.72221 WP_000640293.1.72234 WP_000640293.1.72281 WP_000640293.1.72300 WP_000640293.1.72325 WP_000640293.1.72339 WP_000640293.1.72372 WP_000640293.1.72376 WP_000640293.1.72532 WP_000640293.1.72594 WP_000640293.1.72602 WP_000640293.1.72629 WP_000640293.1.72716 WP_000640293.1.72718 WP_000640293.1.72865 WP_000640293.1.72871 WP_000640293.1.72897 WP_000640293.1.7295 WP_000640293.1.72975 WP_000640293.1.73062 WP_000640293.1.73068 WP_000640293.1.7315 WP_000640293.1.73200 WP_000640293.1.7334 WP_000640293.1.73377 WP_000640293.1.73481 WP_000640293.1.7356 WP_000640293.1.73561 WP_000640293.1.73581 WP_000640293.1.73617 WP_000640293.1.73667 WP_000640293.1.73669 WP_000640293.1.73708 WP_000640293.1.73753 WP_000640293.1.73758 WP_000640293.1.73794 WP_000640293.1.73804 WP_000640293.1.7387 WP_000640293.1.73924 WP_000640293.1.73926 WP_000640293.1.73956 WP_000640293.1.74029 WP_000640293.1.74174 WP_000640293.1.74181 WP_000640293.1.74191 WP_000640293.1.74207 WP_000640293.1.74248 WP_000640293.1.743 WP_000640293.1.74300 WP_000640293.1.7433 WP_000640293.1.74379 WP_000640293.1.74410 WP_000640293.1.74414 WP_000640293.1.74422 WP_000640293.1.74466 WP_000640293.1.74481 WP_000640293.1.74529 WP_000640293.1.74545 WP_000640293.1.74578 WP_000640293.1.74745 WP_000640293.1.74972 WP_000640293.1.75051 WP_000640293.1.75056 WP_000640293.1.75129 WP_000640293.1.75148 WP_000640293.1.75159 WP_000640293.1.75187 WP_000640293.1.75288 WP_000640293.1.75334 WP_000640293.1.75362 WP_000640293.1.75385 WP_000640293.1.75392 WP_000640293.1.75400 WP_000640293.1.75450 WP_000640293.1.7558 WP_000640293.1.75607 WP_000640293.1.75716 WP_000640293.1.75751 WP_000640293.1.75760 WP_000640293.1.75764 WP_000640293.1.75794 WP_000640293.1.75810 WP_000640293.1.75828 WP_000640293.1.75837 WP_000640293.1.75863 WP_000640293.1.75874 WP_000640293.1.75884 WP_000640293.1.75902 WP_000640293.1.75957 WP_000640293.1.76020 WP_000640293.1.76024 WP_000640293.1.76108 WP_000640293.1.76137 WP_000640293.1.76252 WP_000640293.1.76345 WP_000640293.1.76445 WP_000640293.1.76451 WP_000640293.1.76495 WP_000640293.1.7660 WP_000640293.1.76673 WP_000640293.1.76706 WP_000640293.1.76721 WP_000640293.1.76724 WP_000640293.1.76760 WP_000640293.1.76776 WP_000640293.1.76866 WP_000640293.1.76875 WP_000640293.1.76880 WP_000640293.1.76899 WP_000640293.1.76913 WP_000640293.1.76968 WP_000640293.1.77017 WP_000640293.1.77038 WP_000640293.1.77047 WP_000640293.1.77080 WP_000640293.1.7712 WP_000640293.1.77180 WP_000640293.1.77193 WP_000640293.1.77244 WP_000640293.1.77292 WP_000640293.1.77306 WP_000640293.1.77349 WP_000640293.1.77356 WP_000640293.1.77475 WP_000640293.1.77496 WP_000640293.1.77514 WP_000640293.1.77529 WP_000640293.1.77549 WP_000640293.1.77692 WP_000640293.1.7782 WP_000640293.1.77851 WP_000640293.1.77871 WP_000640293.1.77898 WP_000640293.1.77918 WP_000640293.1.7792 WP_000640293.1.7793 WP_000640293.1.77951 WP_000640293.1.77960 WP_000640293.1.77971 