SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451779|ref|YP_005239139.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451779|ref|YP_005239139.1|
Domain Number 1 Region: 200-712
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-96
Family Acetyl-CoA synthetase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 6-171
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 4.58e-19
Family Glycerol-3-phosphate (1)-acyltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378451779|ref|YP_005239139.1|
Sequence length 719
Comment bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS
ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG
AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD
RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK
TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA
AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV
KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG
LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR
LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM
DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENSRGETERGWYDTGDIVR
FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT
TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE
Download sequence
Identical sequences A0A0D6IGZ3 A0A0F6B696 A0A0F7JC19 A0A0H3NRE5 A0A0U1GIK5 A0A0W3PB53 A0A2D3AG06 A0A2H9YFA3 E8X9I2 Q8ZMA4
gi|482905572|ref|YP_007904132.1| gi|16766312|ref|NP_461927.1| gi|378451779|ref|YP_005239139.1| gi|379702268|ref|YP_005243996.1| gi|525837108|ref|YP_008253814.1| gi|378700920|ref|YP_005182877.1| gi|383497678|ref|YP_005398367.1| gi|378990331|ref|YP_005253495.1| gi|549725578|ref|YP_008645768.1| NP_461927.1.58477 WP_000896102.1.100010 WP_000896102.1.100234 WP_000896102.1.100376 WP_000896102.1.100424 WP_000896102.1.100436 WP_000896102.1.100484 WP_000896102.1.100488 WP_000896102.1.100597 WP_000896102.1.10076 WP_000896102.1.100781 WP_000896102.1.100793 WP_000896102.1.100869 WP_000896102.1.100871 WP_000896102.1.100882 WP_000896102.1.101020 WP_000896102.1.101074 WP_000896102.1.101078 WP_000896102.1.101180 WP_000896102.1.101259 WP_000896102.1.101284 WP_000896102.1.101291 WP_000896102.1.101353 WP_000896102.1.101386 WP_000896102.1.101404 WP_000896102.1.101420 WP_000896102.1.101589 WP_000896102.1.101707 WP_000896102.1.101734 WP_000896102.1.101953 WP_000896102.1.10220 WP_000896102.1.10266 WP_000896102.1.10439 WP_000896102.1.10678 WP_000896102.1.10753 WP_000896102.1.10992 WP_000896102.1.11024 WP_000896102.1.11031 WP_000896102.1.11098 WP_000896102.1.11168 WP_000896102.1.11190 WP_000896102.1.11295 WP_000896102.1.11455 WP_000896102.1.11458 WP_000896102.1.11518 WP_000896102.1.11532 WP_000896102.1.11763 WP_000896102.1.11772 WP_000896102.1.11897 WP_000896102.1.12114 WP_000896102.1.12370 WP_000896102.1.12546 WP_000896102.1.1264 WP_000896102.1.12728 WP_000896102.1.12879 WP_000896102.1.12936 WP_000896102.1.12995 WP_000896102.1.13027 WP_000896102.1.13106 WP_000896102.1.13130 WP_000896102.1.13414 WP_000896102.1.13488 WP_000896102.1.13509 WP_000896102.1.13669 