SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451883|ref|YP_005239243.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451883|ref|YP_005239243.1|
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.67e-43
Family Putative Holliday junction resolvase RuvX 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451883|ref|YP_005239243.1|
Sequence length 138
Comment Holliday junction resolvase-like protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSGTLLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWTLIERLLKEWQPDEIIVG
LPLNMDGTEQPLTARARKFANRIHGRFGVTVTLHDERLSTVEARSGLFERGGYRALNKGK
VDSASAVIILESYFEQGY
Download sequence
Identical sequences A0A0D6IED1 A0A0F6B6K0 A0A0F7J9Y4 A0A0H3NLX7 A0A0L5XCS1 A0A0R9N4P7 A0A0T9Y149 A0A0U1IBX7 A0A0W4JTD5 A0A1C2ZXR4 A0A1S0ZHQ5 A0A1X2RKP8 A0A1X2V0A5 A0A1Z3Q6M3 A0A267SLR6 A0A2C6FN59 A0A2D1XAF1 A0A2D1XMU2 A0A2D3AG98 A0A2H9YIV4 A0A2I6MHK8 A0A2I6MVI0 A0A2I6N9G8 A0A2I6NM94 A0A2I6P068 B4T5K4 E8XAE6 G4BYD6 G5MN38 G5QPF4 G5S0F4 Q8ZM50 S5HKE4 V1H0W0 V7IVP6 V7V3H1
gi|525837041|ref|YP_008253721.1| gi|526221467|ref|YP_008267302.1| gi|525946173|ref|YP_008307234.1| gi|378451883|ref|YP_005239243.1| ABAM02000001|CDS_3632373-3632789 ABAN01000013|CDS_127967-127551 ABAO01000002|CDS_202551-202135 ABEH02000003|CDS_272833-273249 ABFH02000001|CDS_1922921-1922505 AE006468|CDS_3258665-3259081 CP001113|CDS_3247997-3248413 CP001363|CDS_3277787-3278203 FN424405|CDS_3249906-3250322 NZ_ACBF01000001|CDS_418667-419083 423368.SNSL254_A3344 99287.STM3097 gi|194442861|ref|YP_002042356.1| gi|482905662|ref|YP_007904222.1| gi|378985690|ref|YP_005248846.1| gi|550902459|ref|YP_008671551.1| gi|379702354|ref|YP_005244082.1| gi|383497759|ref|YP_005398448.1| gi|525858842|ref|YP_008262236.1| gi|378446449|ref|YP_005234081.1| gi|16766398|ref|NP_462013.1| gi|452123088|ref|YP_007473336.1| gi|549725661|ref|YP_008645851.1| NP_462013.1.58477 WP_000017096.1.100007 WP_000017096.1.100010 WP_000017096.1.100115 WP_000017096.1.100137 WP_000017096.1.100165 WP_000017096.1.1002 WP_000017096.1.100234 WP_000017096.1.100258 WP_000017096.1.100376 WP_000017096.1.100413 WP_000017096.1.100424 WP_000017096.1.100436 WP_000017096.1.100438 WP_000017096.1.100484 WP_000017096.1.100488 WP_000017096.1.100502 WP_000017096.1.100521 WP_000017096.1.100589 WP_000017096.1.100597 WP_000017096.1.100650 WP_000017096.1.100707 WP_000017096.1.100711 WP_000017096.1.100714 WP_000017096.1.10076 WP_000017096.1.100773 WP_000017096.1.100781 WP_000017096.1.100793 WP_000017096.1.100869 WP_000017096.1.100870 WP_000017096.1.100871 WP_000017096.1.100882 WP_000017096.1.100886 WP_000017096.1.101007 WP_000017096.1.101020 WP_000017096.1.101074 WP_000017096.1.101078 WP_000017096.1.101094 WP_000017096.1.101180 WP_000017096.1.101185 WP_000017096.1.101199 WP_000017096.1.101259 WP_000017096.1.101284 WP_000017096.1.101291 WP_000017096.1.101320 WP_000017096.1.101353 WP_000017096.1.101386 WP_000017096.1.101404 WP_000017096.1.101420 WP_000017096.1.101425 WP_000017096.1.101473 WP_000017096.1.101589 WP_000017096.1.101639 WP_000017096.1.101666 WP_000017096.1.101734 WP_000017096.1.101815 WP_000017096.1.101868 WP_000017096.1.101878 WP_000017096.1.101953 WP_000017096.1.102009 WP_000017096.1.102103 WP_000017096.1.10220 WP_000017096.1.10266 WP_000017096.1.10310 WP_000017096.1.10429 WP_000017096.1.10439 WP_000017096.1.10463 WP_000017096.1.10568 WP_000017096.1.10675 WP_000017096.1.10678 WP_000017096.1.10753 WP_000017096.1.10992 WP_000017096.1.11000 WP_000017096.1.11024 WP_000017096.1.11031 WP_000017096.1.11041 WP_000017096.1.11098 WP_000017096.1.11168 WP_000017096.1.11190 WP_000017096.1.11213 WP_000017096.1.11295 WP_000017096.1.113 WP_000017096.1.11362 WP_000017096.1.1137 WP_000017096.1.11405 WP_000017096.1.11455 WP_000017096.1.11458 WP_000017096.1.11479 WP_000017096.1.11518 WP_000017096.1.11532 WP_000017096.1.11543 WP_000017096.1.11544 WP_000017096.1.11603 WP_000017096.1.11681 WP_000017096.1.11763 WP_000017096.1.11772 WP_000017096.1.11897 WP_000017096.1.11936 WP_000017096.1.12025 WP_000017096.1.12047 WP_000017096.1.12114 WP_000017096.1.12144 WP_000017096.1.12160 WP_000017096.1.12244 WP_000017096.1.12280 WP_000017096.1.12282 WP_000017096.1.12351 WP_000017096.1.12370 WP_000017096.1.12396 WP_000017096.1.12484 WP_000017096.1.12546 WP_000017096.1.12584 WP_000017096.1.1264 WP_000017096.1.12718 WP_000017096.1.12728 WP_000017096.1.12877 WP_000017096.1.12879 WP_000017096.1.12936 WP_000017096.1.1299 WP_000017096.1.12995 WP_000017096.1.13027 WP_000017096.1.13106 WP_000017096.1.13130 WP_000017096.1.1326 WP_000017096.1.13334 WP_000017096.1.13414 WP_000017096.1.13488 WP_000017096.1.13509 WP_000017096.1.13669 WP_000017096.1.13677 WP_000017096.1.13741 WP_000017096.1.13819 WP_000017096.1.1387 WP_000017096.1.13908 WP_000017096.1.13932 WP_000017096.1.13968 WP_000017096.1.14001 WP_000017096.1.14011 WP_000017096.1.14041 WP_000017096.1.14151 WP_000017096.1.14212 