SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451789|ref|YP_005239149.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451789|ref|YP_005239149.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.17e-106
Family KduI-like 0.000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451789|ref|YP_005239149.1|
Sequence length 278
Comment 5-keto-4-deoxyuronate isomerase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MDVRQSIHSEHAKTLDTQALRREFLIENIFVADEYTMVYSHIDRIIVGGIMPVSHPVEIG
GEVGKQLGVSRLLDRRELGVINIGGAGAIIIDGQRHDIGHRDALYIGKGAKELVFVSNEA
SRPAKFYYNCAPAHTAYPTKKVSPADVAPVTLGDNLTSNRRTINKYFVPDVLETCQLSMG
LTELAPGNLWNTMPCHTHERRMEVYLYFNMEEDSCVFHMMGQPQETRHIVMRNEQAVISP
SWSIHSGVGTKAYTFVWGMVGENQVFDDMDHVAVQDLR
Download sequence
Identical sequences A0A0F6B6A6 A0A0W3MVH2
gi|378451789|ref|YP_005239149.1| gi|526222459|ref|YP_008267222.1| WP_000383266.1.100484 WP_000383266.1.100488 WP_000383266.1.101404 WP_000383266.1.11458 WP_000383266.1.13932 WP_000383266.1.14852 WP_000383266.1.17307 WP_000383266.1.17480 WP_000383266.1.17705 WP_000383266.1.19706 WP_000383266.1.2010 WP_000383266.1.21603 WP_000383266.1.2221 WP_000383266.1.25988 WP_000383266.1.26319 WP_000383266.1.2763 WP_000383266.1.27761 WP_000383266.1.28094 WP_000383266.1.28170 WP_000383266.1.30027 WP_000383266.1.3119 WP_000383266.1.31504 WP_000383266.1.31578 WP_000383266.1.32702 WP_000383266.1.34279 WP_000383266.1.35408 WP_000383266.1.37073 WP_000383266.1.37978 WP_000383266.1.3848 WP_000383266.1.4011 WP_000383266.1.40240 WP_000383266.1.40257 WP_000383266.1.42864 WP_000383266.1.43244 WP_000383266.1.44099 WP_000383266.1.4467 WP_000383266.1.45585 WP_000383266.1.47472 WP_000383266.1.49515 WP_000383266.1.50376 WP_000383266.1.50389 WP_000383266.1.51649 WP_000383266.1.54033 WP_000383266.1.54400 WP_000383266.1.55743 WP_000383266.1.55768 WP_000383266.1.56671 WP_000383266.1.58803 WP_000383266.1.5886 WP_000383266.1.59490 WP_000383266.1.62204 WP_000383266.1.64403 WP_000383266.1.6630 WP_000383266.1.67552 WP_000383266.1.69006 WP_000383266.1.7021 WP_000383266.1.71378 WP_000383266.1.71702 WP_000383266.1.72376 WP_000383266.1.7315 WP_000383266.1.75187 WP_000383266.1.75764 WP_000383266.1.79708 WP_000383266.1.80077 WP_000383266.1.80137 WP_000383266.1.82515 WP_000383266.1.8354 WP_000383266.1.84659 WP_000383266.1.85617 WP_000383266.1.87095 WP_000383266.1.87552 WP_000383266.1.88019 WP_000383266.1.89570 WP_000383266.1.90453 WP_000383266.1.91003 WP_000383266.1.92443 WP_000383266.1.92531 WP_000383266.1.93994 WP_000383266.1.94584 WP_000383266.1.95051 WP_000383266.1.97145 WP_000383266.1.98019 WP_000383266.1.98219 WP_000383266.1.98677 WP_000383266.1.99712 gi|378990339|ref|YP_005253503.1| ABAO01000033|CDS_12937-12101 CP001363|CDS_3199037-3198201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]