SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451487|ref|YP_005238847.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451487|ref|YP_005238847.1|
Domain Number 1 Region: 58-124
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000152
Family Retroviral integrase, catalytic domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378451487|ref|YP_005238847.1|
Sequence length 134
Comment putative transposase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MQAAAERYPRYGFPKLFQVLRRQGYMWNHKRIHRIYCLLKLDFRRKGKQRLPVRNPSPLA
TPEALNQSWSVDFMHDALVCGRRFRTFNVVDDFNREALSIEIDLNLPALRVVRVLDRIAA
NRGKSRLSGHATHG
Download sequence
Identical sequences A0A0F6B5F7
gi|378451487|ref|YP_005238847.1| CP001363|CDS_2927154-2926750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]