WP_000017096.1.14239 WP_000017096.1.14286 WP_000017096.1.14320 WP_000017096.1.14379 WP_000017096.1.14406 WP_000017096.1.14410 WP_000017096.1.14446 WP_000017096.1.14466 WP_000017096.1.14505 WP_000017096.1.14516 WP_000017096.1.14519 WP_000017096.1.14524 WP_000017096.1.14554 WP_000017096.1.14688 WP_000017096.1.14706 WP_000017096.1.14725 WP_000017096.1.14852 WP_000017096.1.1489 WP_000017096.1.14927 WP_000017096.1.14932 WP_000017096.1.15046 WP_000017096.1.15055 WP_000017096.1.15100 WP_000017096.1.15124 WP_000017096.1.15223 WP_000017096.1.15226 WP_000017096.1.15316 WP_000017096.1.15369 WP_000017096.1.1540 WP_000017096.1.15483 WP_000017096.1.15508 WP_000017096.1.15586 WP_000017096.1.15616 WP_000017096.1.15625 WP_000017096.1.15644 WP_000017096.1.15708 WP_000017096.1.15784 WP_000017096.1.15830 WP_000017096.1.15881 WP_000017096.1.1592 WP_000017096.1.16032 WP_000017096.1.16062 WP_000017096.1.16063 WP_000017096.1.16103 WP_000017096.1.1611 WP_000017096.1.16166 WP_000017096.1.16201 WP_000017096.1.16226 WP_000017096.1.16233 WP_000017096.1.16284 WP_000017096.1.16328 WP_000017096.1.16331 WP_000017096.1.1635 WP_000017096.1.16468 WP_000017096.1.16565 WP_000017096.1.16581 WP_000017096.1.16614 WP_000017096.1.16650 WP_000017096.1.1668 WP_000017096.1.16686 WP_000017096.1.16691 WP_000017096.1.167 WP_000017096.1.16732 WP_000017096.1.16735 WP_000017096.1.16736 WP_000017096.1.16786 WP_000017096.1.16817 WP_000017096.1.16819 WP_000017096.1.16855 WP_000017096.1.16858 WP_000017096.1.16896 WP_000017096.1.16916 WP_000017096.1.16941 WP_000017096.1.16942 WP_000017096.1.16944 WP_000017096.1.16965 WP_000017096.1.1700 WP_000017096.1.17285 WP_000017096.1.17307 WP_000017096.1.1737 WP_000017096.1.17390 WP_000017096.1.174 WP_000017096.1.17447 WP_000017096.1.17480 WP_000017096.1.17546 WP_000017096.1.17702 WP_000017096.1.17703 WP_000017096.1.17705 WP_000017096.1.17747 WP_000017096.1.17865 WP_000017096.1.17919 WP_000017096.1.17991 WP_000017096.1.18019 WP_000017096.1.18022 WP_000017096.1.1807 WP_000017096.1.18103 WP_000017096.1.18111 WP_000017096.1.1814 WP_000017096.1.18163 WP_000017096.1.18177 WP_000017096.1.18192 WP_000017096.1.18265 WP_000017096.1.18267 WP_000017096.1.18281 WP_000017096.1.18282 WP_000017096.1.18468 WP_000017096.1.18485 WP_000017096.1.18607 WP_000017096.1.18692 WP_000017096.1.18705 WP_000017096.1.18715 WP_000017096.1.18776 WP_000017096.1.18822 WP_000017096.1.18881 WP_000017096.1.18895 WP_000017096.1.18940 WP_000017096.1.18949 WP_000017096.1.1897 WP_000017096.1.19030 WP_000017096.1.19038 WP_000017096.1.19053 WP_000017096.1.19055 WP_000017096.1.19064 WP_000017096.1.19240 WP_000017096.1.19320 WP_000017096.1.19340 WP_000017096.1.1935 WP_000017096.1.19357 WP_000017096.1.1939 WP_000017096.1.19458 WP_000017096.1.19460 WP_000017096.1.19461 WP_000017096.1.1954 WP_000017096.1.19614 WP_000017096.1.19642 WP_000017096.1.19683 WP_000017096.1.19702 WP_000017096.1.19706 WP_000017096.1.19724 WP_000017096.1.19749 WP_000017096.1.19784 WP_000017096.1.19802 WP_000017096.1.19809 WP_000017096.1.19823 WP_000017096.1.19863 WP_000017096.1.19867 WP_000017096.1.19884 WP_000017096.1.19967 WP_000017096.1.19970 WP_000017096.1.1998 WP_000017096.1.19987 WP_000017096.1.20 WP_000017096.1.20023 WP_000017096.1.20034 WP_000017096.1.20091 WP_000017096.1.2010 WP_000017096.1.20119 WP_000017096.1.20212 WP_000017096.1.20266 WP_000017096.1.20271 WP_000017096.1.20330 WP_000017096.1.20362 WP_000017096.1.20391 WP_000017096.1.20418 WP_000017096.1.20425 WP_000017096.1.20443 WP_000017096.1.20525 WP_000017096.1.2054 WP_000017096.1.20553 WP_000017096.1.20573 WP_000017096.1.20626 WP_000017096.1.20646 WP_000017096.1.20695 WP_000017096.1.20700 WP_000017096.1.20721 WP_000017096.1.20760 WP_000017096.1.20886 WP_000017096.1.20908 WP_000017096.1.2101 WP_000017096.1.21049 WP_000017096.1.21086 WP_000017096.1.21089 WP_000017096.1.21146 WP_000017096.1.21165 WP_000017096.1.21181 WP_000017096.1.21245 WP_000017096.1.21246 WP_000017096.1.21260 WP_000017096.1.21269 WP_000017096.1.2130 WP_000017096.1.21400 WP_000017096.1.21423 WP_000017096.1.21453 WP_000017096.1.21497 WP_000017096.1.21499 WP_000017096.1.21548 WP_000017096.1.21603 WP_000017096.1.21692 WP_000017096.1.21730 WP_000017096.1.21750 WP_000017096.1.21751 WP_000017096.1.21757 WP_000017096.1.21792 WP_000017096.1.21877 WP_000017096.1.21981 WP_000017096.1.22024 WP_000017096.1.22030 WP_000017096.1.2205 WP_000017096.1.22062 WP_000017096.1.22067 WP_000017096.1.2221 WP_000017096.1.2224 WP_000017096.1.22240 WP_000017096.1.22315 WP_000017096.1.2235 WP_000017096.1.22379 WP_000017096.1.22388 WP_000017096.1.22427 WP_000017096.1.22453 WP_000017096.1.2246 WP_000017096.1.22485 WP_000017096.1.22514 WP_000017096.1.22537 WP_000017096.1.22575 WP_000017096.1.22604 WP_000017096.1.22620 WP_000017096.1.22676 WP_000017096.1.2283 WP_000017096.1.22855 WP_000017096.1.22870 WP_000017096.1.22979 WP_000017096.1.23010 