WP_000896102.1.13741 WP_000896102.1.13908 WP_000896102.1.13932 WP_000896102.1.13968 WP_000896102.1.14001 WP_000896102.1.14151 WP_000896102.1.14320 WP_000896102.1.14379 WP_000896102.1.14406 WP_000896102.1.14410 WP_000896102.1.14466 WP_000896102.1.14524 WP_000896102.1.14554 WP_000896102.1.14725 WP_000896102.1.14852 WP_000896102.1.1489 WP_000896102.1.14932 WP_000896102.1.15124 WP_000896102.1.15223 WP_000896102.1.15226 WP_000896102.1.15316 WP_000896102.1.15369 WP_000896102.1.1540 WP_000896102.1.15508 WP_000896102.1.15784 WP_000896102.1.15830 WP_000896102.1.16062 WP_000896102.1.16063 WP_000896102.1.16103 WP_000896102.1.16233 WP_000896102.1.16284 WP_000896102.1.16328 WP_000896102.1.1635 WP_000896102.1.16468 WP_000896102.1.16614 WP_000896102.1.16650 WP_000896102.1.16686 WP_000896102.1.16691 WP_000896102.1.16732 WP_000896102.1.16735 WP_000896102.1.16786 WP_000896102.1.16858 WP_000896102.1.16916 WP_000896102.1.16965 WP_000896102.1.1700 WP_000896102.1.17307 WP_000896102.1.17480 WP_000896102.1.17546 WP_000896102.1.17702 WP_000896102.1.17705 WP_000896102.1.17865 WP_000896102.1.18019 WP_000896102.1.18111 WP_000896102.1.18163 WP_000896102.1.18265 WP_000896102.1.18267 WP_000896102.1.18468 WP_000896102.1.18607 WP_000896102.1.18705 WP_000896102.1.18715 WP_000896102.1.18776 WP_000896102.1.18822 WP_000896102.1.18881 WP_000896102.1.18940 WP_000896102.1.18949 WP_000896102.1.19053 WP_000896102.1.19320 WP_000896102.1.19458 WP_000896102.1.19460 WP_000896102.1.19461 WP_000896102.1.19614 WP_000896102.1.19702 WP_000896102.1.19706 WP_000896102.1.19724 WP_000896102.1.19784 WP_000896102.1.19802 WP_000896102.1.19809 WP_000896102.1.19867 WP_000896102.1.1998 WP_000896102.1.20 WP_000896102.1.2010 WP_000896102.1.20212 WP_000896102.1.20266 WP_000896102.1.20271 WP_000896102.1.20362 WP_000896102.1.20418 WP_000896102.1.20443 WP_000896102.1.20525 WP_000896102.1.2054 WP_000896102.1.20553 WP_000896102.1.20626 WP_000896102.1.20646 WP_000896102.1.20886 WP_000896102.1.20908 WP_000896102.1.21049 WP_000896102.1.21146 WP_000896102.1.21245 WP_000896102.1.21246 WP_000896102.1.21269 WP_000896102.1.21400 WP_000896102.1.21497 WP_000896102.1.21499 WP_000896102.1.21603 WP_000896102.1.21751 WP_000896102.1.21757 WP_000896102.1.22024 WP_000896102.1.2205 WP_000896102.1.22062 WP_000896102.1.22067 WP_000896102.1.2221 WP_000896102.1.2235 WP_000896102.1.22379 WP_000896102.1.22427 WP_000896102.1.2246 WP_000896102.1.22485 WP_000896102.1.22620 WP_000896102.1.22870 WP_000896102.1.22979 WP_000896102.1.23102 WP_000896102.1.23114 WP_000896102.1.2314 WP_000896102.1.23192 WP_000896102.1.23259 WP_000896102.1.23460 WP_000896102.1.23472 WP_000896102.1.23482 WP_000896102.1.23634 WP_000896102.1.2364 WP_000896102.1.23932 WP_000896102.1.24017 WP_000896102.1.24206 WP_000896102.1.24308 WP_000896102.1.24578 WP_000896102.1.24737 WP_000896102.1.24779 WP_000896102.1.25008 WP_000896102.1.25015 WP_000896102.1.25405 WP_000896102.1.25454 WP_000896102.1.25493 WP_000896102.1.25668 WP_000896102.1.25690 WP_000896102.1.2570 WP_000896102.1.25740 WP_000896102.1.25793 WP_000896102.1.25814 