SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451777|ref|YP_005239137.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451777|ref|YP_005239137.1|
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 7.99e-105
Family Aldo-keto reductases (NADP) 0.00000000000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451777|ref|YP_005239137.1|
Sequence length 346
Comment putative aldo-keto reductase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MHYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAIANGINLIDAAEMYPVPPRPE
TQGLTESYIGNWLAKRGNREKLIIASKVSGPARNNDQGIRPHQALDRKNIREALHDSLTR
LQTDYLDLYQVHWPQRPTNCFGKLGYNWTDSTPVVSLLETLDALSEFQRAGKIRYIGVSN
ETAFGVMRYLHLAEKHDLPRIVTIQNPYSLLNRSYEVGLAEVSQYEGVELLAYSCLAFGT
LTGKYLNGAKPAGARNTLFSRFTRYSGEQAQKAVASYVDIAKRHNLDPAQMALAFVRRQP
FVASTLLGATTMAQLKTNVESLHLTLSEEVLAEIEAAHQVYTYPAP
Download sequence
Identical sequences A0A0D6IFH6 A0A0F6B694 A0A0F7J9U3 A0A0H3NLT0 A0A0U1IPC5 A0A0W4IN05 A0A2D3AH71 A0A2H9YFA6 E8X9I0 Q8ZMA6
gi|16766310|ref|NP_461925.1| gi|378446363|ref|YP_005233995.1| gi|378451777|ref|YP_005239137.1| gi|549725576|ref|YP_008645766.1| gi|379702266|ref|YP_005243994.1| gi|378985598|ref|YP_005248754.1| gi|482905570|ref|YP_007904130.1| NP_461925.1.58477 WP_000558962.1.100010 WP_000558962.1.100234 WP_000558962.1.100376 WP_000558962.1.100424 WP_000558962.1.100436 WP_000558962.1.100484 WP_000558962.1.100488 WP_000558962.1.100597 WP_000558962.1.10076 WP_000558962.1.100781 WP_000558962.1.100793 WP_000558962.1.100869 WP_000558962.1.100871 WP_000558962.1.101007 WP_000558962.1.101020 WP_000558962.1.101074 WP_000558962.1.101078 WP_000558962.1.101180 WP_000558962.1.101259 WP_000558962.1.101284 WP_000558962.1.101291 WP_000558962.1.101353 WP_000558962.1.101386 WP_000558962.1.101404 WP_000558962.1.101420 WP_000558962.1.101589 WP_000558962.1.101707 WP_000558962.1.101734 WP_000558962.1.101878 WP_000558962.1.101953 WP_000558962.1.10220 WP_000558962.1.10266 WP_000558962.1.10439 WP_000558962.1.10753 WP_000558962.1.10992 WP_000558962.1.11024 WP_000558962.1.11031 WP_000558962.1.11098 WP_000558962.1.11168 WP_000558962.1.11190 WP_000558962.1.11295 WP_000558962.1.11455 WP_000558962.1.11458 WP_000558962.1.11518 WP_000558962.1.11532 WP_000558962.1.11543 WP_000558962.1.11763 WP_000558962.1.11772 WP_000558962.1.11897 WP_000558962.1.12114 WP_000558962.1.12351 WP_000558962.1.12370 WP_000558962.1.12546 WP_000558962.1.1264 WP_000558962.1.12728 WP_000558962.1.12879 WP_000558962.1.12936 WP_000558962.1.12995 WP_000558962.1.13027 WP_000558962.1.13106 WP_000558962.1.13130 WP_000558962.1.13414 WP_000558962.1.13488 WP_000558962.1.13509 WP_000558962.1.13669 WP_000558962.1.13741 WP_000558962.1.1387 WP_000558962.1.13908 WP_000558962.1.13932 WP_000558962.1.13968 WP_000558962.1.14001 WP_000558962.1.14151 WP_000558962.1.14239 WP_000558962.1.14320 WP_000558962.1.14379 WP_000558962.1.14406 WP_000558962.1.14410 WP_000558962.1.14466 WP_000558962.1.14524 WP_000558962.1.14554 WP_000558962.1.14725 WP_000558962.1.14852 WP_000558962.1.1489 WP_000558962.1.14932 