SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451492|ref|YP_005238852.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451492|ref|YP_005238852.1|
Domain Number 1 Region: 120-282
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.65e-38
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451492|ref|YP_005238852.1|
Sequence length 288
Comment putative transposase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MKYVFIEKHQAEFNIKAMCRVFQVARSGWYVWHQRRHQINRRQRFRLVCDNVVREAFSDA
KQRYGAPRLTDELRAQGYQFNVKTVAASLRRQGLRAKASRRFRPVSYRKHGLPVSENLLK
QDFYASGPNQKWVGDITYLRTGEGWLYLAVVIDLWPRSVIGWSMSSRMTAQLACNALQMA
LWQRKCPENVIVHTDRGGQYCSTDYQSLLKRHNLRGSMSARGCCYDNACAESFFHTLRVE
CIHGEDFVSREIMRTAVFNYSECDYNRWRRHSACGGLSPEQFENQNLA
Download sequence
Identical sequences A0A0D3QSX6 A0A0F6B5G2 A0A0F7J9E9 A0A0H3NQJ5 A0A0M0QVW7 A0A0T9VZK7 A0A2D3AFA0 E8XJC9 Q8ZMN5
ABAM02000001|CDS_3286725-3287591 ABEL01000015|CDS_4018-4884 AE006468|CDS_2910977-2911843 CP001120|CDS_2885483-2886349 CP001363|CDS_2931212-2932078 FN424405|CDS_2903962-2904828 NP_461696.1.58477 gi|549725348|ref|YP_008645538.1| gi|378990098|ref|YP_005253262.1| gi|194451069|ref|YP_002046727.1| gi|379702024|ref|YP_005243752.1| APC25381 NYSGXRC-6066m NYSGXRC-T1377 gi|525829354|ref|YP_008252439.1| gi|525837298|ref|YP_008254051.1| 454169.SeHA_C2945 99287.STM2769 gi|525818562|ref|YP_008248580.1| gi|386592464|ref|YP_006088864.1| gi|482905334|ref|YP_007903894.1| gi|378700687|ref|YP_005182644.1| gi|378446131|ref|YP_005233763.1| gi|383497450|ref|YP_005398139.1| gi|16766081|ref|NP_461696.1| gi|378451492|ref|YP_005238852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]