WP_000896102.1.25988 WP_000896102.1.26282 WP_000896102.1.26311 WP_000896102.1.26319 WP_000896102.1.26429 WP_000896102.1.26440 WP_000896102.1.26493 WP_000896102.1.26551 WP_000896102.1.26567 WP_000896102.1.27010 WP_000896102.1.27173 WP_000896102.1.27206 WP_000896102.1.27423 WP_000896102.1.27561 WP_000896102.1.2763 WP_000896102.1.27665 WP_000896102.1.27707 WP_000896102.1.27761 WP_000896102.1.2777 WP_000896102.1.27857 WP_000896102.1.27977 WP_000896102.1.28094 WP_000896102.1.28170 WP_000896102.1.28302 WP_000896102.1.2835 WP_000896102.1.28370 WP_000896102.1.28538 WP_000896102.1.28575 WP_000896102.1.28625 WP_000896102.1.28655 WP_000896102.1.28694 WP_000896102.1.2879 WP_000896102.1.2890 WP_000896102.1.28938 WP_000896102.1.28946 WP_000896102.1.29006 WP_000896102.1.29010 WP_000896102.1.2910 WP_000896102.1.29588 WP_000896102.1.29601 WP_000896102.1.29606 WP_000896102.1.29615 WP_000896102.1.29619 WP_000896102.1.29704 WP_000896102.1.29969 WP_000896102.1.30006 WP_000896102.1.30027 WP_000896102.1.30180 WP_000896102.1.30246 WP_000896102.1.30469 WP_000896102.1.30505 WP_000896102.1.30507 WP_000896102.1.30535 WP_000896102.1.30547 WP_000896102.1.30794 WP_000896102.1.30833 WP_000896102.1.30835 WP_000896102.1.30972 WP_000896102.1.31 WP_000896102.1.3113 WP_000896102.1.31185 WP_000896102.1.3119 WP_000896102.1.31190 WP_000896102.1.31195 WP_000896102.1.31196 WP_000896102.1.31281 WP_000896102.1.31504 WP_000896102.1.31515 WP_000896102.1.31578 WP_000896102.1.31658 WP_000896102.1.31854 WP_000896102.1.31940 WP_000896102.1.31967 WP_000896102.1.31972 WP_000896102.1.32192 WP_000896102.1.32206 WP_000896102.1.32408 WP_000896102.1.32438 WP_000896102.1.32515 WP_000896102.1.32660 WP_000896102.1.32702 WP_000896102.1.32714 WP_000896102.1.32786 WP_000896102.1.32804 WP_000896102.1.32907 WP_000896102.1.33030 WP_000896102.1.33127 WP_000896102.1.33143 WP_000896102.1.33248 WP_000896102.1.33261 WP_000896102.1.333 WP_000896102.1.33492 WP_000896102.1.33553 WP_000896102.1.33592 WP_000896102.1.33894 WP_000896102.1.34043 WP_000896102.1.34075 WP_000896102.1.34257 WP_000896102.1.34319 WP_000896102.1.3445 WP_000896102.1.34453 WP_000896102.1.34610 WP_000896102.1.34856 WP_000896102.1.34975 WP_000896102.1.35045 WP_000896102.1.35129 WP_000896102.1.35184 WP_000896102.1.35404 WP_000896102.1.35408 WP_000896102.1.35446 WP_000896102.1.35463 WP_000896102.1.35503 WP_000896102.1.35509 WP_000896102.1.35590 WP_000896102.1.35940 WP_000896102.1.36003 WP_000896102.1.3601 WP_000896102.1.36609 WP_000896102.1.36690 WP_000896102.1.3670 WP_000896102.1.36705 WP_000896102.1.36918 WP_000896102.1.36931 WP_000896102.1.37073 WP_000896102.1.37111 WP_000896102.1.37112 WP_000896102.1.37256 WP_000896102.1.37293 WP_000896102.1.37370 WP_000896102.1.37376 WP_000896102.1.3744 WP_000896102.1.37498 WP_000896102.1.37504 WP_000896102.1.37618 WP_000896102.1.37968 WP_000896102.1.37978 WP_000896102.1.38125 WP_000896102.1.38145 WP_000896102.1.383 WP_000896102.1.3848 WP_000896102.1.38613 WP_000896102.1.38673 WP_000896102.1.38693 WP_000896102.1.38773 WP_000896102.1.38882 WP_000896102.1.38913 