WP_000640293.1.77983 WP_000640293.1.77989 WP_000640293.1.78 WP_000640293.1.7802 WP_000640293.1.78033 WP_000640293.1.78051 WP_000640293.1.78076 WP_000640293.1.78096 WP_000640293.1.78100 WP_000640293.1.78110 WP_000640293.1.78120 WP_000640293.1.78383 WP_000640293.1.78407 WP_000640293.1.78501 WP_000640293.1.78603 WP_000640293.1.7861 WP_000640293.1.78618 WP_000640293.1.78632 WP_000640293.1.78658 WP_000640293.1.78673 WP_000640293.1.78697 WP_000640293.1.78734 WP_000640293.1.78735 WP_000640293.1.7877 WP_000640293.1.78802 WP_000640293.1.78815 WP_000640293.1.78830 WP_000640293.1.78835 WP_000640293.1.78862 WP_000640293.1.78871 WP_000640293.1.78874 WP_000640293.1.78877 WP_000640293.1.78896 WP_000640293.1.7891 WP_000640293.1.78918 WP_000640293.1.78930 WP_000640293.1.79099 WP_000640293.1.79151 WP_000640293.1.79167 WP_000640293.1.79289 WP_000640293.1.79335 WP_000640293.1.794 WP_000640293.1.79462 WP_000640293.1.79468 WP_000640293.1.79472 WP_000640293.1.79490 WP_000640293.1.79495 WP_000640293.1.79529 WP_000640293.1.79570 WP_000640293.1.79580 WP_000640293.1.79586 WP_000640293.1.7964 WP_000640293.1.79642 WP_000640293.1.79659 WP_000640293.1.79668 WP_000640293.1.79708 WP_000640293.1.79738 WP_000640293.1.7982 WP_000640293.1.79832 WP_000640293.1.79845 WP_000640293.1.7994 WP_000640293.1.79996 WP_000640293.1.80077 WP_000640293.1.80137 WP_000640293.1.80182 WP_000640293.1.80249 WP_000640293.1.80254 WP_000640293.1.80296 WP_000640293.1.80366 WP_000640293.1.80380 WP_000640293.1.80448 WP_000640293.1.80757 WP_000640293.1.80760 WP_000640293.1.80780 WP_000640293.1.80831 WP_000640293.1.80850 WP_000640293.1.80874 WP_000640293.1.80876 WP_000640293.1.80881 WP_000640293.1.80939 WP_000640293.1.8096 WP_000640293.1.81037 WP_000640293.1.8106 WP_000640293.1.81069 WP_000640293.1.81109 WP_000640293.1.81110 WP_000640293.1.81149 WP_000640293.1.81175 WP_000640293.1.8119 WP_000640293.1.81193 WP_000640293.1.81197 WP_000640293.1.81225 WP_000640293.1.8130 WP_000640293.1.8134 WP_000640293.1.81354 WP_000640293.1.81388 WP_000640293.1.81404 WP_000640293.1.81410 WP_000640293.1.81425 WP_000640293.1.81668 WP_000640293.1.81750 WP_000640293.1.81768 WP_000640293.1.81785 WP_000640293.1.81902 WP_000640293.1.81941 WP_000640293.1.81974 WP_000640293.1.82099 WP_000640293.1.82149 WP_000640293.1.82337 WP_000640293.1.82401 WP_000640293.1.82420 WP_000640293.1.82434 WP_000640293.1.8247 WP_000640293.1.82474 WP_000640293.1.82479 WP_000640293.1.82503 WP_000640293.1.82515 WP_000640293.1.82569 WP_000640293.1.82676 WP_000640293.1.82761 WP_000640293.1.8282 WP_000640293.1.82944 WP_000640293.1.82964 WP_000640293.1.83005 WP_000640293.1.83006 WP_000640293.1.83092 WP_000640293.1.83163 WP_000640293.1.83204 WP_000640293.1.83305 WP_000640293.1.83331 WP_000640293.1.83354 WP_000640293.1.83356 WP_000640293.1.83365 WP_000640293.1.83413 WP_000640293.1.83491 WP_000640293.1.83523 WP_000640293.1.8354 WP_000640293.1.83558 WP_000640293.1.83651 