SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451480|ref|YP_005238840.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451480|ref|YP_005238840.1|
Domain Number 1 Region: 32-212
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.55e-24
Family Glucose-6-phosphate isomerase, GPI 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378451480|ref|YP_005238840.1|
Sequence length 280
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MKQLHHSGLPLYLDDDGVMALKPPLNYLGFGRKSAGQMAVVLPEFTEGLRNEPAYDVYRG
LSFAEDQERLAADQYQYDITIIMPGTIGKERKKTSGHYHGYNDTRRNTHPEVYEVIKGTA
AYILQKSPDFAAAPQELVVDDLIVAVVKEGQSIIVPPNYGHCSINIGDGPLVFSNLAYKP
CTVHYDTVQFYHGMACYIVEENGQLCVRKNHYYPRVPRIKFATVKENPHLGITFDMPLYQ
RYRAAPERFHFLGHVDNYVREIMGMLQYEDDLFPLCQEDA
Download sequence
Identical sequences A0A0D3QTA7 A0A0D6FA22 A0A0F6B5F0 A0A0F7J9E5 A0A0H3NQI3 A0A0M0QV21 A0A0T9VZX9 A0A265AYA5 A0A2D3AF86 A0A2H9YEE5 E8XJB7 G4WFM4 Q8ZMP7
gi|378451480|ref|YP_005238840.1| gi|525837305|ref|YP_008254069.1| gi|525818548|ref|YP_008248566.1| gi|379702012|ref|YP_005243740.1| gi|378446121|ref|YP_005233753.1| gi|378700677|ref|YP_005182634.1| gi|194447570|ref|YP_002046715.1| ABAM02000001|CDS_3271497-3270655 ABEL01000028|CDS_9983-9141 AE006468|CDS_2895749-2894907 CP001120|CDS_2870255-2869413 CP001363|CDS_2915974-2915132 FN424405|CDS_2888714-2887872 gi|549725339|ref|YP_008645529.1| 454169.SeHA_C2931 99287.STM2757 NP_461684.1.58477 WP_000811366.1.100010 WP_000811366.1.100234 WP_000811366.1.100376 WP_000811366.1.100424 WP_000811366.1.100436 WP_000811366.1.100484 WP_000811366.1.100488 WP_000811366.1.100730 WP_000811366.1.10076 WP_000811366.1.100781 WP_000811366.1.100793 WP_000811366.1.100869 WP_000811366.1.100871 WP_000811366.1.100882 WP_000811366.1.101020 WP_000811366.1.101074 WP_000811366.1.101078 WP_000811366.1.101180 WP_000811366.1.101259 WP_000811366.1.101284 WP_000811366.1.1013 WP_000811366.1.101353 WP_000811366.1.101386 WP_000811366.1.101420 WP_000811366.1.101589 WP_000811366.1.101734 WP_000811366.1.101953 WP_000811366.1.10220 WP_000811366.1.10231 WP_000811366.1.10266 WP_000811366.1.10429 WP_000811366.1.10439 WP_000811366.1.10566 WP_000811366.1.10678 WP_000811366.1.10753 WP_000811366.1.10992 WP_000811366.1.11024 WP_000811366.1.11031 WP_000811366.1.11098 WP_000811366.1.1110 WP_000811366.1.11156 WP_000811366.1.11168 WP_000811366.1.11190 WP_000811366.1.11295 WP_000811366.1.11455 WP_000811366.1.11518 WP_000811366.1.11532 WP_000811366.1.11543 WP_000811366.1.11588 WP_000811366.1.11677 WP_000811366.1.11687 WP_000811366.1.11735 WP_000811366.1.11763 WP_000811366.1.11834 WP_000811366.1.11897 WP_000811366.1.12017 WP_000811366.1.12114 WP_000811366.1.12351 WP_000811366.1.12370 WP_000811366.1.12546 WP_000811366.1.1264 WP_000811366.1.12728 WP_000811366.1.12879 WP_000811366.1.12936 WP_000811366.1.12995 WP_000811366.1.13027 WP_000811366.1.13106 WP_000811366.1.13130 WP_000811366.1.13207 WP_000811366.1.13414 WP_000811366.1.13488 WP_000811366.1.13509 WP_000811366.1.13661 WP_000811366.1.13669 WP_000811366.1.13741 WP_000811366.1.1387 WP_000811366.1.13908 WP_000811366.1.13968 WP_000811366.1.14001 WP_000811366.1.14111 WP_000811366.1.14151 WP_000811366.1.14239 WP_000811366.1.14320 WP_000811366.1.14379 WP_000811366.1.14406 WP_000811366.1.14410 WP_000811366.1.14436 WP_000811366.1.14458 WP_000811366.1.14466 WP_000811366.1.14524 WP_000811366.1.14554 WP_000811366.1.14618 WP_000811366.1.14725 WP_000811366.1.14852 WP_000811366.1.1489 WP_000811366.1.14932 WP_000811366.1.15055 WP_000811366.1.15124 