WP_000896102.1.39003 WP_000896102.1.39136 WP_000896102.1.39197 WP_000896102.1.39229 WP_000896102.1.39405 WP_000896102.1.39420 WP_000896102.1.39449 WP_000896102.1.39512 WP_000896102.1.39629 WP_000896102.1.39763 WP_000896102.1.39862 WP_000896102.1.39921 WP_000896102.1.39923 WP_000896102.1.40017 WP_000896102.1.40072 WP_000896102.1.40073 WP_000896102.1.4011 WP_000896102.1.40208 WP_000896102.1.40240 WP_000896102.1.40257 WP_000896102.1.40292 WP_000896102.1.40305 WP_000896102.1.40311 WP_000896102.1.40380 WP_000896102.1.40395 WP_000896102.1.40465 WP_000896102.1.40710 WP_000896102.1.4075 WP_000896102.1.4087 WP_000896102.1.40877 WP_000896102.1.41017 WP_000896102.1.41086 WP_000896102.1.41091 WP_000896102.1.41226 WP_000896102.1.41279 WP_000896102.1.41516 WP_000896102.1.41554 WP_000896102.1.41572 WP_000896102.1.41591 WP_000896102.1.41662 WP_000896102.1.41708 WP_000896102.1.41761 WP_000896102.1.41882 WP_000896102.1.41979 WP_000896102.1.41985 WP_000896102.1.42104 WP_000896102.1.42320 WP_000896102.1.42342 WP_000896102.1.42422 WP_000896102.1.4276 WP_000896102.1.42767 WP_000896102.1.42864 WP_000896102.1.4288 WP_000896102.1.43018 WP_000896102.1.43041 WP_000896102.1.43244 WP_000896102.1.43312 WP_000896102.1.43334 WP_000896102.1.43437 WP_000896102.1.43522 WP_000896102.1.43613 WP_000896102.1.43668 WP_000896102.1.43886 WP_000896102.1.44005 WP_000896102.1.44043 WP_000896102.1.44099 WP_000896102.1.44121 WP_000896102.1.44291 WP_000896102.1.44310 WP_000896102.1.44386 WP_000896102.1.44479 WP_000896102.1.44640 WP_000896102.1.4467 WP_000896102.1.44747 WP_000896102.1.4485 WP_000896102.1.44877 WP_000896102.1.44927 WP_000896102.1.45067 WP_000896102.1.45074 WP_000896102.1.45079 WP_000896102.1.45177 WP_000896102.1.45184 WP_000896102.1.45259 WP_000896102.1.45349 WP_000896102.1.45365 WP_000896102.1.45550 WP_000896102.1.45585 WP_000896102.1.45660 WP_000896102.1.45690 WP_000896102.1.458 WP_000896102.1.46011 WP_000896102.1.46069 WP_000896102.1.46112 WP_000896102.1.46173 WP_000896102.1.46174 WP_000896102.1.46187 WP_000896102.1.46303 WP_000896102.1.46595 WP_000896102.1.46675 WP_000896102.1.47057 WP_000896102.1.47214 WP_000896102.1.47429 WP_000896102.1.47448 WP_000896102.1.4747 WP_000896102.1.47472 WP_000896102.1.47478 WP_000896102.1.47621 WP_000896102.1.47799 WP_000896102.1.48242 WP_000896102.1.48253 WP_000896102.1.483 WP_000896102.1.48367 WP_000896102.1.48377 WP_000896102.1.4853 WP_000896102.1.48788 WP_000896102.1.4885 WP_000896102.1.48876 WP_000896102.1.48894 WP_000896102.1.48919 WP_000896102.1.49084 WP_000896102.1.49155 WP_000896102.1.49204 WP_000896102.1.49239 WP_000896102.1.49256 WP_000896102.1.49276 WP_000896102.1.49290 WP_000896102.1.49340 WP_000896102.1.49366 WP_000896102.1.49490 WP_000896102.1.49515 WP_000896102.1.49572 WP_000896102.1.4979 WP_000896102.1.49803 WP_000896102.1.49805 WP_000896102.1.49929 WP_000896102.1.50080 WP_000896102.1.50161 WP_000896102.1.50211 WP_000896102.1.50376 WP_000896102.1.50389 WP_000896102.1.50676 WP_000896102.1.50804 WP_000896102.1.50808 WP_000896102.1.5088 WP_000896102.1.50908 WP_000896102.1.50941 