WP_000558962.1.15055 WP_000558962.1.15124 WP_000558962.1.15223 WP_000558962.1.15226 WP_000558962.1.15316 WP_000558962.1.15369 WP_000558962.1.1540 WP_000558962.1.15508 WP_000558962.1.15784 WP_000558962.1.15830 WP_000558962.1.16062 WP_000558962.1.16063 WP_000558962.1.16103 WP_000558962.1.16226 WP_000558962.1.16233 WP_000558962.1.16284 WP_000558962.1.16328 WP_000558962.1.1635 WP_000558962.1.16468 WP_000558962.1.16614 WP_000558962.1.16650 WP_000558962.1.16686 WP_000558962.1.16691 WP_000558962.1.16732 WP_000558962.1.16735 WP_000558962.1.16786 WP_000558962.1.16858 WP_000558962.1.16896 WP_000558962.1.16916 WP_000558962.1.16965 WP_000558962.1.1700 WP_000558962.1.17307 WP_000558962.1.174 WP_000558962.1.17480 WP_000558962.1.17546 WP_000558962.1.17702 WP_000558962.1.18019 WP_000558962.1.18111 WP_000558962.1.18163 WP_000558962.1.18265 WP_000558962.1.18267 WP_000558962.1.18468 WP_000558962.1.18607 WP_000558962.1.18705 WP_000558962.1.18715 WP_000558962.1.18776 WP_000558962.1.18822 WP_000558962.1.18881 WP_000558962.1.18940 WP_000558962.1.18949 WP_000558962.1.19053 WP_000558962.1.19320 WP_000558962.1.19458 WP_000558962.1.19460 WP_000558962.1.19461 WP_000558962.1.19614 WP_000558962.1.19702 WP_000558962.1.19724 WP_000558962.1.19749 WP_000558962.1.19784 WP_000558962.1.19802 WP_000558962.1.19809 WP_000558962.1.19867 WP_000558962.1.1998 WP_000558962.1.20 WP_000558962.1.2010 WP_000558962.1.20212 WP_000558962.1.20266 WP_000558962.1.20271 WP_000558962.1.20362 WP_000558962.1.20418 WP_000558962.1.20443 WP_000558962.1.20525 WP_000558962.1.2054 WP_000558962.1.20553 WP_000558962.1.20626 WP_000558962.1.20646 WP_000558962.1.20886 WP_000558962.1.20908 WP_000558962.1.21049 WP_000558962.1.21146 WP_000558962.1.21245 WP_000558962.1.21246 WP_000558962.1.21269 WP_000558962.1.21400 WP_000558962.1.21497 WP_000558962.1.21499 WP_000558962.1.21603 WP_000558962.1.21751 WP_000558962.1.21757 WP_000558962.1.22024 WP_000558962.1.2205 WP_000558962.1.22062 WP_000558962.1.22067 WP_000558962.1.2221 WP_000558962.1.2235 WP_000558962.1.22379 WP_000558962.1.22427 WP_000558962.1.2246 WP_000558962.1.22485 WP_000558962.1.22620 WP_000558962.1.22870 WP_000558962.1.22979 WP_000558962.1.23114 WP_000558962.1.2314 WP_000558962.1.23192 WP_000558962.1.23259 WP_000558962.1.23460 WP_000558962.1.23472 WP_000558962.1.23482 WP_000558962.1.23634 WP_000558962.1.2364 WP_000558962.1.23932 WP_000558962.1.24017 WP_000558962.1.24206 WP_000558962.1.24308 WP_000558962.1.24578 WP_000558962.1.24737 WP_000558962.1.24779 WP_000558962.1.25008 WP_000558962.1.25015 WP_000558962.1.25405 WP_000558962.1.25454 WP_000558962.1.25493 WP_000558962.1.25668 WP_000558962.1.25690 WP_000558962.1.2570 WP_000558962.1.25740 WP_000558962.1.25814 WP_000558962.1.25988 WP_000558962.1.26282 WP_000558962.1.26311 WP_000558962.1.26319 WP_000558962.1.26429 WP_000558962.1.26440 WP_000558962.1.26493 WP_000558962.1.26551 WP_000558962.1.26567 WP_000558962.1.27010 WP_000558962.1.27173 WP_000558962.1.27206 WP_000558962.1.27423 WP_000558962.1.27561 