SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451243|ref|YP_005238602.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451243|ref|YP_005238602.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.25e-23
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451243|ref|YP_005238602.1|
Sequence length 118
Comment putative transposase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MYLAVVVDLFSCKVIGWSMQPRMTKDIVLNALLMAVWRRHPQKQVLVQSDQGSQYTRYEW
LKLHGLEGSMSRCGNCHDNAVAESFFQLLKRERIKKKIYQRLRSVQVIRGDSAQIRGI
Download sequence
Identical sequences A0A0F6B4R5 A0A0H3NPM0 A0A2D3AEP0 E8XGJ8 Q8ZN61
gi|379701738|ref|YP_005243466.1| gi|378985067|ref|YP_005248222.1| gi|378700411|ref|YP_005182368.1| ABAM02000001|CDS_3080406-3080050 ABAO01000009|CDS_90206-89850 AE006468|CDS_2622648-2622292 CP001363|CDS_2674200-2673844 FN424405|CDS_2647027-2646671 gi|378451243|ref|YP_005238602.1| gi|482904318|ref|YP_007902878.1| APC24581 99287.STM2509 NP_461444.1.58477 gi|16765829|ref|NP_461444.1| gi|549725157|ref|YP_008645347.1| gi|550901935|ref|YP_008671027.1| gi|378445927|ref|YP_005233559.1| gi|378989890|ref|YP_005253054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]