WP_000640293.1.83721 WP_000640293.1.83760 WP_000640293.1.8399 WP_000640293.1.83995 WP_000640293.1.84000 WP_000640293.1.84011 WP_000640293.1.84075 WP_000640293.1.84077 WP_000640293.1.84083 WP_000640293.1.84086 WP_000640293.1.84103 WP_000640293.1.84154 WP_000640293.1.84283 WP_000640293.1.84300 WP_000640293.1.84392 WP_000640293.1.8441 WP_000640293.1.84459 WP_000640293.1.84497 WP_000640293.1.84515 WP_000640293.1.84532 WP_000640293.1.84554 WP_000640293.1.84572 WP_000640293.1.84598 WP_000640293.1.84644 WP_000640293.1.84659 WP_000640293.1.84693 WP_000640293.1.84876 WP_000640293.1.84899 WP_000640293.1.8497 WP_000640293.1.84983 WP_000640293.1.85040 WP_000640293.1.85079 WP_000640293.1.85134 WP_000640293.1.85178 WP_000640293.1.85180 WP_000640293.1.85190 WP_000640293.1.8526 WP_000640293.1.85271 WP_000640293.1.85301 WP_000640293.1.8533 WP_000640293.1.8537 WP_000640293.1.8545 WP_000640293.1.85456 WP_000640293.1.85481 WP_000640293.1.85483 WP_000640293.1.85541 WP_000640293.1.8556 WP_000640293.1.85615 WP_000640293.1.85617 WP_000640293.1.85663 WP_000640293.1.85671 WP_000640293.1.85672 WP_000640293.1.85759 WP_000640293.1.85777 WP_000640293.1.85780 WP_000640293.1.85855 WP_000640293.1.85886 WP_000640293.1.85900 WP_000640293.1.85904 WP_000640293.1.85976 WP_000640293.1.85982 WP_000640293.1.86138 WP_000640293.1.86157 WP_000640293.1.8616 WP_000640293.1.86224 WP_000640293.1.86285 WP_000640293.1.86306 WP_000640293.1.86347 WP_000640293.1.86356 WP_000640293.1.86380 WP_000640293.1.86450 WP_000640293.1.86469 WP_000640293.1.8647 WP_000640293.1.86514 WP_000640293.1.86580 WP_000640293.1.86588 WP_000640293.1.86593 WP_000640293.1.86610 WP_000640293.1.86661 WP_000640293.1.8672 WP_000640293.1.8678 WP_000640293.1.86810 WP_000640293.1.8684 WP_000640293.1.86895 WP_000640293.1.86906 WP_000640293.1.86915 WP_000640293.1.87038 WP_000640293.1.87051 WP_000640293.1.87095 WP_000640293.1.87187 WP_000640293.1.87265 WP_000640293.1.87323 WP_000640293.1.8736 WP_000640293.1.87365 WP_000640293.1.87460 WP_000640293.1.87484 WP_000640293.1.87500 WP_000640293.1.87552 WP_000640293.1.87583 WP_000640293.1.87712 WP_000640293.1.87779 WP_000640293.1.87905 WP_000640293.1.87945 WP_000640293.1.88019 WP_000640293.1.88052 WP_000640293.1.88073 WP_000640293.1.8809 WP_000640293.1.88185 WP_000640293.1.88275 WP_000640293.1.88291 WP_000640293.1.88293 WP_000640293.1.88356 WP_000640293.1.8837 WP_000640293.1.88393 WP_000640293.1.88474 WP_000640293.1.8849 WP_000640293.1.88508 WP_000640293.1.88703 WP_000640293.1.88731 WP_000640293.1.88792 WP_000640293.1.88854 WP_000640293.1.88902 WP_000640293.1.8891 WP_000640293.1.88966 WP_000640293.1.88967 WP_000640293.1.88968 WP_000640293.1.88981 WP_000640293.1.88998 WP_000640293.1.89008 WP_000640293.1.89116 WP_000640293.1.89120 WP_000640293.1.89138 WP_000640293.1.89177 WP_000640293.1.89221 WP_000640293.1.89304 WP_000640293.1.89362 WP_000640293.1.89408 WP_000640293.1.89425 WP_000640293.1.89512 