WP_000811366.1.15223 WP_000811366.1.15226 WP_000811366.1.15316 WP_000811366.1.15369 WP_000811366.1.1540 WP_000811366.1.15508 WP_000811366.1.15830 WP_000811366.1.15862 WP_000811366.1.15910 WP_000811366.1.15986 WP_000811366.1.16004 WP_000811366.1.16047 WP_000811366.1.16062 WP_000811366.1.16063 WP_000811366.1.16103 WP_000811366.1.16226 WP_000811366.1.16233 WP_000811366.1.16284 WP_000811366.1.16328 WP_000811366.1.1635 WP_000811366.1.16361 WP_000811366.1.16468 WP_000811366.1.16525 WP_000811366.1.16614 WP_000811366.1.16650 WP_000811366.1.16686 WP_000811366.1.16691 WP_000811366.1.16732 WP_000811366.1.16735 WP_000811366.1.16786 WP_000811366.1.16858 WP_000811366.1.16873 WP_000811366.1.16896 WP_000811366.1.16903 WP_000811366.1.16916 WP_000811366.1.16965 WP_000811366.1.1700 WP_000811366.1.17093 WP_000811366.1.17307 WP_000811366.1.174 WP_000811366.1.17480 WP_000811366.1.17546 WP_000811366.1.17702 WP_000811366.1.17705 WP_000811366.1.17743 WP_000811366.1.17891 WP_000811366.1.1798 WP_000811366.1.18019 WP_000811366.1.18111 WP_000811366.1.18122 WP_000811366.1.18163 WP_000811366.1.1818 WP_000811366.1.18254 WP_000811366.1.18265 WP_000811366.1.18267 WP_000811366.1.18282 WP_000811366.1.18468 WP_000811366.1.18607 WP_000811366.1.18715 WP_000811366.1.18776 WP_000811366.1.18822 WP_000811366.1.18881 WP_000811366.1.18940 WP_000811366.1.18949 WP_000811366.1.19053 WP_000811366.1.19273 WP_000811366.1.19320 WP_000811366.1.19458 WP_000811366.1.19460 WP_000811366.1.19461 WP_000811366.1.19588 WP_000811366.1.19614 WP_000811366.1.19616 WP_000811366.1.19642 WP_000811366.1.19702 WP_000811366.1.19724 WP_000811366.1.19749 WP_000811366.1.19784 WP_000811366.1.19793 WP_000811366.1.19802 WP_000811366.1.19809 WP_000811366.1.19867 WP_000811366.1.19975 WP_000811366.1.20 WP_000811366.1.20212 WP_000811366.1.20266 WP_000811366.1.20271 WP_000811366.1.20362 WP_000811366.1.20418 WP_000811366.1.20443 WP_000811366.1.20446 WP_000811366.1.2054 WP_000811366.1.20553 WP_000811366.1.20614 WP_000811366.1.20626 WP_000811366.1.20646 WP_000811366.1.20908 WP_000811366.1.21049 WP_000811366.1.21136 WP_000811366.1.21146 WP_000811366.1.21245 WP_000811366.1.21246 WP_000811366.1.21269 WP_000811366.1.21351 WP_000811366.1.21400 WP_000811366.1.21497 WP_000811366.1.21499 WP_000811366.1.21603 WP_000811366.1.21751 WP_000811366.1.21757 WP_000811366.1.21991 WP_000811366.1.22024 WP_000811366.1.2205 WP_000811366.1.22062 WP_000811366.1.22067 WP_000811366.1.22235 WP_000811366.1.2235 WP_000811366.1.22379 WP_000811366.1.2246 WP_000811366.1.22485 WP_000811366.1.22620 WP_000811366.1.22692 WP_000811366.1.22758 WP_000811366.1.22864 WP_000811366.1.22870 WP_000811366.1.22979 WP_000811366.1.23102 WP_000811366.1.23114 WP_000811366.1.2314 WP_000811366.1.23192 WP_000811366.1.23259 WP_000811366.1.23379 WP_000811366.1.23460 WP_000811366.1.23472 WP_000811366.1.23482 WP_000811366.1.23509 WP_000811366.1.23634 WP_000811366.1.2364 WP_000811366.1.23932 WP_000811366.1.23959 WP_000811366.1.24017 WP_000811366.1.24082 WP_000811366.1.24206 WP_000811366.1.24308 WP_000811366.1.24578 WP_000811366.1.24737 WP_000811366.1.24779 WP_000811366.1.25008 WP_000811366.1.25119 WP_000811366.1.25405 WP_000811366.1.25454 WP_000811366.1.25493 WP_000811366.1.25690 WP_000811366.1.2570 WP_000811366.1.25740 WP_000811366.1.25793 WP_000811366.1.25814 WP_000811366.1.25988 WP_000811366.1.26282 WP_000811366.1.26311 WP_000811366.1.26429 WP_000811366.1.26440 WP_000811366.1.26493 WP_000811366.1.26551 WP_000811366.1.26567 WP_000811366.1.26741 WP_000811366.1.26919 