WP_000558962.1.2763 WP_000558962.1.27665 WP_000558962.1.27707 WP_000558962.1.27761 WP_000558962.1.2777 WP_000558962.1.27857 WP_000558962.1.27977 WP_000558962.1.28094 WP_000558962.1.28170 WP_000558962.1.28302 WP_000558962.1.2835 WP_000558962.1.28370 WP_000558962.1.28538 WP_000558962.1.28575 WP_000558962.1.28625 WP_000558962.1.28655 WP_000558962.1.28694 WP_000558962.1.2879 WP_000558962.1.2890 WP_000558962.1.28938 WP_000558962.1.28946 WP_000558962.1.29006 WP_000558962.1.29010 WP_000558962.1.2910 WP_000558962.1.29588 WP_000558962.1.29601 WP_000558962.1.29606 WP_000558962.1.29615 WP_000558962.1.29619 WP_000558962.1.29704 WP_000558962.1.29969 WP_000558962.1.30006 WP_000558962.1.30027 WP_000558962.1.30180 WP_000558962.1.30469 WP_000558962.1.30505 WP_000558962.1.30507 WP_000558962.1.30547 WP_000558962.1.30794 WP_000558962.1.30833 WP_000558962.1.30835 WP_000558962.1.30972 WP_000558962.1.31 WP_000558962.1.3113 WP_000558962.1.31185 WP_000558962.1.3119 WP_000558962.1.31190 WP_000558962.1.31195 WP_000558962.1.31196 WP_000558962.1.31281 WP_000558962.1.31362 WP_000558962.1.31504 WP_000558962.1.31515 WP_000558962.1.31578 WP_000558962.1.31658 WP_000558962.1.31940 WP_000558962.1.31967 WP_000558962.1.31972 WP_000558962.1.32192 WP_000558962.1.32206 WP_000558962.1.32438 WP_000558962.1.32515 WP_000558962.1.32660 WP_000558962.1.32702 WP_000558962.1.32714 WP_000558962.1.32786 WP_000558962.1.32804 WP_000558962.1.32907 WP_000558962.1.33030 WP_000558962.1.33127 WP_000558962.1.33143 WP_000558962.1.33248 WP_000558962.1.33261 WP_000558962.1.333 WP_000558962.1.33492 WP_000558962.1.33553 WP_000558962.1.33592 WP_000558962.1.33894 WP_000558962.1.34043 WP_000558962.1.34075 WP_000558962.1.34257 WP_000558962.1.34279 WP_000558962.1.34319 WP_000558962.1.34453 WP_000558962.1.34610 WP_000558962.1.34856 WP_000558962.1.34975 WP_000558962.1.35045 WP_000558962.1.35129 WP_000558962.1.35184 WP_000558962.1.35404 WP_000558962.1.35408 WP_000558962.1.35425 WP_000558962.1.35446 WP_000558962.1.35463 WP_000558962.1.35503 WP_000558962.1.35509 WP_000558962.1.35590 WP_000558962.1.35940 WP_000558962.1.36003 WP_000558962.1.3601 WP_000558962.1.36609 WP_000558962.1.36690 WP_000558962.1.3670 WP_000558962.1.36705 WP_000558962.1.36918 WP_000558962.1.36931 WP_000558962.1.37073 WP_000558962.1.37111 WP_000558962.1.37112 WP_000558962.1.37256 WP_000558962.1.37293 WP_000558962.1.37370 WP_000558962.1.37376 WP_000558962.1.3744 WP_000558962.1.37498 WP_000558962.1.37504 WP_000558962.1.37618 WP_000558962.1.37968 WP_000558962.1.37978 WP_000558962.1.38145 WP_000558962.1.383 WP_000558962.1.3848 WP_000558962.1.38613 WP_000558962.1.38673 WP_000558962.1.38693 WP_000558962.1.38773 WP_000558962.1.38882 WP_000558962.1.38913 WP_000558962.1.39003 WP_000558962.1.39136 WP_000558962.1.39197 WP_000558962.1.39229 WP_000558962.1.39405 WP_000558962.1.39420 WP_000558962.1.39449 WP_000558962.1.39512 WP_000558962.1.39629 WP_000558962.1.39763 WP_000558962.1.39862 WP_000558962.1.39921 WP_000558962.1.39923 WP_000558962.1.40017 WP_000558962.1.40072 