WP_000640293.1.89527 WP_000640293.1.89570 WP_000640293.1.89604 WP_000640293.1.89606 WP_000640293.1.8961 WP_000640293.1.89622 WP_000640293.1.89634 WP_000640293.1.89659 WP_000640293.1.89680 WP_000640293.1.89789 WP_000640293.1.89832 WP_000640293.1.89870 WP_000640293.1.89902 WP_000640293.1.8996 WP_000640293.1.9003 WP_000640293.1.90097 WP_000640293.1.90252 WP_000640293.1.90417 WP_000640293.1.90421 WP_000640293.1.90440 WP_000640293.1.90453 WP_000640293.1.90458 WP_000640293.1.90522 WP_000640293.1.90540 WP_000640293.1.90557 WP_000640293.1.90563 WP_000640293.1.90585 WP_000640293.1.9064 WP_000640293.1.90641 WP_000640293.1.90734 WP_000640293.1.90748 WP_000640293.1.90759 WP_000640293.1.90814 WP_000640293.1.90859 WP_000640293.1.9093 WP_000640293.1.90959 WP_000640293.1.90973 WP_000640293.1.90983 WP_000640293.1.91003 WP_000640293.1.91069 WP_000640293.1.91156 WP_000640293.1.91215 WP_000640293.1.91278 WP_000640293.1.9131 WP_000640293.1.9137 WP_000640293.1.91372 WP_000640293.1.91424 WP_000640293.1.91474 WP_000640293.1.91505 WP_000640293.1.91512 WP_000640293.1.91524 WP_000640293.1.91564 WP_000640293.1.91628 WP_000640293.1.91655 WP_000640293.1.91724 WP_000640293.1.91732 WP_000640293.1.91742 WP_000640293.1.91772 WP_000640293.1.91776 WP_000640293.1.91788 WP_000640293.1.91795 WP_000640293.1.91898 WP_000640293.1.91904 WP_000640293.1.91974 WP_000640293.1.92013 WP_000640293.1.92060 WP_000640293.1.92082 WP_000640293.1.92093 WP_000640293.1.92108 WP_000640293.1.92122 WP_000640293.1.92129 WP_000640293.1.92171 WP_000640293.1.92183 WP_000640293.1.92208 WP_000640293.1.9222 WP_000640293.1.92268 WP_000640293.1.92310 WP_000640293.1.92318 WP_000640293.1.92408 WP_000640293.1.92443 WP_000640293.1.92452 WP_000640293.1.92482 WP_000640293.1.92531 WP_000640293.1.92557 WP_000640293.1.92628 WP_000640293.1.92669 WP_000640293.1.92671 WP_000640293.1.92738 WP_000640293.1.92806 WP_000640293.1.92832 WP_000640293.1.92890 WP_000640293.1.92929 WP_000640293.1.93076 WP_000640293.1.93086 WP_000640293.1.93101 WP_000640293.1.93136 WP_000640293.1.93155 WP_000640293.1.93215 WP_000640293.1.93275 WP_000640293.1.93350 WP_000640293.1.93365 WP_000640293.1.93376 WP_000640293.1.93524 WP_000640293.1.93543 WP_000640293.1.93577 WP_000640293.1.93650 WP_000640293.1.93656 WP_000640293.1.93662 WP_000640293.1.937 WP_000640293.1.93705 WP_000640293.1.93741 WP_000640293.1.9380 WP_000640293.1.93804 WP_000640293.1.93809 WP_000640293.1.9389 WP_000640293.1.93994 WP_000640293.1.94072 WP_000640293.1.94162 WP_000640293.1.94168 WP_000640293.1.94198 WP_000640293.1.94354 WP_000640293.1.94380 WP_000640293.1.9440 WP_000640293.1.94458 WP_000640293.1.94473 WP_000640293.1.94565 WP_000640293.1.94584 WP_000640293.1.94598 WP_000640293.1.94622 WP_000640293.1.94649 WP_000640293.1.94670 WP_000640293.1.94674 WP_000640293.1.94796 WP_000640293.1.9481 WP_000640293.1.94835 WP_000640293.1.94959 WP_000640293.1.94967 WP_000640293.1.95051 WP_000640293.1.95085 