WP_000811366.1.27010 WP_000811366.1.27084 WP_000811366.1.27173 WP_000811366.1.27206 WP_000811366.1.27223 WP_000811366.1.27423 WP_000811366.1.27544 WP_000811366.1.27561 WP_000811366.1.2763 WP_000811366.1.27665 WP_000811366.1.2777 WP_000811366.1.27857 WP_000811366.1.28032 WP_000811366.1.28170 WP_000811366.1.28302 WP_000811366.1.2835 WP_000811366.1.28370 WP_000811366.1.28538 WP_000811366.1.28575 WP_000811366.1.28625 WP_000811366.1.28655 WP_000811366.1.28694 WP_000811366.1.2879 WP_000811366.1.2890 WP_000811366.1.28938 WP_000811366.1.28946 WP_000811366.1.29006 WP_000811366.1.29010 WP_000811366.1.2910 WP_000811366.1.29113 WP_000811366.1.29509 WP_000811366.1.29588 WP_000811366.1.29601 WP_000811366.1.29606 WP_000811366.1.29615 WP_000811366.1.29619 WP_000811366.1.29704 WP_000811366.1.29827 WP_000811366.1.29969 WP_000811366.1.29990 WP_000811366.1.30006 WP_000811366.1.30022 WP_000811366.1.30180 WP_000811366.1.30202 WP_000811366.1.30469 WP_000811366.1.30507 WP_000811366.1.30535 WP_000811366.1.30547 WP_000811366.1.30794 WP_000811366.1.30833 WP_000811366.1.30835 WP_000811366.1.30972 WP_000811366.1.31 WP_000811366.1.31092 WP_000811366.1.31122 WP_000811366.1.3113 WP_000811366.1.31185 WP_000811366.1.3119 WP_000811366.1.31190 WP_000811366.1.31195 WP_000811366.1.31196 WP_000811366.1.31281 WP_000811366.1.31362 WP_000811366.1.31451 WP_000811366.1.31515 WP_000811366.1.31578 WP_000811366.1.31658 WP_000811366.1.31940 WP_000811366.1.31967 WP_000811366.1.31972 WP_000811366.1.32192 WP_000811366.1.32206 WP_000811366.1.32260 WP_000811366.1.32515 WP_000811366.1.32527 WP_000811366.1.32660 WP_000811366.1.32714 WP_000811366.1.32786 WP_000811366.1.32804 WP_000811366.1.32907 WP_000811366.1.33030 WP_000811366.1.33127 WP_000811366.1.33143 WP_000811366.1.33248 WP_000811366.1.33261 WP_000811366.1.333 WP_000811366.1.33492 WP_000811366.1.33553 WP_000811366.1.33580 WP_000811366.1.33592 WP_000811366.1.33894 WP_000811366.1.3394 WP_000811366.1.34043 WP_000811366.1.34075 WP_000811366.1.34257 WP_000811366.1.34319 WP_000811366.1.34417 WP_000811366.1.34453 WP_000811366.1.34610 WP_000811366.1.34856 WP_000811366.1.34975 WP_000811366.1.35045 WP_000811366.1.35129 WP_000811366.1.35184 WP_000811366.1.35193 WP_000811366.1.35404 WP_000811366.1.35425 WP_000811366.1.35429 WP_000811366.1.35446 WP_000811366.1.35463 WP_000811366.1.35503 WP_000811366.1.35509 WP_000811366.1.35590 WP_000811366.1.35892 WP_000811366.1.35940 WP_000811366.1.36003 WP_000811366.1.3601 WP_000811366.1.36017 WP_000811366.1.36547 WP_000811366.1.36609 WP_000811366.1.36690 WP_000811366.1.3670 WP_000811366.1.36705 WP_000811366.1.36918 WP_000811366.1.36931 WP_000811366.1.37073 WP_000811366.1.37111 WP_000811366.1.37112 WP_000811366.1.37293 WP_000811366.1.37370 WP_000811366.1.37376 WP_000811366.1.3744 WP_000811366.1.37498 WP_000811366.1.37504 WP_000811366.1.37618 WP_000811366.1.37968 WP_000811366.1.37978 WP_000811366.1.38125 WP_000811366.1.38145 WP_000811366.1.383 WP_000811366.1.38393 WP_000811366.1.38569 WP_000811366.1.38613 WP_000811366.1.38673 WP_000811366.1.38693 WP_000811366.1.38773 WP_000811366.1.38781 WP_000811366.1.38882 WP_000811366.1.38913 WP_000811366.1.39003 WP_000811366.1.39082 WP_000811366.1.39136 WP_000811366.1.39197 WP_000811366.1.39229 WP_000811366.1.39265 WP_000811366.1.39405 WP_000811366.1.39420 WP_000811366.1.39449 WP_000811366.1.39512 WP_000811366.1.39584 WP_000811366.1.39629 WP_000811366.1.39724 WP_000811366.1.39763 WP_000811366.1.39862 WP_000811366.1.39921 WP_000811366.1.39923 