WP_000017096.1.23102 WP_000017096.1.23114 WP_000017096.1.2314 WP_000017096.1.23155 WP_000017096.1.23192 WP_000017096.1.23201 WP_000017096.1.23259 WP_000017096.1.23274 WP_000017096.1.23409 WP_000017096.1.23444 WP_000017096.1.23460 WP_000017096.1.23466 WP_000017096.1.23472 WP_000017096.1.23482 WP_000017096.1.23485 WP_000017096.1.23529 WP_000017096.1.23587 WP_000017096.1.23621 WP_000017096.1.23629 WP_000017096.1.23634 WP_000017096.1.2364 WP_000017096.1.23643 WP_000017096.1.23685 WP_000017096.1.23707 WP_000017096.1.23736 WP_000017096.1.23819 WP_000017096.1.23932 WP_000017096.1.24017 WP_000017096.1.24158 WP_000017096.1.24206 WP_000017096.1.24259 WP_000017096.1.24308 WP_000017096.1.24325 WP_000017096.1.24376 WP_000017096.1.24450 WP_000017096.1.24555 WP_000017096.1.24567 WP_000017096.1.24578 WP_000017096.1.24727 WP_000017096.1.24737 WP_000017096.1.24779 WP_000017096.1.24873 WP_000017096.1.25008 WP_000017096.1.25015 WP_000017096.1.25036 WP_000017096.1.25206 WP_000017096.1.25217 WP_000017096.1.25405 WP_000017096.1.25454 WP_000017096.1.25493 WP_000017096.1.25498 WP_000017096.1.2554 WP_000017096.1.25596 WP_000017096.1.25668 WP_000017096.1.25690 WP_000017096.1.2570 WP_000017096.1.25703 WP_000017096.1.25708 WP_000017096.1.25740 WP_000017096.1.25793 WP_000017096.1.2581 WP_000017096.1.25814 WP_000017096.1.25825 WP_000017096.1.25932 WP_000017096.1.25944 WP_000017096.1.25988 WP_000017096.1.26030 WP_000017096.1.26034 WP_000017096.1.26075 WP_000017096.1.26093 WP_000017096.1.26129 WP_000017096.1.26213 WP_000017096.1.26224 WP_000017096.1.26269 WP_000017096.1.26282 WP_000017096.1.26311 WP_000017096.1.26319 WP_000017096.1.2634 WP_000017096.1.26363 WP_000017096.1.26426 WP_000017096.1.26429 WP_000017096.1.26440 WP_000017096.1.26493 WP_000017096.1.26512 WP_000017096.1.26551 WP_000017096.1.26563 WP_000017096.1.26567 WP_000017096.1.26576 WP_000017096.1.26582 WP_000017096.1.2660 WP_000017096.1.26646 WP_000017096.1.2667 WP_000017096.1.26709 WP_000017096.1.26758 WP_000017096.1.26787 WP_000017096.1.26856 WP_000017096.1.27010 WP_000017096.1.27055 WP_000017096.1.27122 WP_000017096.1.27169 WP_000017096.1.27173 WP_000017096.1.27206 WP_000017096.1.27279 WP_000017096.1.27419 WP_000017096.1.27423 WP_000017096.1.27556 WP_000017096.1.27561 WP_000017096.1.2763 WP_000017096.1.27665 WP_000017096.1.27707 WP_000017096.1.27761 WP_000017096.1.2777 WP_000017096.1.27776 WP_000017096.1.27857 WP_000017096.1.27977 WP_000017096.1.28094 WP_000017096.1.28116 WP_000017096.1.28126 WP_000017096.1.28170 WP_000017096.1.28225 WP_000017096.1.28302 WP_000017096.1.28370 WP_000017096.1.28393 WP_000017096.1.28538 WP_000017096.1.28575 WP_000017096.1.28612 WP_000017096.1.28625 WP_000017096.1.28655 WP_000017096.1.28694 WP_000017096.1.287 WP_000017096.1.28775 WP_000017096.1.2879 WP_000017096.1.2890 WP_000017096.1.28902 WP_000017096.1.28921 WP_000017096.1.28938 WP_000017096.1.28946 WP_000017096.1.29006 WP_000017096.1.29010 WP_000017096.1.2910 WP_000017096.1.29190 WP_000017096.1.29588 WP_000017096.1.29593 WP_000017096.1.29601 WP_000017096.1.29606 WP_000017096.1.29615 WP_000017096.1.29619 WP_000017096.1.29704 WP_000017096.1.29775 WP_000017096.1.29898 WP_000017096.1.29924 WP_000017096.1.29969 WP_000017096.1.30006 WP_000017096.1.30018 WP_000017096.1.30027 WP_000017096.1.30086 WP_000017096.1.30093 WP_000017096.1.3017 WP_000017096.1.30180 WP_000017096.1.30246 WP_000017096.1.30389 WP_000017096.1.30469 WP_000017096.1.30505 WP_000017096.1.30507 WP_000017096.1.30535 WP_000017096.1.30547 WP_000017096.1.30573 WP_000017096.1.30602 WP_000017096.1.30635 WP_000017096.1.30794 WP_000017096.1.30803 WP_000017096.1.30833 WP_000017096.1.30835 WP_000017096.1.30909 WP_000017096.1.30934 WP_000017096.1.3095 WP_000017096.1.30951 WP_000017096.1.30972 WP_000017096.1.31 WP_000017096.1.31042 WP_000017096.1.31086 WP_000017096.1.31107 WP_000017096.1.3113 WP_000017096.1.31185 WP_000017096.1.3119 WP_000017096.1.31190 WP_000017096.1.31195 WP_000017096.1.31196 WP_000017096.1.31210 WP_000017096.1.31214 WP_000017096.1.31219 WP_000017096.1.3124 WP_000017096.1.31251 WP_000017096.1.3127 WP_000017096.1.31281 WP_000017096.1.31362 WP_000017096.1.31476 WP_000017096.1.31504 WP_000017096.1.31515 WP_000017096.1.31578 WP_000017096.1.31658 WP_000017096.1.3170 WP_000017096.1.31762 WP_000017096.1.31782 WP_000017096.1.31854 WP_000017096.1.31927 WP_000017096.1.31940 WP_000017096.1.31967 WP_000017096.1.31972 WP_000017096.1.32038 WP_000017096.1.32054 WP_000017096.1.32192 WP_000017096.1.32206 WP_000017096.1.32275 WP_000017096.1.32277 WP_000017096.1.32357 WP_000017096.1.32408 WP_000017096.1.32424 WP_000017096.1.32438 WP_000017096.1.32459 WP_000017096.1.32515 WP_000017096.1.32527 WP_000017096.1.32643 WP_000017096.1.32660 WP_000017096.1.32702 WP_000017096.1.32714 WP_000017096.1.32747 WP_000017096.1.32750 WP_000017096.1.32786 WP_000017096.1.32804 WP_000017096.1.32860 WP_000017096.1.32900 