WP_000896102.1.51014 WP_000896102.1.51022 WP_000896102.1.51179 WP_000896102.1.51182 WP_000896102.1.51186 WP_000896102.1.51487 WP_000896102.1.51488 WP_000896102.1.51634 WP_000896102.1.51649 WP_000896102.1.51686 WP_000896102.1.51911 WP_000896102.1.51932 WP_000896102.1.51989 WP_000896102.1.52121 WP_000896102.1.52346 WP_000896102.1.52353 WP_000896102.1.52361 WP_000896102.1.52653 WP_000896102.1.52656 WP_000896102.1.52743 WP_000896102.1.52851 WP_000896102.1.52857 WP_000896102.1.52898 WP_000896102.1.53190 WP_000896102.1.53406 WP_000896102.1.53466 WP_000896102.1.53529 WP_000896102.1.53543 WP_000896102.1.53757 WP_000896102.1.53812 WP_000896102.1.54033 WP_000896102.1.54075 WP_000896102.1.54196 WP_000896102.1.54209 WP_000896102.1.54271 WP_000896102.1.54274 WP_000896102.1.54319 WP_000896102.1.54364 WP_000896102.1.54400 WP_000896102.1.54644 WP_000896102.1.54662 WP_000896102.1.54722 WP_000896102.1.54749 WP_000896102.1.54764 WP_000896102.1.55008 WP_000896102.1.55152 WP_000896102.1.55156 WP_000896102.1.55285 WP_000896102.1.55475 WP_000896102.1.55743 WP_000896102.1.55768 WP_000896102.1.55782 WP_000896102.1.55796 WP_000896102.1.56002 WP_000896102.1.56012 WP_000896102.1.56105 WP_000896102.1.56238 WP_000896102.1.56304 WP_000896102.1.56414 WP_000896102.1.56438 WP_000896102.1.56560 WP_000896102.1.56601 WP_000896102.1.56614 WP_000896102.1.56671 WP_000896102.1.56682 WP_000896102.1.56875 WP_000896102.1.56877 WP_000896102.1.57168 WP_000896102.1.57187 WP_000896102.1.57377 WP_000896102.1.57433 WP_000896102.1.57515 WP_000896102.1.57529 WP_000896102.1.57576 WP_000896102.1.57601 WP_000896102.1.57607 WP_000896102.1.57763 WP_000896102.1.57862 WP_000896102.1.57890 WP_000896102.1.57891 WP_000896102.1.57978 WP_000896102.1.5801 WP_000896102.1.58041 WP_000896102.1.58144 WP_000896102.1.58548 WP_000896102.1.5858 WP_000896102.1.58662 WP_000896102.1.58669 WP_000896102.1.58745 WP_000896102.1.58803 WP_000896102.1.59094 WP_000896102.1.59224 WP_000896102.1.59375 WP_000896102.1.59458 WP_000896102.1.59490 WP_000896102.1.59508 WP_000896102.1.59684 WP_000896102.1.59694 WP_000896102.1.59771 WP_000896102.1.5979 WP_000896102.1.59953 WP_000896102.1.60008 WP_000896102.1.60021 WP_000896102.1.60069 WP_000896102.1.60140 WP_000896102.1.60155 WP_000896102.1.60285 WP_000896102.1.60379 WP_000896102.1.60874 WP_000896102.1.60941 WP_000896102.1.6114 WP_000896102.1.61232 WP_000896102.1.6129 WP_000896102.1.61296 WP_000896102.1.61345 WP_000896102.1.61417 WP_000896102.1.61574 WP_000896102.1.61712 WP_000896102.1.61714 WP_000896102.1.61730 WP_000896102.1.61857 WP_000896102.1.61918 WP_000896102.1.61952 WP_000896102.1.62007 WP_000896102.1.62025 WP_000896102.1.62204 WP_000896102.1.62304 WP_000896102.1.62374 WP_000896102.1.62403 WP_000896102.1.6253 WP_000896102.1.62903 WP_000896102.1.62910 WP_000896102.1.62955 WP_000896102.1.63181 WP_000896102.1.63203 WP_000896102.1.63256 WP_000896102.1.63290 WP_000896102.1.63382 WP_000896102.1.63461 WP_000896102.1.63479 WP_000896102.1.63577 WP_000896102.1.63664 WP_000896102.1.63718 WP_000896102.1.6375 WP_000896102.1.63757 