WP_000811366.1.40072 WP_000811366.1.40073 WP_000811366.1.4011 WP_000811366.1.40208 WP_000811366.1.40240 WP_000811366.1.40292 WP_000811366.1.40305 WP_000811366.1.40311 WP_000811366.1.40341 WP_000811366.1.40380 WP_000811366.1.40395 WP_000811366.1.40465 WP_000811366.1.40710 WP_000811366.1.40877 WP_000811366.1.40996 WP_000811366.1.41018 WP_000811366.1.41086 WP_000811366.1.41091 WP_000811366.1.41226 WP_000811366.1.41279 WP_000811366.1.41516 WP_000811366.1.41554 WP_000811366.1.41572 WP_000811366.1.41591 WP_000811366.1.41662 WP_000811366.1.41708 WP_000811366.1.41761 WP_000811366.1.41882 WP_000811366.1.41985 WP_000811366.1.42104 WP_000811366.1.42156 WP_000811366.1.4222 WP_000811366.1.42243 WP_000811366.1.42320 WP_000811366.1.42342 WP_000811366.1.42422 WP_000811366.1.42444 WP_000811366.1.42676 WP_000811366.1.4276 WP_000811366.1.42864 WP_000811366.1.4288 WP_000811366.1.43018 WP_000811366.1.43041 WP_000811366.1.43077 WP_000811366.1.43312 WP_000811366.1.43334 WP_000811366.1.43339 WP_000811366.1.43371 WP_000811366.1.43437 WP_000811366.1.43522 WP_000811366.1.43613 WP_000811366.1.43668 WP_000811366.1.43778 WP_000811366.1.43886 WP_000811366.1.43951 WP_000811366.1.44005 WP_000811366.1.44043 WP_000811366.1.44099 WP_000811366.1.44121 WP_000811366.1.44291 WP_000811366.1.44300 WP_000811366.1.44310 WP_000811366.1.44386 WP_000811366.1.44433 WP_000811366.1.44479 WP_000811366.1.44640 WP_000811366.1.4467 WP_000811366.1.44747 WP_000811366.1.4485 WP_000811366.1.44877 WP_000811366.1.44927 WP_000811366.1.44933 WP_000811366.1.45067 WP_000811366.1.45074 WP_000811366.1.45079 WP_000811366.1.45098 WP_000811366.1.45145 WP_000811366.1.45177 WP_000811366.1.45184 WP_000811366.1.45259 WP_000811366.1.45344 WP_000811366.1.45349 WP_000811366.1.45365 WP_000811366.1.45434 WP_000811366.1.45550 WP_000811366.1.45582 WP_000811366.1.45622 WP_000811366.1.45660 WP_000811366.1.45690 WP_000811366.1.458 WP_000811366.1.45848 WP_000811366.1.46011 WP_000811366.1.46069 WP_000811366.1.46112 WP_000811366.1.46174 WP_000811366.1.46187 WP_000811366.1.46278 WP_000811366.1.46303 WP_000811366.1.46434 WP_000811366.1.46595 WP_000811366.1.46675 WP_000811366.1.46930 WP_000811366.1.47008 WP_000811366.1.47057 WP_000811366.1.47214 WP_000811366.1.47429 WP_000811366.1.47448 WP_000811366.1.4747 WP_000811366.1.47472 WP_000811366.1.47478 WP_000811366.1.47579 WP_000811366.1.47799 WP_000811366.1.48242 WP_000811366.1.48253 WP_000811366.1.483 WP_000811366.1.48367 WP_000811366.1.48377 WP_000811366.1.4853 WP_000811366.1.4885 WP_000811366.1.48876 WP_000811366.1.48894 WP_000811366.1.48919 WP_000811366.1.49084 WP_000811366.1.49113 WP_000811366.1.49155 WP_000811366.1.49204 WP_000811366.1.49239 WP_000811366.1.49256 WP_000811366.1.49290 WP_000811366.1.49340 WP_000811366.1.49366 WP_000811366.1.49490 WP_000811366.1.49515 WP_000811366.1.49572 WP_000811366.1.49686 WP_000811366.1.4979 WP_000811366.1.49803 WP_000811366.1.49805 WP_000811366.1.49929 WP_000811366.1.50080 WP_000811366.1.50161 WP_000811366.1.50211 WP_000811366.1.50404 WP_000811366.1.50676 WP_000811366.1.50774 WP_000811366.1.50804 WP_000811366.1.50808 WP_000811366.1.5088 WP_000811366.1.50908 WP_000811366.1.50941 WP_000811366.1.50999 WP_000811366.1.51014 WP_000811366.1.51022 WP_000811366.1.51066 WP_000811366.1.51179 WP_000811366.1.51182 WP_000811366.1.51186 WP_000811366.1.51224 WP_000811366.1.51487 WP_000811366.1.51488 WP_000811366.1.51634 WP_000811366.1.51686 WP_000811366.1.51756 WP_000811366.1.51831 WP_000811366.1.51911 WP_000811366.1.51932 