WP_000017096.1.32907 WP_000017096.1.33030 WP_000017096.1.33078 WP_000017096.1.3310 WP_000017096.1.33127 WP_000017096.1.33143 WP_000017096.1.33144 WP_000017096.1.33248 WP_000017096.1.33261 WP_000017096.1.333 WP_000017096.1.33392 WP_000017096.1.33492 WP_000017096.1.33553 WP_000017096.1.33592 WP_000017096.1.33609 WP_000017096.1.33870 WP_000017096.1.33894 WP_000017096.1.3395 WP_000017096.1.34043 WP_000017096.1.34075 WP_000017096.1.34107 WP_000017096.1.34179 WP_000017096.1.34184 WP_000017096.1.34257 WP_000017096.1.34279 WP_000017096.1.34319 WP_000017096.1.34330 WP_000017096.1.3445 WP_000017096.1.34453 WP_000017096.1.34610 WP_000017096.1.34647 WP_000017096.1.34659 WP_000017096.1.34667 WP_000017096.1.34817 WP_000017096.1.34856 WP_000017096.1.34975 WP_000017096.1.34977 WP_000017096.1.35035 WP_000017096.1.35045 WP_000017096.1.35075 WP_000017096.1.35125 WP_000017096.1.35129 WP_000017096.1.35184 WP_000017096.1.35294 WP_000017096.1.35404 WP_000017096.1.35408 WP_000017096.1.35425 WP_000017096.1.35429 WP_000017096.1.35446 WP_000017096.1.35460 WP_000017096.1.35463 WP_000017096.1.35503 WP_000017096.1.35509 WP_000017096.1.35590 WP_000017096.1.3566 WP_000017096.1.35868 WP_000017096.1.35940 WP_000017096.1.35993 WP_000017096.1.36003 WP_000017096.1.3601 WP_000017096.1.3610 WP_000017096.1.36157 WP_000017096.1.36232 WP_000017096.1.36236 WP_000017096.1.36425 WP_000017096.1.36564 WP_000017096.1.36592 WP_000017096.1.36609 WP_000017096.1.36652 WP_000017096.1.36690 WP_000017096.1.3670 WP_000017096.1.36705 WP_000017096.1.3688 WP_000017096.1.36899 WP_000017096.1.36918 WP_000017096.1.36931 WP_000017096.1.37028 WP_000017096.1.37073 WP_000017096.1.37111 WP_000017096.1.37112 WP_000017096.1.37256 WP_000017096.1.37293 WP_000017096.1.37370 WP_000017096.1.37376 WP_000017096.1.3744 WP_000017096.1.37498 WP_000017096.1.37504 WP_000017096.1.37558 WP_000017096.1.37618 WP_000017096.1.37666 WP_000017096.1.37687 WP_000017096.1.37719 WP_000017096.1.37848 WP_000017096.1.37968 WP_000017096.1.37978 WP_000017096.1.38001 WP_000017096.1.38125 WP_000017096.1.38145 WP_000017096.1.38199 WP_000017096.1.383 WP_000017096.1.38341 WP_000017096.1.38408 WP_000017096.1.3848 WP_000017096.1.38609 WP_000017096.1.38613 WP_000017096.1.38673 WP_000017096.1.3869 WP_000017096.1.38693 WP_000017096.1.38773 WP_000017096.1.38797 WP_000017096.1.38882 WP_000017096.1.38898 WP_000017096.1.3891 WP_000017096.1.38913 WP_000017096.1.39003 WP_000017096.1.39059 WP_000017096.1.39075 WP_000017096.1.39082 WP_000017096.1.39136 WP_000017096.1.39146 WP_000017096.1.39197 WP_000017096.1.39229 WP_000017096.1.39311 WP_000017096.1.39385 WP_000017096.1.39405 WP_000017096.1.39420 WP_000017096.1.39449 WP_000017096.1.39466 WP_000017096.1.39512 WP_000017096.1.39553 WP_000017096.1.39556 WP_000017096.1.39629 WP_000017096.1.39722 WP_000017096.1.39723 WP_000017096.1.39763 WP_000017096.1.39862 WP_000017096.1.39921 WP_000017096.1.39923 WP_000017096.1.40017 WP_000017096.1.40072 WP_000017096.1.40073 WP_000017096.1.4011 WP_000017096.1.40155 WP_000017096.1.40170 WP_000017096.1.40171 WP_000017096.1.40205 WP_000017096.1.40208 WP_000017096.1.40240 WP_000017096.1.40257 WP_000017096.1.40292 WP_000017096.1.40305 WP_000017096.1.40311 WP_000017096.1.40380 WP_000017096.1.40395 WP_000017096.1.40465 WP_000017096.1.40492 WP_000017096.1.40583 WP_000017096.1.40605 WP_000017096.1.40710 WP_000017096.1.4075 WP_000017096.1.40788 WP_000017096.1.4087 WP_000017096.1.40877 WP_000017096.1.4088 WP_000017096.1.40935 WP_000017096.1.41017 WP_000017096.1.41048 WP_000017096.1.41050 WP_000017096.1.41086 WP_000017096.1.41091 WP_000017096.1.41225 WP_000017096.1.41226 WP_000017096.1.41279 WP_000017096.1.41310 WP_000017096.1.41375 WP_000017096.1.41440 WP_000017096.1.41468 WP_000017096.1.41516 WP_000017096.1.41554 WP_000017096.1.41572 WP_000017096.1.41591 WP_000017096.1.41662 WP_000017096.1.41708 WP_000017096.1.41735 WP_000017096.1.41761 WP_000017096.1.41859 WP_000017096.1.41882 WP_000017096.1.41897 WP_000017096.1.41938 WP_000017096.1.41979 WP_000017096.1.41985 WP_000017096.1.41994 WP_000017096.1.42104 WP_000017096.1.42276 WP_000017096.1.42320 WP_000017096.1.42328 WP_000017096.1.42342 WP_000017096.1.4239 WP_000017096.1.42422 WP_000017096.1.42489 WP_000017096.1.42491 WP_000017096.1.4276 WP_000017096.1.42767 WP_000017096.1.42797 WP_000017096.1.42829 WP_000017096.1.42864 WP_000017096.1.4288 WP_000017096.1.42887 WP_000017096.1.42957 WP_000017096.1.42978 WP_000017096.1.43018 WP_000017096.1.43041 WP_000017096.1.43086 WP_000017096.1.43149 WP_000017096.1.43160 WP_000017096.1.43244 WP_000017096.1.43258 WP_000017096.1.43272 WP_000017096.1.43299 WP_000017096.1.43312 WP_000017096.1.4332 WP_000017096.1.43334 WP_000017096.1.43351 WP_000017096.1.43437 WP_000017096.1.43476 WP_000017096.1.43522 WP_000017096.1.43535 WP_000017096.1.43613 WP_000017096.1.43668 WP_000017096.1.43763 WP_000017096.1.43864 WP_000017096.1.43873 