WP_000896102.1.63834 WP_000896102.1.64046 WP_000896102.1.6423 WP_000896102.1.64244 WP_000896102.1.64403 WP_000896102.1.64649 WP_000896102.1.64702 WP_000896102.1.64757 WP_000896102.1.64781 WP_000896102.1.64831 WP_000896102.1.6489 WP_000896102.1.65018 WP_000896102.1.65028 WP_000896102.1.65171 WP_000896102.1.65248 WP_000896102.1.6535 WP_000896102.1.65474 WP_000896102.1.65633 WP_000896102.1.6565 WP_000896102.1.65696 WP_000896102.1.6575 WP_000896102.1.65782 WP_000896102.1.6630 WP_000896102.1.66314 WP_000896102.1.66358 WP_000896102.1.66362 WP_000896102.1.6638 WP_000896102.1.6640 WP_000896102.1.66698 WP_000896102.1.66834 WP_000896102.1.66901 WP_000896102.1.66962 WP_000896102.1.67037 WP_000896102.1.67045 WP_000896102.1.67181 WP_000896102.1.67268 WP_000896102.1.67347 WP_000896102.1.67465 WP_000896102.1.67552 WP_000896102.1.67682 WP_000896102.1.67829 WP_000896102.1.67887 WP_000896102.1.68073 WP_000896102.1.68201 WP_000896102.1.68206 WP_000896102.1.6827 WP_000896102.1.68275 WP_000896102.1.6849 WP_000896102.1.68547 WP_000896102.1.68589 WP_000896102.1.68655 WP_000896102.1.68656 WP_000896102.1.68778 WP_000896102.1.68787 WP_000896102.1.68894 WP_000896102.1.68928 WP_000896102.1.68975 WP_000896102.1.69006 WP_000896102.1.6913 WP_000896102.1.69146 WP_000896102.1.69255 WP_000896102.1.69397 WP_000896102.1.69564 WP_000896102.1.69644 WP_000896102.1.69704 WP_000896102.1.7021 WP_000896102.1.70241 WP_000896102.1.70269 WP_000896102.1.70289 WP_000896102.1.70447 WP_000896102.1.70643 WP_000896102.1.70683 WP_000896102.1.70883 WP_000896102.1.70922 WP_000896102.1.70948 WP_000896102.1.71010 WP_000896102.1.71116 WP_000896102.1.71146 WP_000896102.1.71165 WP_000896102.1.71188 WP_000896102.1.71202 WP_000896102.1.71243 WP_000896102.1.71306 WP_000896102.1.71337 WP_000896102.1.71378 WP_000896102.1.71401 WP_000896102.1.71702 WP_000896102.1.71750 WP_000896102.1.71845 WP_000896102.1.71881 WP_000896102.1.71908 WP_000896102.1.71952 WP_000896102.1.71973 WP_000896102.1.72105 WP_000896102.1.72203 WP_000896102.1.72376 WP_000896102.1.72594 WP_000896102.1.72871 WP_000896102.1.72975 WP_000896102.1.7315 WP_000896102.1.73200 WP_000896102.1.7334 WP_000896102.1.73377 WP_000896102.1.73481 WP_000896102.1.7356 WP_000896102.1.73581 WP_000896102.1.73617 WP_000896102.1.73753 WP_000896102.1.73758 WP_000896102.1.73794 WP_000896102.1.7387 WP_000896102.1.73924 WP_000896102.1.74029 WP_000896102.1.74181 WP_000896102.1.74191 WP_000896102.1.7433 WP_000896102.1.74379 WP_000896102.1.74410 WP_000896102.1.74466 WP_000896102.1.74529 WP_000896102.1.74545 WP_000896102.1.74745 WP_000896102.1.75129 WP_000896102.1.75187 WP_000896102.1.75288 WP_000896102.1.75334 WP_000896102.1.75362 WP_000896102.1.75385 WP_000896102.1.75392 WP_000896102.1.75760 WP_000896102.1.75764 WP_000896102.1.75837 WP_000896102.1.75874 WP_000896102.1.75945 WP_000896102.1.76020 WP_000896102.1.76252 WP_000896102.1.76445 WP_000896102.1.7660 WP_000896102.1.76673 WP_000896102.1.76706 WP_000896102.1.76721 WP_000896102.1.76756 WP_000896102.1.76760 WP_000896102.1.76875 WP_000896102.1.76880 WP_000896102.1.76899 