WP_000811366.1.51989 WP_000811366.1.52121 WP_000811366.1.52170 WP_000811366.1.52336 WP_000811366.1.52346 WP_000811366.1.52353 WP_000811366.1.52361 WP_000811366.1.52653 WP_000811366.1.52656 WP_000811366.1.52692 WP_000811366.1.52743 WP_000811366.1.52857 WP_000811366.1.52866 WP_000811366.1.52898 WP_000811366.1.52915 WP_000811366.1.52949 WP_000811366.1.52985 WP_000811366.1.53190 WP_000811366.1.53272 WP_000811366.1.53406 WP_000811366.1.53466 WP_000811366.1.53529 WP_000811366.1.53543 WP_000811366.1.53757 WP_000811366.1.53812 WP_000811366.1.53905 WP_000811366.1.54033 WP_000811366.1.54075 WP_000811366.1.54196 WP_000811366.1.54209 WP_000811366.1.54271 WP_000811366.1.54319 WP_000811366.1.54364 WP_000811366.1.54526 WP_000811366.1.54644 WP_000811366.1.54662 WP_000811366.1.54722 WP_000811366.1.54749 WP_000811366.1.54764 WP_000811366.1.55008 WP_000811366.1.55152 WP_000811366.1.55156 WP_000811366.1.55285 WP_000811366.1.55325 WP_000811366.1.55430 WP_000811366.1.55475 WP_000811366.1.5560 WP_000811366.1.55647 WP_000811366.1.55768 WP_000811366.1.55782 WP_000811366.1.55796 WP_000811366.1.55973 WP_000811366.1.56002 WP_000811366.1.56012 WP_000811366.1.56105 WP_000811366.1.56238 WP_000811366.1.56244 WP_000811366.1.56304 WP_000811366.1.56414 WP_000811366.1.56438 WP_000811366.1.56559 WP_000811366.1.56560 WP_000811366.1.56597 WP_000811366.1.56614 WP_000811366.1.56660 WP_000811366.1.56682 WP_000811366.1.56875 WP_000811366.1.56877 WP_000811366.1.57168 WP_000811366.1.57187 WP_000811366.1.57356 WP_000811366.1.57377 WP_000811366.1.57418 WP_000811366.1.57433 WP_000811366.1.57515 WP_000811366.1.57529 WP_000811366.1.57576 WP_000811366.1.57601 WP_000811366.1.57607 WP_000811366.1.57763 WP_000811366.1.57862 WP_000811366.1.57890 WP_000811366.1.57891 WP_000811366.1.57978 WP_000811366.1.5801 WP_000811366.1.58041 WP_000811366.1.58358 WP_000811366.1.58407 WP_000811366.1.58418 WP_000811366.1.58548 WP_000811366.1.5858 WP_000811366.1.58662 WP_000811366.1.58669 WP_000811366.1.58745 WP_000811366.1.5886 WP_000811366.1.59094 WP_000811366.1.59224 WP_000811366.1.59321 WP_000811366.1.59375 WP_000811366.1.59420 WP_000811366.1.59458 WP_000811366.1.59490 WP_000811366.1.59508 WP_000811366.1.59684 WP_000811366.1.59694 WP_000811366.1.59771 WP_000811366.1.5979 WP_000811366.1.59953 WP_000811366.1.60008 WP_000811366.1.60021 WP_000811366.1.60069 WP_000811366.1.60140 WP_000811366.1.60155 WP_000811366.1.60285 WP_000811366.1.60379 WP_000811366.1.60464 WP_000811366.1.60545 WP_000811366.1.60561 WP_000811366.1.60772 WP_000811366.1.60874 WP_000811366.1.60941 WP_000811366.1.61078 WP_000811366.1.6114 WP_000811366.1.61232 WP_000811366.1.6129 WP_000811366.1.61296 WP_000811366.1.61345 WP_000811366.1.61417 WP_000811366.1.61574 WP_000811366.1.61609 WP_000811366.1.61712 WP_000811366.1.61714 WP_000811366.1.61730 WP_000811366.1.61857 WP_000811366.1.61918 WP_000811366.1.61952 WP_000811366.1.62007 WP_000811366.1.62020 WP_000811366.1.62025 WP_000811366.1.6209 WP_000811366.1.62204 WP_000811366.1.62257 WP_000811366.1.62304 WP_000811366.1.62364 WP_000811366.1.62374 WP_000811366.1.62403 WP_000811366.1.6253 WP_000811366.1.62903 WP_000811366.1.62910 WP_000811366.1.62955 WP_000811366.1.63181 WP_000811366.1.63203 WP_000811366.1.63256 WP_000811366.1.63290 WP_000811366.1.63382 WP_000811366.1.63432 WP_000811366.1.63479 WP_000811366.1.63577 WP_000811366.1.63664 WP_000811366.1.63718 WP_000811366.1.6375 WP_000811366.1.63757 WP_000811366.1.63797 WP_000811366.1.63834 WP_000811366.1.64018 WP_000811366.1.64046 