WP_000017096.1.43875 WP_000017096.1.43886 WP_000017096.1.44005 WP_000017096.1.4404 WP_000017096.1.44043 WP_000017096.1.4405 WP_000017096.1.44099 WP_000017096.1.44113 WP_000017096.1.44121 WP_000017096.1.44250 WP_000017096.1.44291 WP_000017096.1.44310 WP_000017096.1.44380 WP_000017096.1.44386 WP_000017096.1.4440 WP_000017096.1.44438 WP_000017096.1.44440 WP_000017096.1.44479 WP_000017096.1.44549 WP_000017096.1.44578 WP_000017096.1.44607 WP_000017096.1.44640 WP_000017096.1.4467 WP_000017096.1.44747 WP_000017096.1.44781 WP_000017096.1.44791 WP_000017096.1.44795 WP_000017096.1.4485 WP_000017096.1.44877 WP_000017096.1.44887 WP_000017096.1.44927 WP_000017096.1.44971 WP_000017096.1.44985 WP_000017096.1.45038 WP_000017096.1.45045 WP_000017096.1.45067 WP_000017096.1.45074 WP_000017096.1.45079 WP_000017096.1.45098 WP_000017096.1.45138 WP_000017096.1.45177 WP_000017096.1.45184 WP_000017096.1.45259 WP_000017096.1.45344 WP_000017096.1.45349 WP_000017096.1.45351 WP_000017096.1.45365 WP_000017096.1.45402 WP_000017096.1.45462 WP_000017096.1.45522 WP_000017096.1.45550 WP_000017096.1.45585 WP_000017096.1.45660 WP_000017096.1.45690 WP_000017096.1.45797 WP_000017096.1.458 WP_000017096.1.45973 WP_000017096.1.45984 WP_000017096.1.46011 WP_000017096.1.46028 WP_000017096.1.46069 WP_000017096.1.46091 WP_000017096.1.46112 WP_000017096.1.46173 WP_000017096.1.46174 WP_000017096.1.46187 WP_000017096.1.46232 WP_000017096.1.46243 WP_000017096.1.46250 WP_000017096.1.46286 WP_000017096.1.46299 WP_000017096.1.46303 WP_000017096.1.46322 WP_000017096.1.46499 WP_000017096.1.46574 WP_000017096.1.46595 WP_000017096.1.46666 WP_000017096.1.46675 WP_000017096.1.46693 WP_000017096.1.46730 WP_000017096.1.46749 WP_000017096.1.46930 WP_000017096.1.46961 WP_000017096.1.47005 WP_000017096.1.47057 WP_000017096.1.47058 WP_000017096.1.47067 WP_000017096.1.47214 WP_000017096.1.47429 WP_000017096.1.47442 WP_000017096.1.47448 WP_000017096.1.4747 WP_000017096.1.47472 WP_000017096.1.47478 WP_000017096.1.47482 WP_000017096.1.47621 WP_000017096.1.47649 WP_000017096.1.4769 WP_000017096.1.47714 WP_000017096.1.47799 WP_000017096.1.47814 WP_000017096.1.48209 WP_000017096.1.48242 WP_000017096.1.48244 WP_000017096.1.48253 WP_000017096.1.48262 WP_000017096.1.48367 WP_000017096.1.48377 WP_000017096.1.48399 WP_000017096.1.4853 WP_000017096.1.48570 WP_000017096.1.48647 WP_000017096.1.48774 WP_000017096.1.48788 WP_000017096.1.4885 WP_000017096.1.48886 WP_000017096.1.48894 WP_000017096.1.48896 WP_000017096.1.48908 WP_000017096.1.48919 WP_000017096.1.48985 WP_000017096.1.49005 WP_000017096.1.49084 WP_000017096.1.49102 WP_000017096.1.49155 WP_000017096.1.49204 WP_000017096.1.49226 WP_000017096.1.49239 WP_000017096.1.49256 WP_000017096.1.49276 WP_000017096.1.49290 WP_000017096.1.49304 WP_000017096.1.49340 WP_000017096.1.49366 WP_000017096.1.49443 WP_000017096.1.49472 WP_000017096.1.49490 WP_000017096.1.49515 WP_000017096.1.49572 WP_000017096.1.49574 WP_000017096.1.49595 WP_000017096.1.49602 WP_000017096.1.49626 WP_000017096.1.49630 WP_000017096.1.49778 WP_000017096.1.4979 WP_000017096.1.49803 WP_000017096.1.49805 WP_000017096.1.49827 WP_000017096.1.49848 WP_000017096.1.49929 WP_000017096.1.49931 WP_000017096.1.50007 WP_000017096.1.50080 WP_000017096.1.5009 WP_000017096.1.50161 WP_000017096.1.50198 WP_000017096.1.50211 WP_000017096.1.50238 WP_000017096.1.50374 WP_000017096.1.50376 WP_000017096.1.50389 WP_000017096.1.50413 WP_000017096.1.50469 WP_000017096.1.50478 WP_000017096.1.50563 WP_000017096.1.50576 WP_000017096.1.50593 WP_000017096.1.50676 WP_000017096.1.50774 WP_000017096.1.50782 WP_000017096.1.50804 WP_000017096.1.50808 WP_000017096.1.50811 WP_000017096.1.5088 WP_000017096.1.50893 WP_000017096.1.50908 WP_000017096.1.50941 WP_000017096.1.51014 WP_000017096.1.51022 WP_000017096.1.51117 WP_000017096.1.51162 WP_000017096.1.51178 WP_000017096.1.51179 WP_000017096.1.51182 WP_000017096.1.51186 WP_000017096.1.51331 WP_000017096.1.5138 WP_000017096.1.51414 WP_000017096.1.51419 WP_000017096.1.51487 WP_000017096.1.51488 WP_000017096.1.51555 WP_000017096.1.51611 WP_000017096.1.51634 WP_000017096.1.51649 WP_000017096.1.51686 WP_000017096.1.51700 WP_000017096.1.51756 WP_000017096.1.51900 WP_000017096.1.51911 WP_000017096.1.51932 WP_000017096.1.51989 WP_000017096.1.52121 WP_000017096.1.52148 WP_000017096.1.52156 WP_000017096.1.52346 WP_000017096.1.52353 WP_000017096.1.52361 WP_000017096.1.52438 WP_000017096.1.52446 WP_000017096.1.52608 WP_000017096.1.52637 WP_000017096.1.52653 WP_000017096.1.52656 WP_000017096.1.52675 WP_000017096.1.52738 WP_000017096.1.52743 WP_000017096.1.52824 WP_000017096.1.52851 WP_000017096.1.52857 WP_000017096.1.52898 WP_000017096.1.52915 WP_000017096.1.5301 WP_000017096.1.53100 WP_000017096.1.53190 WP_000017096.1.53274 WP_000017096.1.53286 WP_000017096.1.53328 WP_000017096.1.53406 WP_000017096.1.53436 