WP_000640293.1.95121 WP_000640293.1.95136 WP_000640293.1.95249 WP_000640293.1.9527 WP_000640293.1.95282 WP_000640293.1.9530 WP_000640293.1.95434 WP_000640293.1.95447 WP_000640293.1.95456 WP_000640293.1.95546 WP_000640293.1.95607 WP_000640293.1.95630 WP_000640293.1.95656 WP_000640293.1.95703 WP_000640293.1.95757 WP_000640293.1.9586 WP_000640293.1.95866 WP_000640293.1.95911 WP_000640293.1.95963 WP_000640293.1.96107 WP_000640293.1.96139 WP_000640293.1.96172 WP_000640293.1.9624 WP_000640293.1.96260 WP_000640293.1.96317 WP_000640293.1.96340 WP_000640293.1.96343 WP_000640293.1.96348 WP_000640293.1.96349 WP_000640293.1.96380 WP_000640293.1.9644 WP_000640293.1.96469 WP_000640293.1.96497 WP_000640293.1.96500 WP_000640293.1.96521 WP_000640293.1.96537 WP_000640293.1.96555 WP_000640293.1.96563 WP_000640293.1.96588 WP_000640293.1.96732 WP_000640293.1.96735 WP_000640293.1.96771 WP_000640293.1.96876 WP_000640293.1.96902 WP_000640293.1.96993 WP_000640293.1.97015 WP_000640293.1.97103 WP_000640293.1.97145 WP_000640293.1.97190 WP_000640293.1.97318 WP_000640293.1.97322 WP_000640293.1.97328 WP_000640293.1.97369 WP_000640293.1.97547 WP_000640293.1.97594 WP_000640293.1.97597 WP_000640293.1.97613 WP_000640293.1.97620 WP_000640293.1.97640 WP_000640293.1.97648 WP_000640293.1.97656 WP_000640293.1.97704 WP_000640293.1.97726 WP_000640293.1.97727 WP_000640293.1.97732 WP_000640293.1.97736 WP_000640293.1.9774 WP_000640293.1.9775 WP_000640293.1.97846 WP_000640293.1.97873 WP_000640293.1.9793 WP_000640293.1.97981 WP_000640293.1.97991 WP_000640293.1.98006 WP_000640293.1.98019 WP_000640293.1.98022 WP_000640293.1.9805 WP_000640293.1.98110 WP_000640293.1.98119 WP_000640293.1.98124 WP_000640293.1.98146 WP_000640293.1.98219 WP_000640293.1.98338 WP_000640293.1.9841 WP_000640293.1.98440 WP_000640293.1.98446 WP_000640293.1.98472 WP_000640293.1.98495 WP_000640293.1.98531 WP_000640293.1.98570 WP_000640293.1.98577 WP_000640293.1.98676 WP_000640293.1.98677 WP_000640293.1.98726 WP_000640293.1.98760 WP_000640293.1.98843 WP_000640293.1.9898 WP_000640293.1.9899 WP_000640293.1.99057 WP_000640293.1.99072 WP_000640293.1.99097 WP_000640293.1.99098 WP_000640293.1.99164 WP_000640293.1.99184 WP_000640293.1.99215 WP_000640293.1.99267 WP_000640293.1.99276 WP_000640293.1.99456 WP_000640293.1.99490 WP_000640293.1.99493 WP_000640293.1.99561 WP_000640293.1.99613 WP_000640293.1.99630 WP_000640293.1.99646 WP_000640293.1.99657 WP_000640293.1.99660 WP_000640293.1.99712 WP_000640293.1.99813 WP_000640293.1.99858 WP_000640293.1.99889 WP_000640293.1.99924 WP_000640293.1.99958 WP_000640293.1.99961 gi|538363027|ref|YP_008506312.1| ABAM02000001|CDS_2981341-2982339 ABAO01000020|CDS_65135-66133 ABFG01000004|CDS_213071-212073 AE006468|CDS_2522220-2523218 AM933172|CDS_2521274-2522272 AM933173|CDS_2512179-2513177 CP001363|CDS_2573772-2574770 FN424405|CDS_2545886-2546884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]