WP_000558962.1.40073 WP_000558962.1.4011 WP_000558962.1.40208 WP_000558962.1.40257 WP_000558962.1.40292 WP_000558962.1.40305 WP_000558962.1.40311 WP_000558962.1.40395 WP_000558962.1.40465 WP_000558962.1.40710 WP_000558962.1.4075 WP_000558962.1.4087 WP_000558962.1.40877 WP_000558962.1.41017 WP_000558962.1.41086 WP_000558962.1.41091 WP_000558962.1.41226 WP_000558962.1.41279 WP_000558962.1.41516 WP_000558962.1.41554 WP_000558962.1.41572 WP_000558962.1.41591 WP_000558962.1.41662 WP_000558962.1.41708 WP_000558962.1.41761 WP_000558962.1.41882 WP_000558962.1.41979 WP_000558962.1.41985 WP_000558962.1.42104 WP_000558962.1.42320 WP_000558962.1.42342 WP_000558962.1.42422 WP_000558962.1.4276 WP_000558962.1.42864 WP_000558962.1.4288 WP_000558962.1.43018 WP_000558962.1.43041 WP_000558962.1.43244 WP_000558962.1.43312 WP_000558962.1.43334 WP_000558962.1.43437 WP_000558962.1.43522 WP_000558962.1.43613 WP_000558962.1.43668 WP_000558962.1.43886 WP_000558962.1.44005 WP_000558962.1.44043 WP_000558962.1.44099 WP_000558962.1.44121 WP_000558962.1.44291 WP_000558962.1.44310 WP_000558962.1.44479 WP_000558962.1.44640 WP_000558962.1.4467 WP_000558962.1.44747 WP_000558962.1.4485 WP_000558962.1.44877 WP_000558962.1.44927 WP_000558962.1.45067 WP_000558962.1.45074 WP_000558962.1.45079 WP_000558962.1.45098 WP_000558962.1.45177 WP_000558962.1.45184 WP_000558962.1.45259 WP_000558962.1.45349 WP_000558962.1.45365 WP_000558962.1.45550 WP_000558962.1.45585 WP_000558962.1.45660 WP_000558962.1.45690 WP_000558962.1.458 WP_000558962.1.46011 WP_000558962.1.46069 WP_000558962.1.46112 WP_000558962.1.46173 WP_000558962.1.46174 WP_000558962.1.46187 WP_000558962.1.46303 WP_000558962.1.46595 WP_000558962.1.46675 WP_000558962.1.47057 WP_000558962.1.47214 WP_000558962.1.47429 WP_000558962.1.47448 WP_000558962.1.4747 WP_000558962.1.47472 WP_000558962.1.47478 WP_000558962.1.47621 WP_000558962.1.47799 WP_000558962.1.48242 WP_000558962.1.48253 WP_000558962.1.483 WP_000558962.1.48367 WP_000558962.1.48377 WP_000558962.1.4853 WP_000558962.1.48788 WP_000558962.1.4885 WP_000558962.1.48876 WP_000558962.1.48894 WP_000558962.1.48919 WP_000558962.1.49084 WP_000558962.1.49155 WP_000558962.1.49204 WP_000558962.1.49239 WP_000558962.1.49256 WP_000558962.1.49290 WP_000558962.1.49340 WP_000558962.1.49366 WP_000558962.1.49490 WP_000558962.1.49515 WP_000558962.1.49572 WP_000558962.1.4979 WP_000558962.1.49803 WP_000558962.1.49805 WP_000558962.1.49929 WP_000558962.1.50080 WP_000558962.1.50161 WP_000558962.1.50211 WP_000558962.1.50376 WP_000558962.1.50389 WP_000558962.1.50676 WP_000558962.1.50804 WP_000558962.1.50808 WP_000558962.1.5088 WP_000558962.1.50908 WP_000558962.1.50941 WP_000558962.1.51014 WP_000558962.1.51022 WP_000558962.1.51179 WP_000558962.1.51182 WP_000558962.1.51186 WP_000558962.1.51487 WP_000558962.1.51488 WP_000558962.1.51634 WP_000558962.1.51649 WP_000558962.1.51686 WP_000558962.1.51756 WP_000558962.1.51911 WP_000558962.1.51932 WP_000558962.1.51989 WP_000558962.1.52121 WP_000558962.1.52346 WP_000558962.1.52353 