WP_000017096.1.53466 WP_000017096.1.53529 WP_000017096.1.53543 WP_000017096.1.53694 WP_000017096.1.53757 WP_000017096.1.53790 WP_000017096.1.53812 WP_000017096.1.53935 WP_000017096.1.54033 WP_000017096.1.54061 WP_000017096.1.54075 WP_000017096.1.54082 WP_000017096.1.54085 WP_000017096.1.54136 WP_000017096.1.54159 WP_000017096.1.54196 WP_000017096.1.542 WP_000017096.1.54209 WP_000017096.1.54271 WP_000017096.1.54273 WP_000017096.1.54274 WP_000017096.1.54319 WP_000017096.1.54324 WP_000017096.1.54364 WP_000017096.1.54400 WP_000017096.1.54500 WP_000017096.1.54558 WP_000017096.1.54569 WP_000017096.1.5459 WP_000017096.1.54607 WP_000017096.1.54644 WP_000017096.1.54662 WP_000017096.1.54722 WP_000017096.1.54749 WP_000017096.1.54764 WP_000017096.1.55008 WP_000017096.1.55152 WP_000017096.1.55156 WP_000017096.1.5517 WP_000017096.1.5523 WP_000017096.1.5525 WP_000017096.1.55285 WP_000017096.1.55361 WP_000017096.1.55475 WP_000017096.1.55500 WP_000017096.1.5552 WP_000017096.1.55528 WP_000017096.1.5555 WP_000017096.1.55554 WP_000017096.1.55614 WP_000017096.1.55623 WP_000017096.1.55647 WP_000017096.1.55680 WP_000017096.1.55743 WP_000017096.1.55768 WP_000017096.1.55782 WP_000017096.1.55796 WP_000017096.1.55993 WP_000017096.1.55995 WP_000017096.1.56002 WP_000017096.1.56012 WP_000017096.1.56069 WP_000017096.1.56082 WP_000017096.1.56097 WP_000017096.1.56100 WP_000017096.1.56105 WP_000017096.1.56130 WP_000017096.1.56152 WP_000017096.1.56238 WP_000017096.1.56247 WP_000017096.1.56286 WP_000017096.1.56303 WP_000017096.1.56304 WP_000017096.1.5633 WP_000017096.1.56370 WP_000017096.1.56393 WP_000017096.1.56396 WP_000017096.1.56414 WP_000017096.1.56438 WP_000017096.1.56468 WP_000017096.1.56560 WP_000017096.1.56597 WP_000017096.1.56601 WP_000017096.1.56614 WP_000017096.1.56615 WP_000017096.1.56671 WP_000017096.1.56682 WP_000017096.1.56824 WP_000017096.1.56853 WP_000017096.1.56875 WP_000017096.1.56877 WP_000017096.1.56893 WP_000017096.1.57149 WP_000017096.1.57168 WP_000017096.1.57187 WP_000017096.1.57232 WP_000017096.1.57233 WP_000017096.1.57307 WP_000017096.1.57357 WP_000017096.1.57377 WP_000017096.1.57418 WP_000017096.1.57433 WP_000017096.1.57515 WP_000017096.1.57529 WP_000017096.1.5753 WP_000017096.1.57576 WP_000017096.1.57601 WP_000017096.1.57607 WP_000017096.1.57735 WP_000017096.1.57763 WP_000017096.1.57778 WP_000017096.1.57862 WP_000017096.1.57890 WP_000017096.1.57891 WP_000017096.1.57978 WP_000017096.1.5801 WP_000017096.1.58040 WP_000017096.1.58041 WP_000017096.1.58144 WP_000017096.1.58249 WP_000017096.1.58301 WP_000017096.1.58334 WP_000017096.1.58372 WP_000017096.1.58418 WP_000017096.1.58442 WP_000017096.1.58451 WP_000017096.1.5854 WP_000017096.1.58548 WP_000017096.1.58564 WP_000017096.1.5858 WP_000017096.1.58633 WP_000017096.1.58648 WP_000017096.1.58662 WP_000017096.1.58669 WP_000017096.1.58698 WP_000017096.1.58744 WP_000017096.1.58745 WP_000017096.1.5878 WP_000017096.1.58803 WP_000017096.1.58834 WP_000017096.1.58836 WP_000017096.1.5886 WP_000017096.1.59084 WP_000017096.1.59094 WP_000017096.1.59125 WP_000017096.1.59148 WP_000017096.1.59224 WP_000017096.1.59295 WP_000017096.1.59321 WP_000017096.1.59336 WP_000017096.1.59375 WP_000017096.1.59381 WP_000017096.1.59458 WP_000017096.1.59490 WP_000017096.1.59508 WP_000017096.1.59521 WP_000017096.1.5953 WP_000017096.1.59562 WP_000017096.1.59604 WP_000017096.1.59641 WP_000017096.1.59684 WP_000017096.1.59694 WP_000017096.1.59710 WP_000017096.1.59771 WP_000017096.1.5979 WP_000017096.1.59830 WP_000017096.1.59928 WP_000017096.1.59953 WP_000017096.1.60008 WP_000017096.1.60021 WP_000017096.1.60069 WP_000017096.1.60140 WP_000017096.1.60155 WP_000017096.1.60213 WP_000017096.1.60226 WP_000017096.1.60285 WP_000017096.1.60330 WP_000017096.1.60379 WP_000017096.1.60464 WP_000017096.1.60469 WP_000017096.1.60507 WP_000017096.1.60746 WP_000017096.1.60794 WP_000017096.1.60838 WP_000017096.1.60851 WP_000017096.1.60857 WP_000017096.1.60874 WP_000017096.1.6090 WP_000017096.1.60919 WP_000017096.1.60941 WP_000017096.1.60988 WP_000017096.1.60990 WP_000017096.1.61045 WP_000017096.1.61078 WP_000017096.1.61087 WP_000017096.1.61114 WP_000017096.1.6114 WP_000017096.1.61184 WP_000017096.1.61200 WP_000017096.1.61201 WP_000017096.1.61232 WP_000017096.1.61233 WP_000017096.1.6129 WP_000017096.1.61296 WP_000017096.1.61345 WP_000017096.1.61417 WP_000017096.1.61434 WP_000017096.1.61519 WP_000017096.1.61574 WP_000017096.1.61609 WP_000017096.1.6164 WP_000017096.1.61712 WP_000017096.1.61714 WP_000017096.1.61730 WP_000017096.1.61737 WP_000017096.1.61857 WP_000017096.1.61918 WP_000017096.1.61922 WP_000017096.1.61924 WP_000017096.1.61952 WP_000017096.1.62007 WP_000017096.1.62025 WP_000017096.1.6210 WP_000017096.1.62184 WP_000017096.1.62204 WP_000017096.1.62219 WP_000017096.1.62241 WP_000017096.1.62304 WP_000017096.1.62310 WP_000017096.1.62344 WP_000017096.1.62361 WP_000017096.1.62364 