WP_000896102.1.77038 WP_000896102.1.77047 WP_000896102.1.77080 WP_000896102.1.7712 WP_000896102.1.77180 WP_000896102.1.77244 WP_000896102.1.77292 WP_000896102.1.77349 WP_000896102.1.77514 WP_000896102.1.77529 WP_000896102.1.77549 WP_000896102.1.77692 WP_000896102.1.7782 WP_000896102.1.77851 WP_000896102.1.77898 WP_000896102.1.77918 WP_000896102.1.77960 WP_000896102.1.78076 WP_000896102.1.78096 WP_000896102.1.78100 WP_000896102.1.78110 WP_000896102.1.78120 WP_000896102.1.78383 WP_000896102.1.78407 WP_000896102.1.7861 WP_000896102.1.78618 WP_000896102.1.78673 WP_000896102.1.78735 WP_000896102.1.78802 WP_000896102.1.78830 WP_000896102.1.78871 WP_000896102.1.78874 WP_000896102.1.78918 WP_000896102.1.78930 WP_000896102.1.79151 WP_000896102.1.79167 WP_000896102.1.79335 WP_000896102.1.79462 WP_000896102.1.79472 WP_000896102.1.79490 WP_000896102.1.79495 WP_000896102.1.79529 WP_000896102.1.79570 WP_000896102.1.7964 WP_000896102.1.79659 WP_000896102.1.79668 WP_000896102.1.79708 WP_000896102.1.79845 WP_000896102.1.80077 WP_000896102.1.80137 WP_000896102.1.80182 WP_000896102.1.80296 WP_000896102.1.80366 WP_000896102.1.80831 WP_000896102.1.80850 WP_000896102.1.80881 WP_000896102.1.8096 WP_000896102.1.81037 WP_000896102.1.81069 WP_000896102.1.81149 WP_000896102.1.81175 WP_000896102.1.8119 WP_000896102.1.81193 WP_000896102.1.81354 WP_000896102.1.81425 WP_000896102.1.81785 WP_000896102.1.81902 WP_000896102.1.81974 WP_000896102.1.82337 WP_000896102.1.82479 WP_000896102.1.82503 WP_000896102.1.82515 WP_000896102.1.82676 WP_000896102.1.82761 WP_000896102.1.8282 WP_000896102.1.82944 WP_000896102.1.82956 WP_000896102.1.83092 WP_000896102.1.83163 WP_000896102.1.83305 WP_000896102.1.83413 WP_000896102.1.83491 WP_000896102.1.83523 WP_000896102.1.8354 WP_000896102.1.83721 WP_000896102.1.83760 WP_000896102.1.83995 WP_000896102.1.84103 WP_000896102.1.84283 WP_000896102.1.84392 WP_000896102.1.8441 WP_000896102.1.84532 WP_000896102.1.84554 WP_000896102.1.84659 WP_000896102.1.84899 WP_000896102.1.8497 WP_000896102.1.85040 WP_000896102.1.85134 WP_000896102.1.85178 WP_000896102.1.85190 WP_000896102.1.8533 WP_000896102.1.8545 WP_000896102.1.85481 WP_000896102.1.85483 WP_000896102.1.85541 WP_000896102.1.8556 WP_000896102.1.85615 WP_000896102.1.85617 WP_000896102.1.85663 WP_000896102.1.85671 WP_000896102.1.85672 WP_000896102.1.85777 WP_000896102.1.85886 WP_000896102.1.85900 WP_000896102.1.85904 WP_000896102.1.85976 WP_000896102.1.86356 WP_000896102.1.86450 WP_000896102.1.86469 WP_000896102.1.86580 WP_000896102.1.86588 WP_000896102.1.86661 WP_000896102.1.8672 WP_000896102.1.8678 WP_000896102.1.86810 WP_000896102.1.8684 WP_000896102.1.86895 WP_000896102.1.86906 WP_000896102.1.87095 WP_000896102.1.8736 WP_000896102.1.87460 WP_000896102.1.87552 WP_000896102.1.87779 WP_000896102.1.87945 WP_000896102.1.88019 WP_000896102.1.88073 WP_000896102.1.8809 WP_000896102.1.88291 WP_000896102.1.88293 WP_000896102.1.8837 WP_000896102.1.88393 WP_000896102.1.88703 WP_000896102.1.88792 WP_000896102.1.88902 WP_000896102.1.8891 WP_000896102.1.89008 