WP_000811366.1.6423 WP_000811366.1.64244 WP_000811366.1.64387 WP_000811366.1.64649 WP_000811366.1.64702 WP_000811366.1.64757 WP_000811366.1.64781 WP_000811366.1.64831 WP_000811366.1.6489 WP_000811366.1.64894 WP_000811366.1.65018 WP_000811366.1.65028 WP_000811366.1.65171 WP_000811366.1.65248 WP_000811366.1.65269 WP_000811366.1.6535 WP_000811366.1.65474 WP_000811366.1.65633 WP_000811366.1.6565 WP_000811366.1.65696 WP_000811366.1.6575 WP_000811366.1.65782 WP_000811366.1.65940 WP_000811366.1.65956 WP_000811366.1.66049 WP_000811366.1.66314 WP_000811366.1.66330 WP_000811366.1.66358 WP_000811366.1.66362 WP_000811366.1.6638 WP_000811366.1.6640 WP_000811366.1.66678 WP_000811366.1.66698 WP_000811366.1.66834 WP_000811366.1.66901 WP_000811366.1.66962 WP_000811366.1.67045 WP_000811366.1.67100 WP_000811366.1.67181 WP_000811366.1.67235 WP_000811366.1.67268 WP_000811366.1.67347 WP_000811366.1.6739 WP_000811366.1.67465 WP_000811366.1.67682 WP_000811366.1.67829 WP_000811366.1.67887 WP_000811366.1.68073 WP_000811366.1.68201 WP_000811366.1.68206 WP_000811366.1.6827 WP_000811366.1.68275 WP_000811366.1.68401 WP_000811366.1.68477 WP_000811366.1.6849 WP_000811366.1.68547 WP_000811366.1.68589 WP_000811366.1.68655 WP_000811366.1.68656 WP_000811366.1.68778 WP_000811366.1.68787 WP_000811366.1.68894 WP_000811366.1.68928 WP_000811366.1.68975 WP_000811366.1.69001 WP_000811366.1.6904 WP_000811366.1.6913 WP_000811366.1.69146 WP_000811366.1.69151 WP_000811366.1.69255 WP_000811366.1.69359 WP_000811366.1.69397 WP_000811366.1.6954 WP_000811366.1.69564 WP_000811366.1.69644 WP_000811366.1.69704 WP_000811366.1.69758 WP_000811366.1.70241 WP_000811366.1.70269 WP_000811366.1.70289 WP_000811366.1.70447 WP_000811366.1.70643 WP_000811366.1.70683 WP_000811366.1.70883 WP_000811366.1.70922 WP_000811366.1.70948 WP_000811366.1.70959 WP_000811366.1.71023 WP_000811366.1.71116 WP_000811366.1.71146 WP_000811366.1.71165 WP_000811366.1.71188 WP_000811366.1.71202 WP_000811366.1.71243 WP_000811366.1.71248 WP_000811366.1.71306 WP_000811366.1.71337 WP_000811366.1.71363 WP_000811366.1.71378 WP_000811366.1.71401 WP_000811366.1.71636 WP_000811366.1.71702 WP_000811366.1.71750 WP_000811366.1.71798 WP_000811366.1.71845 WP_000811366.1.71881 WP_000811366.1.71908 WP_000811366.1.71952 WP_000811366.1.71973 WP_000811366.1.72105 WP_000811366.1.72203 WP_000811366.1.72403 WP_000811366.1.72594 WP_000811366.1.72728 WP_000811366.1.72871 WP_000811366.1.72975 WP_000811366.1.73125 WP_000811366.1.7315 WP_000811366.1.73200 WP_000811366.1.7334 WP_000811366.1.73377 WP_000811366.1.73461 WP_000811366.1.73481 WP_000811366.1.7356 WP_000811366.1.73561 WP_000811366.1.73581 WP_000811366.1.73617 WP_000811366.1.73753 WP_000811366.1.73758 WP_000811366.1.73794 WP_000811366.1.73847 WP_000811366.1.7387 WP_000811366.1.73924 WP_000811366.1.74029 WP_000811366.1.74181 WP_000811366.1.74191 WP_000811366.1.7433 WP_000811366.1.74410 WP_000811366.1.74466 WP_000811366.1.745 WP_000811366.1.74529 WP_000811366.1.74545 WP_000811366.1.74745 WP_000811366.1.7491 WP_000811366.1.75129 WP_000811366.1.75288 WP_000811366.1.75334 WP_000811366.1.75362 WP_000811366.1.75385 WP_000811366.1.75392 WP_000811366.1.75760 WP_000811366.1.75837 WP_000811366.1.75874 WP_000811366.1.75945 WP_000811366.1.76020 WP_000811366.1.76252 WP_000811366.1.76327 WP_000811366.1.76445 WP_000811366.1.7660 WP_000811366.1.76673 WP_000811366.1.76706 WP_000811366.1.76721 WP_000811366.1.76756 WP_000811366.1.76760 WP_000811366.1.76875 WP_000811366.1.76880 WP_000811366.1.76899 