WP_000017096.1.62374 WP_000017096.1.62403 WP_000017096.1.62486 WP_000017096.1.62488 WP_000017096.1.62504 WP_000017096.1.6253 WP_000017096.1.62570 WP_000017096.1.62648 WP_000017096.1.62677 WP_000017096.1.62725 WP_000017096.1.62798 WP_000017096.1.62828 WP_000017096.1.62853 WP_000017096.1.62903 WP_000017096.1.62910 WP_000017096.1.62955 WP_000017096.1.63043 WP_000017096.1.63063 WP_000017096.1.63118 WP_000017096.1.63135 WP_000017096.1.63181 WP_000017096.1.63203 WP_000017096.1.63234 WP_000017096.1.63250 WP_000017096.1.63256 WP_000017096.1.63290 WP_000017096.1.63382 WP_000017096.1.63422 WP_000017096.1.63432 WP_000017096.1.63461 WP_000017096.1.63479 WP_000017096.1.63513 WP_000017096.1.63532 WP_000017096.1.63568 WP_000017096.1.63577 WP_000017096.1.63664 WP_000017096.1.6367 WP_000017096.1.63718 WP_000017096.1.63731 WP_000017096.1.6375 WP_000017096.1.63757 WP_000017096.1.63824 WP_000017096.1.63834 WP_000017096.1.63864 WP_000017096.1.63903 WP_000017096.1.63934 WP_000017096.1.63992 WP_000017096.1.64007 WP_000017096.1.64034 WP_000017096.1.64046 WP_000017096.1.64072 WP_000017096.1.64217 WP_000017096.1.6423 WP_000017096.1.64242 WP_000017096.1.64244 WP_000017096.1.64374 WP_000017096.1.64403 WP_000017096.1.64569 WP_000017096.1.64649 WP_000017096.1.64702 WP_000017096.1.64757 WP_000017096.1.64781 WP_000017096.1.64798 WP_000017096.1.64831 WP_000017096.1.6489 WP_000017096.1.64920 WP_000017096.1.64972 WP_000017096.1.65016 WP_000017096.1.65018 WP_000017096.1.65027 WP_000017096.1.65028 WP_000017096.1.65171 WP_000017096.1.65248 WP_000017096.1.6525 WP_000017096.1.65295 WP_000017096.1.6535 WP_000017096.1.65363 WP_000017096.1.65474 WP_000017096.1.65508 WP_000017096.1.65538 WP_000017096.1.65572 WP_000017096.1.6561 WP_000017096.1.65633 WP_000017096.1.6565 WP_000017096.1.65696 WP_000017096.1.6575 WP_000017096.1.65782 WP_000017096.1.65838 WP_000017096.1.65849 WP_000017096.1.66085 WP_000017096.1.66167 WP_000017096.1.66250 WP_000017096.1.6630 WP_000017096.1.66314 WP_000017096.1.66358 WP_000017096.1.66362 WP_000017096.1.6638 WP_000017096.1.6640 WP_000017096.1.66492 WP_000017096.1.66534 WP_000017096.1.66630 WP_000017096.1.66698 WP_000017096.1.66702 WP_000017096.1.6680 WP_000017096.1.66800 WP_000017096.1.66807 WP_000017096.1.66820 WP_000017096.1.66834 WP_000017096.1.66901 WP_000017096.1.66962 WP_000017096.1.67037 WP_000017096.1.67045 WP_000017096.1.67181 WP_000017096.1.67184 WP_000017096.1.67268 WP_000017096.1.67288 WP_000017096.1.67347 WP_000017096.1.67374 WP_000017096.1.67405 WP_000017096.1.67465 WP_000017096.1.67552 WP_000017096.1.67603 WP_000017096.1.67682 WP_000017096.1.67731 WP_000017096.1.67772 WP_000017096.1.67887 WP_000017096.1.67942 WP_000017096.1.67970 WP_000017096.1.68036 WP_000017096.1.68073 WP_000017096.1.68075 WP_000017096.1.68167 WP_000017096.1.68201 WP_000017096.1.68206 WP_000017096.1.6827 WP_000017096.1.68275 WP_000017096.1.6833 WP_000017096.1.6849 WP_000017096.1.685 WP_000017096.1.68532 WP_000017096.1.68547 WP_000017096.1.6857 WP_000017096.1.6858 WP_000017096.1.68589 WP_000017096.1.68591 WP_000017096.1.68629 WP_000017096.1.68655 WP_000017096.1.68656 WP_000017096.1.68658 WP_000017096.1.6869 WP_000017096.1.68778 WP_000017096.1.68787 WP_000017096.1.6879 WP_000017096.1.68818 WP_000017096.1.6883 WP_000017096.1.68894 WP_000017096.1.68928 WP_000017096.1.68966 WP_000017096.1.68975 WP_000017096.1.69006 WP_000017096.1.69029 WP_000017096.1.6905 WP_000017096.1.6913 WP_000017096.1.69139 WP_000017096.1.69146 WP_000017096.1.69255 WP_000017096.1.69288 WP_000017096.1.69296 WP_000017096.1.69385 WP_000017096.1.69397 WP_000017096.1.69564 WP_000017096.1.69588 WP_000017096.1.69636 WP_000017096.1.69644 WP_000017096.1.69704 WP_000017096.1.69787 WP_000017096.1.69977 WP_000017096.1.70028 WP_000017096.1.70087 WP_000017096.1.7010 WP_000017096.1.7014 WP_000017096.1.7021 WP_000017096.1.70241 WP_000017096.1.70248 WP_000017096.1.70269 WP_000017096.1.70289 WP_000017096.1.70290 WP_000017096.1.70321 WP_000017096.1.70326 WP_000017096.1.70447 WP_000017096.1.70485 WP_000017096.1.70488 WP_000017096.1.70523 WP_000017096.1.70547 WP_000017096.1.7055 WP_000017096.1.70580 WP_000017096.1.70643 WP_000017096.1.70683 WP_000017096.1.70869 WP_000017096.1.70883 WP_000017096.1.70922 WP_000017096.1.70948 WP_000017096.1.71007 WP_000017096.1.71010 WP_000017096.1.71069 WP_000017096.1.71088 WP_000017096.1.7110 WP_000017096.1.71116 WP_000017096.1.71120 WP_000017096.1.71146 WP_000017096.1.71150 WP_000017096.1.71165 WP_000017096.1.71188 WP_000017096.1.71202 WP_000017096.1.71243 WP_000017096.1.71299 WP_000017096.1.71306 WP_000017096.1.71337 WP_000017096.1.7134 WP_000017096.1.71368 WP_000017096.1.71378 WP_000017096.1.71401 WP_000017096.1.71407 WP_000017096.1.7142 WP_000017096.1.71446 WP_000017096.1.71667 WP_000017096.1.71691 WP_000017096.1.71702 WP_000017096.1.7174 WP_000017096.1.71746 WP_000017096.1.71750 WP_000017096.1.71756 WP_000017096.1.71845 