WP_000558962.1.52361 WP_000558962.1.52653 WP_000558962.1.52656 WP_000558962.1.52743 WP_000558962.1.52857 WP_000558962.1.52898 WP_000558962.1.52915 WP_000558962.1.53190 WP_000558962.1.53406 WP_000558962.1.53466 WP_000558962.1.53529 WP_000558962.1.53543 WP_000558962.1.53757 WP_000558962.1.53812 WP_000558962.1.54033 WP_000558962.1.54075 WP_000558962.1.54196 WP_000558962.1.54209 WP_000558962.1.54271 WP_000558962.1.54274 WP_000558962.1.54319 WP_000558962.1.54364 WP_000558962.1.54400 WP_000558962.1.54644 WP_000558962.1.54662 WP_000558962.1.54722 WP_000558962.1.54749 WP_000558962.1.54764 WP_000558962.1.55008 WP_000558962.1.55152 WP_000558962.1.55156 WP_000558962.1.55285 WP_000558962.1.55475 WP_000558962.1.55647 WP_000558962.1.55743 WP_000558962.1.55768 WP_000558962.1.55782 WP_000558962.1.55796 WP_000558962.1.56002 WP_000558962.1.56012 WP_000558962.1.56105 WP_000558962.1.56238 WP_000558962.1.56286 WP_000558962.1.56304 WP_000558962.1.56414 WP_000558962.1.56438 WP_000558962.1.56560 WP_000558962.1.56601 WP_000558962.1.56614 WP_000558962.1.56671 WP_000558962.1.56682 WP_000558962.1.56875 WP_000558962.1.56877 WP_000558962.1.57168 WP_000558962.1.57187 WP_000558962.1.57377 WP_000558962.1.57433 WP_000558962.1.57529 WP_000558962.1.57576 WP_000558962.1.57601 WP_000558962.1.57607 WP_000558962.1.57763 WP_000558962.1.57862 WP_000558962.1.57890 WP_000558962.1.57891 WP_000558962.1.57978 WP_000558962.1.5801 WP_000558962.1.58041 WP_000558962.1.58418 WP_000558962.1.58548 WP_000558962.1.5858 WP_000558962.1.58662 WP_000558962.1.58669 WP_000558962.1.58745 WP_000558962.1.58803 WP_000558962.1.5886 WP_000558962.1.59094 WP_000558962.1.59224 WP_000558962.1.59375 WP_000558962.1.59458 WP_000558962.1.59490 WP_000558962.1.59508 WP_000558962.1.59684 WP_000558962.1.59694 WP_000558962.1.59771 WP_000558962.1.5979 WP_000558962.1.59953 WP_000558962.1.60008 WP_000558962.1.60021 WP_000558962.1.60069 WP_000558962.1.60140 WP_000558962.1.60155 WP_000558962.1.60285 WP_000558962.1.60379 WP_000558962.1.60464 WP_000558962.1.60874 WP_000558962.1.60941 WP_000558962.1.61078 WP_000558962.1.6114 WP_000558962.1.61232 WP_000558962.1.6129 WP_000558962.1.61296 WP_000558962.1.61345 WP_000558962.1.61417 WP_000558962.1.61574 WP_000558962.1.61712 WP_000558962.1.61714 WP_000558962.1.61730 WP_000558962.1.61857 WP_000558962.1.61918 WP_000558962.1.61952 WP_000558962.1.62007 WP_000558962.1.62025 WP_000558962.1.62204 WP_000558962.1.62304 WP_000558962.1.62364 WP_000558962.1.62374 WP_000558962.1.62403 WP_000558962.1.6253 WP_000558962.1.62853 WP_000558962.1.62903 WP_000558962.1.62910 WP_000558962.1.62955 WP_000558962.1.63181 WP_000558962.1.63203 WP_000558962.1.63256 WP_000558962.1.63290 WP_000558962.1.63382 WP_000558962.1.63432 WP_000558962.1.63461 WP_000558962.1.63479 WP_000558962.1.63577 WP_000558962.1.63664 WP_000558962.1.63718 WP_000558962.1.6375 WP_000558962.1.63757 WP_000558962.1.63834 WP_000558962.1.64046 WP_000558962.1.6423 WP_000558962.1.64244 WP_000558962.1.64403 WP_000558962.1.64649 WP_000558962.1.64702 