WP_000811366.1.77038 WP_000811366.1.77047 WP_000811366.1.77080 WP_000811366.1.7712 WP_000811366.1.77177 WP_000811366.1.77180 WP_000811366.1.77244 WP_000811366.1.77267 WP_000811366.1.77292 WP_000811366.1.77349 WP_000811366.1.77514 WP_000811366.1.77529 WP_000811366.1.77549 WP_000811366.1.77692 WP_000811366.1.77710 WP_000811366.1.7782 WP_000811366.1.77898 WP_000811366.1.77918 WP_000811366.1.77960 WP_000811366.1.78033 WP_000811366.1.78076 WP_000811366.1.78096 WP_000811366.1.78100 WP_000811366.1.78110 WP_000811366.1.78120 WP_000811366.1.78372 WP_000811366.1.78383 WP_000811366.1.78407 WP_000811366.1.7861 WP_000811366.1.78618 WP_000811366.1.78673 WP_000811366.1.78802 WP_000811366.1.78830 WP_000811366.1.78835 WP_000811366.1.78838 WP_000811366.1.78874 WP_000811366.1.78918 WP_000811366.1.78930 WP_000811366.1.79151 WP_000811366.1.79167 WP_000811366.1.79335 WP_000811366.1.79462 WP_000811366.1.79472 WP_000811366.1.79490 WP_000811366.1.79495 WP_000811366.1.79529 WP_000811366.1.79570 WP_000811366.1.7964 WP_000811366.1.79659 WP_000811366.1.79668 WP_000811366.1.79734 WP_000811366.1.79845 WP_000811366.1.80137 WP_000811366.1.80182 WP_000811366.1.80296 WP_000811366.1.80366 WP_000811366.1.80741 WP_000811366.1.80831 WP_000811366.1.80850 WP_000811366.1.80881 WP_000811366.1.80939 WP_000811366.1.8096 WP_000811366.1.81037 WP_000811366.1.81069 WP_000811366.1.81149 WP_000811366.1.81175 WP_000811366.1.8119 WP_000811366.1.81193 WP_000811366.1.81305 WP_000811366.1.81320 WP_000811366.1.81328 WP_000811366.1.81354 WP_000811366.1.81425 WP_000811366.1.81528 WP_000811366.1.81735 WP_000811366.1.81750 WP_000811366.1.81760 WP_000811366.1.81785 WP_000811366.1.81902 WP_000811366.1.81974 WP_000811366.1.82192 WP_000811366.1.82232 WP_000811366.1.82337 WP_000811366.1.82395 WP_000811366.1.82479 WP_000811366.1.82503 WP_000811366.1.82676 WP_000811366.1.82761 WP_000811366.1.8282 WP_000811366.1.82944 WP_000811366.1.82956 WP_000811366.1.83092 WP_000811366.1.83163 WP_000811366.1.83305 WP_000811366.1.83491 WP_000811366.1.83523 WP_000811366.1.8354 WP_000811366.1.83721 WP_000811366.1.83760 WP_000811366.1.83995 WP_000811366.1.84103 WP_000811366.1.84283 WP_000811366.1.84291 WP_000811366.1.84392 WP_000811366.1.84397 WP_000811366.1.8441 WP_000811366.1.84532 WP_000811366.1.84899 WP_000811366.1.8497 WP_000811366.1.85040 WP_000811366.1.85134 WP_000811366.1.85178 WP_000811366.1.85180 WP_000811366.1.85190 WP_000811366.1.8533 WP_000811366.1.85481 WP_000811366.1.85483 WP_000811366.1.8556 WP_000811366.1.85568 WP_000811366.1.85615 WP_000811366.1.85617 WP_000811366.1.85663 WP_000811366.1.85671 WP_000811366.1.85672 WP_000811366.1.85886 WP_000811366.1.85900 WP_000811366.1.85904 WP_000811366.1.85976 WP_000811366.1.86043 WP_000811366.1.86173 WP_000811366.1.86306 WP_000811366.1.86356 WP_000811366.1.86450 WP_000811366.1.86469 WP_000811366.1.86580 WP_000811366.1.86588 WP_000811366.1.86661 WP_000811366.1.8671 WP_000811366.1.8672 WP_000811366.1.8678 WP_000811366.1.86810 WP_000811366.1.8684 WP_000811366.1.86895 WP_000811366.1.86906 WP_000811366.1.87095 WP_000811366.1.87323 WP_000811366.1.8736 WP_000811366.1.87460 WP_000811366.1.87552 WP_000811366.1.87695 WP_000811366.1.87779 WP_000811366.1.87899 WP_000811366.1.8792 WP_000811366.1.87945 WP_000811366.1.88073 WP_000811366.1.8809 WP_000811366.1.88092 WP_000811366.1.88291 WP_000811366.1.88293 WP_000811366.1.8837 WP_000811366.1.88393 WP_000811366.1.88703 WP_000811366.1.88792 WP_000811366.1.88902 WP_000811366.1.8891 WP_000811366.1.88957 