WP_000896102.1.89116 WP_000896102.1.89138 WP_000896102.1.89304 WP_000896102.1.89512 WP_000896102.1.89527 WP_000896102.1.89570 WP_000896102.1.89604 WP_000896102.1.89622 WP_000896102.1.89659 WP_000896102.1.89902 WP_000896102.1.8996 WP_000896102.1.90097 WP_000896102.1.90252 WP_000896102.1.90417 WP_000896102.1.90453 WP_000896102.1.90458 WP_000896102.1.90557 WP_000896102.1.90585 WP_000896102.1.90641 WP_000896102.1.90734 WP_000896102.1.91003 WP_000896102.1.91069 WP_000896102.1.91278 WP_000896102.1.91512 WP_000896102.1.91564 WP_000896102.1.91628 WP_000896102.1.91655 WP_000896102.1.91724 WP_000896102.1.91732 WP_000896102.1.91788 WP_000896102.1.92013 WP_000896102.1.92093 WP_000896102.1.92108 WP_000896102.1.92183 WP_000896102.1.92208 WP_000896102.1.92268 WP_000896102.1.92310 WP_000896102.1.92443 WP_000896102.1.92482 WP_000896102.1.92531 WP_000896102.1.92669 WP_000896102.1.92671 WP_000896102.1.92738 WP_000896102.1.93086 WP_000896102.1.93101 WP_000896102.1.93136 WP_000896102.1.93155 WP_000896102.1.93365 WP_000896102.1.93543 WP_000896102.1.93650 WP_000896102.1.93656 WP_000896102.1.93662 WP_000896102.1.937 WP_000896102.1.93705 WP_000896102.1.93804 WP_000896102.1.9389 WP_000896102.1.93994 WP_000896102.1.94072 WP_000896102.1.94162 WP_000896102.1.94168 WP_000896102.1.94198 WP_000896102.1.9432 WP_000896102.1.94354 WP_000896102.1.94380 WP_000896102.1.94458 WP_000896102.1.94565 WP_000896102.1.94584 WP_000896102.1.94674 WP_000896102.1.94796 WP_000896102.1.94959 WP_000896102.1.95051 WP_000896102.1.95085 WP_000896102.1.95121 WP_000896102.1.95282 WP_000896102.1.95546 WP_000896102.1.95630 WP_000896102.1.95840 WP_000896102.1.95911 WP_000896102.1.96139 WP_000896102.1.96317 WP_000896102.1.96343 WP_000896102.1.9644 WP_000896102.1.96469 WP_000896102.1.96500 WP_000896102.1.96555 WP_000896102.1.96563 WP_000896102.1.96732 WP_000896102.1.96771 WP_000896102.1.97015 WP_000896102.1.97145 WP_000896102.1.97190 WP_000896102.1.97318 WP_000896102.1.97368 WP_000896102.1.97369 WP_000896102.1.97594 WP_000896102.1.97597 WP_000896102.1.97613 WP_000896102.1.97620 WP_000896102.1.97727 WP_000896102.1.97732 WP_000896102.1.97736 WP_000896102.1.9775 WP_000896102.1.97846 WP_000896102.1.98006 WP_000896102.1.98019 WP_000896102.1.98022 WP_000896102.1.98110 WP_000896102.1.98146 WP_000896102.1.98219 WP_000896102.1.9841 WP_000896102.1.98495 WP_000896102.1.98531 WP_000896102.1.98577 WP_000896102.1.98676 WP_000896102.1.98677 WP_000896102.1.98760 WP_000896102.1.98843 WP_000896102.1.9898 WP_000896102.1.99098 WP_000896102.1.99184 WP_000896102.1.99267 WP_000896102.1.99276 WP_000896102.1.99646 WP_000896102.1.99657 WP_000896102.1.99660 WP_000896102.1.99712 WP_000896102.1.99813 WP_000896102.1.99858 WP_000896102.1.99889 WP_000896102.1.99958 gi|526221400|ref|YP_008267214.1| gi|378985600|ref|YP_005248756.1| ABAO01000033|CDS_3740-1581 AE006468|CDS_3170031-3167872 CP001363|CDS_3189840-3187681 FN424405|CDS_3162041-3159882 gi|550902373|ref|YP_008671465.1| gi|378446365|ref|YP_005233997.1| 99287.STM3010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]