WP_000558962.1.64757 WP_000558962.1.64781 WP_000558962.1.64831 WP_000558962.1.6489 WP_000558962.1.65018 WP_000558962.1.65028 WP_000558962.1.65171 WP_000558962.1.65248 WP_000558962.1.6535 WP_000558962.1.65474 WP_000558962.1.65633 WP_000558962.1.6565 WP_000558962.1.65696 WP_000558962.1.6575 WP_000558962.1.65782 WP_000558962.1.6630 WP_000558962.1.66314 WP_000558962.1.66358 WP_000558962.1.66362 WP_000558962.1.6638 WP_000558962.1.6640 WP_000558962.1.66698 WP_000558962.1.6680 WP_000558962.1.66834 WP_000558962.1.66901 WP_000558962.1.66962 WP_000558962.1.67037 WP_000558962.1.67045 WP_000558962.1.67181 WP_000558962.1.67268 WP_000558962.1.67347 WP_000558962.1.67465 WP_000558962.1.67552 WP_000558962.1.67682 WP_000558962.1.67887 WP_000558962.1.68073 WP_000558962.1.68201 WP_000558962.1.68206 WP_000558962.1.6827 WP_000558962.1.68275 WP_000558962.1.6849 WP_000558962.1.68547 WP_000558962.1.68589 WP_000558962.1.68655 WP_000558962.1.68656 WP_000558962.1.68778 WP_000558962.1.68787 WP_000558962.1.68928 WP_000558962.1.68975 WP_000558962.1.69006 WP_000558962.1.6913 WP_000558962.1.69146 WP_000558962.1.69255 WP_000558962.1.69397 WP_000558962.1.69564 WP_000558962.1.69644 WP_000558962.1.69704 WP_000558962.1.7021 WP_000558962.1.70241 WP_000558962.1.70269 WP_000558962.1.70289 WP_000558962.1.70447 WP_000558962.1.70485 WP_000558962.1.70643 WP_000558962.1.70683 WP_000558962.1.70883 WP_000558962.1.70922 WP_000558962.1.70948 WP_000558962.1.71116 WP_000558962.1.71146 WP_000558962.1.71165 WP_000558962.1.71188 WP_000558962.1.71202 WP_000558962.1.71243 WP_000558962.1.71306 WP_000558962.1.71337 WP_000558962.1.71378 WP_000558962.1.71401 WP_000558962.1.71702 WP_000558962.1.71750 WP_000558962.1.71845 WP_000558962.1.71881 WP_000558962.1.71908 WP_000558962.1.71952 WP_000558962.1.71973 WP_000558962.1.72105 WP_000558962.1.72203 WP_000558962.1.72376 WP_000558962.1.72594 WP_000558962.1.72871 WP_000558962.1.72975 WP_000558962.1.7315 WP_000558962.1.73200 WP_000558962.1.7334 WP_000558962.1.73377 WP_000558962.1.73481 WP_000558962.1.7356 WP_000558962.1.73581 WP_000558962.1.73617 WP_000558962.1.73753 WP_000558962.1.73758 WP_000558962.1.73794 WP_000558962.1.7387 WP_000558962.1.73924 WP_000558962.1.74029 WP_000558962.1.74181 WP_000558962.1.74191 WP_000558962.1.7433 WP_000558962.1.74379 WP_000558962.1.74410 WP_000558962.1.74466 WP_000558962.1.74529 WP_000558962.1.74545 WP_000558962.1.74745 WP_000558962.1.75129 WP_000558962.1.75187 WP_000558962.1.75288 WP_000558962.1.75334 WP_000558962.1.75362 WP_000558962.1.75385 WP_000558962.1.75392 WP_000558962.1.75760 WP_000558962.1.75764 WP_000558962.1.75837 WP_000558962.1.75874 WP_000558962.1.75945 WP_000558962.1.76020 WP_000558962.1.76252 WP_000558962.1.76445 WP_000558962.1.7660 WP_000558962.1.76673 WP_000558962.1.76706 WP_000558962.1.76721 WP_000558962.1.76756 WP_000558962.1.76760 WP_000558962.1.76875 WP_000558962.1.76880 WP_000558962.1.76899 WP_000558962.1.77038 WP_000558962.1.77047 WP_000558962.1.77080 WP_000558962.1.7712 WP_000558962.1.77180 