WP_000811366.1.88980 WP_000811366.1.88981 WP_000811366.1.89008 WP_000811366.1.89114 WP_000811366.1.89116 WP_000811366.1.89119 WP_000811366.1.89138 WP_000811366.1.89304 WP_000811366.1.89512 WP_000811366.1.89527 WP_000811366.1.89570 WP_000811366.1.89604 WP_000811366.1.89622 WP_000811366.1.89657 WP_000811366.1.89765 WP_000811366.1.89817 WP_000811366.1.89902 WP_000811366.1.8996 WP_000811366.1.90252 WP_000811366.1.90417 WP_000811366.1.90453 WP_000811366.1.90458 WP_000811366.1.90557 WP_000811366.1.90641 WP_000811366.1.90734 WP_000811366.1.91056 WP_000811366.1.91179 WP_000811366.1.91278 WP_000811366.1.91512 WP_000811366.1.91564 WP_000811366.1.91621 WP_000811366.1.91628 WP_000811366.1.91655 WP_000811366.1.91724 WP_000811366.1.91732 WP_000811366.1.91788 WP_000811366.1.92013 WP_000811366.1.92093 WP_000811366.1.92108 WP_000811366.1.92165 WP_000811366.1.92183 WP_000811366.1.92208 WP_000811366.1.92268 WP_000811366.1.92310 WP_000811366.1.92318 WP_000811366.1.92443 WP_000811366.1.92482 WP_000811366.1.92531 WP_000811366.1.92671 WP_000811366.1.92738 WP_000811366.1.92893 WP_000811366.1.93059 WP_000811366.1.93086 WP_000811366.1.93101 WP_000811366.1.93136 WP_000811366.1.93155 WP_000811366.1.93339 WP_000811366.1.93365 WP_000811366.1.93543 WP_000811366.1.93650 WP_000811366.1.93656 WP_000811366.1.93662 WP_000811366.1.937 WP_000811366.1.93705 WP_000811366.1.93804 WP_000811366.1.9389 WP_000811366.1.93937 WP_000811366.1.93994 WP_000811366.1.94072 WP_000811366.1.94162 WP_000811366.1.94168 WP_000811366.1.94198 WP_000811366.1.9432 WP_000811366.1.94354 WP_000811366.1.94380 WP_000811366.1.94458 WP_000811366.1.94565 WP_000811366.1.94584 WP_000811366.1.94655 WP_000811366.1.94674 WP_000811366.1.94796 WP_000811366.1.94959 WP_000811366.1.95051 WP_000811366.1.95085 WP_000811366.1.95121 WP_000811366.1.95248 WP_000811366.1.95277 WP_000811366.1.95282 WP_000811366.1.95388 WP_000811366.1.95546 WP_000811366.1.95630 WP_000811366.1.95670 WP_000811366.1.95691 WP_000811366.1.95911 WP_000811366.1.95939 WP_000811366.1.96004 WP_000811366.1.96162 WP_000811366.1.96317 WP_000811366.1.9644 WP_000811366.1.96469 WP_000811366.1.96497 WP_000811366.1.96555 WP_000811366.1.96563 WP_000811366.1.96732 WP_000811366.1.9674 WP_000811366.1.96771 WP_000811366.1.97015 WP_000811366.1.97047 WP_000811366.1.97145 WP_000811366.1.97190 WP_000811366.1.97297 WP_000811366.1.97318 WP_000811366.1.97477 WP_000811366.1.97487 WP_000811366.1.97594 WP_000811366.1.97597 WP_000811366.1.97613 WP_000811366.1.97620 WP_000811366.1.97631 WP_000811366.1.97727 WP_000811366.1.97732 WP_000811366.1.97736 WP_000811366.1.9775 WP_000811366.1.97846 WP_000811366.1.9799 WP_000811366.1.98006 WP_000811366.1.98022 WP_000811366.1.98110 WP_000811366.1.98146 WP_000811366.1.98170 WP_000811366.1.9826 WP_000811366.1.9841 WP_000811366.1.98495 WP_000811366.1.98531 WP_000811366.1.98577 WP_000811366.1.98676 WP_000811366.1.98760 WP_000811366.1.98843 WP_000811366.1.9898 WP_000811366.1.99098 WP_000811366.1.99184 WP_000811366.1.99267 WP_000811366.1.99276 WP_000811366.1.99626 WP_000811366.1.99646 WP_000811366.1.99657 WP_000811366.1.99660 WP_000811366.1.99712 WP_000811366.1.99858 WP_000811366.1.99889 WP_000811366.1.99958 gi|378990087|ref|YP_005253251.1| gi|386592454|ref|YP_006088854.1| gi|378985349|ref|YP_005248505.1| gi|525829361|ref|YP_008252453.1| gi|383497441|ref|YP_005398130.1| gi|482905321|ref|YP_007903881.1| APC23840 gi|16766069|ref|NP_461684.1| gi|550902129|ref|YP_008671221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]