WP_000558962.1.77244 WP_000558962.1.77292 WP_000558962.1.77349 WP_000558962.1.77514 WP_000558962.1.77529 WP_000558962.1.77549 WP_000558962.1.77692 WP_000558962.1.7782 WP_000558962.1.77851 WP_000558962.1.77898 WP_000558962.1.77918 WP_000558962.1.77960 WP_000558962.1.78033 WP_000558962.1.78076 WP_000558962.1.78096 WP_000558962.1.78100 WP_000558962.1.78110 WP_000558962.1.78120 WP_000558962.1.78383 WP_000558962.1.78407 WP_000558962.1.7861 WP_000558962.1.78618 WP_000558962.1.78673 WP_000558962.1.78735 WP_000558962.1.78802 WP_000558962.1.78830 WP_000558962.1.78835 WP_000558962.1.78871 WP_000558962.1.78874 WP_000558962.1.78918 WP_000558962.1.78930 WP_000558962.1.79151 WP_000558962.1.79167 WP_000558962.1.79335 WP_000558962.1.79462 WP_000558962.1.79472 WP_000558962.1.79490 WP_000558962.1.79495 WP_000558962.1.79529 WP_000558962.1.79570 WP_000558962.1.7964 WP_000558962.1.79659 WP_000558962.1.79668 WP_000558962.1.79708 WP_000558962.1.79845 WP_000558962.1.80077 WP_000558962.1.80137 WP_000558962.1.80182 WP_000558962.1.80296 WP_000558962.1.80366 WP_000558962.1.80780 WP_000558962.1.80831 WP_000558962.1.80850 WP_000558962.1.80881 WP_000558962.1.80939 WP_000558962.1.8096 WP_000558962.1.81037 WP_000558962.1.81069 WP_000558962.1.81149 WP_000558962.1.81175 WP_000558962.1.8119 WP_000558962.1.81193 WP_000558962.1.81354 WP_000558962.1.81425 WP_000558962.1.81750 WP_000558962.1.81785 WP_000558962.1.81902 WP_000558962.1.81974 WP_000558962.1.82337 WP_000558962.1.82479 WP_000558962.1.82503 WP_000558962.1.82515 WP_000558962.1.82676 WP_000558962.1.82761 WP_000558962.1.8282 WP_000558962.1.82944 WP_000558962.1.83092 WP_000558962.1.83163 WP_000558962.1.83413 WP_000558962.1.83491 WP_000558962.1.83523 WP_000558962.1.8354 WP_000558962.1.83721 WP_000558962.1.83760 WP_000558962.1.83995 WP_000558962.1.84103 WP_000558962.1.84283 WP_000558962.1.84392 WP_000558962.1.8441 WP_000558962.1.84532 WP_000558962.1.84659 WP_000558962.1.84899 WP_000558962.1.8497 WP_000558962.1.85040 WP_000558962.1.85134 WP_000558962.1.85178 WP_000558962.1.85180 WP_000558962.1.85190 WP_000558962.1.8533 WP_000558962.1.8545 WP_000558962.1.85481 WP_000558962.1.85483 WP_000558962.1.85541 WP_000558962.1.8556 WP_000558962.1.85615 WP_000558962.1.85617 WP_000558962.1.85663 WP_000558962.1.85671 WP_000558962.1.85672 WP_000558962.1.85777 WP_000558962.1.85886 WP_000558962.1.85900 WP_000558962.1.85904 WP_000558962.1.85976 WP_000558962.1.86306 WP_000558962.1.86356 WP_000558962.1.86450 WP_000558962.1.86469 WP_000558962.1.86580 WP_000558962.1.86588 WP_000558962.1.86661 WP_000558962.1.8672 WP_000558962.1.8678 WP_000558962.1.86810 WP_000558962.1.8684 WP_000558962.1.86895 WP_000558962.1.86906 WP_000558962.1.87095 WP_000558962.1.8736 WP_000558962.1.87460 WP_000558962.1.87552 WP_000558962.1.87779 WP_000558962.1.87945 WP_000558962.1.88019 WP_000558962.1.88073 WP_000558962.1.8809 WP_000558962.1.88291 WP_000558962.1.88293 WP_000558962.1.88393 WP_000558962.1.88703 WP_000558962.1.88792 WP_000558962.1.88902 WP_000558962.1.8891 WP_000558962.1.89008 WP_000558962.1.89116 WP_000558962.1.89138 WP_000558962.1.89304 WP_000558962.1.89512 WP_000558962.1.89527 WP_000558962.1.89570 WP_000558962.1.89604 WP_000558962.1.89622 WP_000558962.1.89659 WP_000558962.1.89902 WP_000558962.1.8996 WP_000558962.1.90097 WP_000558962.1.90252 WP_000558962.1.90417 WP_000558962.1.90453 WP_000558962.1.90458 WP_000558962.1.90557 WP_000558962.1.90585 WP_000558962.1.90641 WP_000558962.1.90734 WP_000558962.1.91003 WP_000558962.1.91069 WP_000558962.1.91278 WP_000558962.1.91512 WP_000558962.1.91564 WP_000558962.1.91628 WP_000558962.1.91655 WP_000558962.1.91724 WP_000558962.1.91732 WP_000558962.1.91788 WP_000558962.1.92013 WP_000558962.1.92093 WP_000558962.1.92108 WP_000558962.1.92183 WP_000558962.1.92208 WP_000558962.1.92268 WP_000558962.1.92310 WP_000558962.1.92443 WP_000558962.1.92482 WP_000558962.1.92531 WP_000558962.1.92669 WP_000558962.1.92671 WP_000558962.1.92738 WP_000558962.1.93086 WP_000558962.1.93101 WP_000558962.1.93136 WP_000558962.1.93155 WP_000558962.1.93365 WP_000558962.1.93543 WP_000558962.1.93650 WP_000558962.1.93656 WP_000558962.1.93662 WP_000558962.1.937 WP_000558962.1.93705 WP_000558962.1.93804 WP_000558962.1.9389 WP_000558962.1.93994 WP_000558962.1.94072 WP_000558962.1.94162 WP_000558962.1.94168 WP_000558962.1.94198 WP_000558962.1.9432 WP_000558962.1.94354 WP_000558962.1.94380 WP_000558962.1.94458 WP_000558962.1.94565 WP_000558962.1.94584 WP_000558962.1.94674 WP_000558962.1.94796 WP_000558962.1.94959 WP_000558962.1.95051 WP_000558962.1.95085 WP_000558962.1.95121 WP_000558962.1.95282 WP_000558962.1.95546 WP_000558962.1.95630 WP_000558962.1.95911 WP_000558962.1.96139 WP_000558962.1.96317 WP_000558962.1.96343 WP_000558962.1.9644 WP_000558962.1.96469 WP_000558962.1.96500 WP_000558962.1.96555 WP_000558962.1.96563 WP_000558962.1.96732 WP_000558962.1.96771 WP_000558962.1.97015 WP_000558962.1.97145 WP_000558962.1.97190 WP_000558962.1.97318 WP_000558962.1.97369 WP_000558962.1.97594 WP_000558962.1.97597 WP_000558962.1.97613 WP_000558962.1.97620 WP_000558962.1.97727 WP_000558962.1.97732 WP_000558962.1.97736 WP_000558962.1.9775 WP_000558962.1.97846 WP_000558962.1.98006 WP_000558962.1.98019 WP_000558962.1.98022 WP_000558962.1.98110 WP_000558962.1.98146 WP_000558962.1.98219 WP_000558962.1.9841 WP_000558962.1.98495 WP_000558962.1.98531 WP_000558962.1.98577 WP_000558962.1.98676 WP_000558962.1.98677 WP_000558962.1.98760 WP_000558962.1.98843 WP_000558962.1.9898 WP_000558962.1.99098 WP_000558962.1.99184 WP_000558962.1.99267 WP_000558962.1.99276 WP_000558962.1.99646 WP_000558962.1.99657 WP_000558962.1.99660 WP_000558962.1.99712 WP_000558962.1.99813 WP_000558962.1.99858 WP_000558962.1.99889 WP_000558962.1.99958 gi|550902371|ref|YP_008671463.1| gi|378990329|ref|YP_005253493.1| gi|526221398|ref|YP_008267212.1| gi|378700918|ref|YP_005182875.1| gi|525837110|ref|YP_008253816.1| 99287.STM3008 AE006468|CDS_3165550-3166590 CP001363|CDS_3185359-3186399 FN424405|CDS_3157560-3158600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]