WP_000017096.1.71881 WP_000017096.1.71908 WP_000017096.1.71941 WP_000017096.1.71952 WP_000017096.1.71973 WP_000017096.1.72065 WP_000017096.1.72105 WP_000017096.1.72119 WP_000017096.1.72203 WP_000017096.1.72226 WP_000017096.1.72234 WP_000017096.1.72307 WP_000017096.1.72372 WP_000017096.1.72376 WP_000017096.1.72438 WP_000017096.1.72594 WP_000017096.1.72629 WP_000017096.1.72689 WP_000017096.1.72843 WP_000017096.1.72850 WP_000017096.1.72871 WP_000017096.1.72872 WP_000017096.1.72897 WP_000017096.1.72975 WP_000017096.1.73062 WP_000017096.1.73144 WP_000017096.1.7315 WP_000017096.1.7316 WP_000017096.1.73164 WP_000017096.1.73200 WP_000017096.1.73338 WP_000017096.1.7334 WP_000017096.1.73377 WP_000017096.1.73481 WP_000017096.1.73512 WP_000017096.1.7356 WP_000017096.1.73561 WP_000017096.1.73581 WP_000017096.1.73617 WP_000017096.1.73667 WP_000017096.1.73669 WP_000017096.1.73701 WP_000017096.1.73753 WP_000017096.1.73758 WP_000017096.1.73794 WP_000017096.1.73804 WP_000017096.1.73831 WP_000017096.1.7387 WP_000017096.1.73924 WP_000017096.1.73926 WP_000017096.1.7394 WP_000017096.1.73956 WP_000017096.1.74029 WP_000017096.1.74040 WP_000017096.1.7405 WP_000017096.1.74181 WP_000017096.1.74191 WP_000017096.1.74228 WP_000017096.1.7433 WP_000017096.1.74379 WP_000017096.1.74410 WP_000017096.1.74414 WP_000017096.1.74428 WP_000017096.1.7444 WP_000017096.1.74466 WP_000017096.1.74481 WP_000017096.1.74529 WP_000017096.1.74545 WP_000017096.1.7458 WP_000017096.1.74632 WP_000017096.1.74745 WP_000017096.1.74757 WP_000017096.1.74806 WP_000017096.1.74807 WP_000017096.1.74884 WP_000017096.1.74996 WP_000017096.1.75129 WP_000017096.1.75187 WP_000017096.1.75288 WP_000017096.1.75334 WP_000017096.1.75362 WP_000017096.1.75385 WP_000017096.1.75392 WP_000017096.1.75402 WP_000017096.1.7543 WP_000017096.1.75494 WP_000017096.1.75585 WP_000017096.1.75626 WP_000017096.1.75760 WP_000017096.1.75764 WP_000017096.1.75793 WP_000017096.1.75837 WP_000017096.1.75874 WP_000017096.1.75884 WP_000017096.1.75932 WP_000017096.1.75945 WP_000017096.1.76020 WP_000017096.1.76024 WP_000017096.1.76097 WP_000017096.1.76102 WP_000017096.1.76156 WP_000017096.1.76170 WP_000017096.1.76197 WP_000017096.1.76208 WP_000017096.1.76252 WP_000017096.1.7633 WP_000017096.1.7634 WP_000017096.1.76364 WP_000017096.1.76434 WP_000017096.1.76445 WP_000017096.1.76529 WP_000017096.1.76532 WP_000017096.1.7655 WP_000017096.1.7657 WP_000017096.1.7660 WP_000017096.1.76673 WP_000017096.1.76706 WP_000017096.1.76721 WP_000017096.1.76738 WP_000017096.1.76756 WP_000017096.1.76760 WP_000017096.1.76806 WP_000017096.1.76866 WP_000017096.1.76875 WP_000017096.1.76880 WP_000017096.1.76899 WP_000017096.1.77017 WP_000017096.1.77038 WP_000017096.1.77047 WP_000017096.1.77080 WP_000017096.1.7712 WP_000017096.1.77180 WP_000017096.1.77244 WP_000017096.1.77292 WP_000017096.1.77313 WP_000017096.1.77349 WP_000017096.1.77414 WP_000017096.1.77514 WP_000017096.1.77529 WP_000017096.1.77543 WP_000017096.1.77549 WP_000017096.1.77596 WP_000017096.1.77646 WP_000017096.1.77692 WP_000017096.1.77761 WP_000017096.1.7782 WP_000017096.1.77851 WP_000017096.1.77871 WP_000017096.1.77898 WP_000017096.1.77918 WP_000017096.1.77960 WP_000017096.1.77971 WP_000017096.1.78 WP_000017096.1.78016 WP_000017096.1.78026 WP_000017096.1.78033 WP_000017096.1.78076 WP_000017096.1.78096 WP_000017096.1.78100 WP_000017096.1.78110 WP_000017096.1.78120 WP_000017096.1.78170 WP_000017096.1.78201 WP_000017096.1.78339 WP_000017096.1.78383 WP_000017096.1.78407 WP_000017096.1.78502 WP_000017096.1.78602 WP_000017096.1.7861 WP_000017096.1.78618 WP_000017096.1.78673 WP_000017096.1.78715 WP_000017096.1.78735 WP_000017096.1.78771 WP_000017096.1.78802 WP_000017096.1.78830 WP_000017096.1.78835 WP_000017096.1.78871 WP_000017096.1.78874 WP_000017096.1.78913 WP_000017096.1.78918 WP_000017096.1.78930 WP_000017096.1.79011 WP_000017096.1.79140 WP_000017096.1.79151 WP_000017096.1.79167 WP_000017096.1.79189 WP_000017096.1.79203 WP_000017096.1.79297 WP_000017096.1.79335 WP_000017096.1.794 WP_000017096.1.79427 WP_000017096.1.79462 WP_000017096.1.79472 WP_000017096.1.79490 WP_000017096.1.79495 WP_000017096.1.79529 WP_000017096.1.7956 WP_000017096.1.79570 WP_000017096.1.79635 WP_000017096.1.7964 WP_000017096.1.79642 WP_000017096.1.79659 WP_000017096.1.79668 WP_000017096.1.79708 WP_000017096.1.79738 WP_000017096.1.79778 WP_000017096.1.7979 WP_000017096.1.79845 WP_000017096.1.79867 WP_000017096.1.79929 WP_000017096.1.79934 WP_000017096.1.7994 WP_000017096.1.79942 WP_000017096.1.79996 WP_000017096.1.80077 WP_000017096.1.80137 WP_000017096.1.80149 WP_000017096.1.80182 WP_000017096.1.80229 WP_000017096.1.80296 WP_000017096.1.80307 WP_000017096.1.80333 WP_000017096.1.80366 WP_000017096.1.80529 WP_000017096.1.80586 WP_000017096.1.80757 WP_000017096.1.80780 WP_000017096.1.80803 WP_000017096.1.80831 WP_000017096.1.80840 WP_000017096.1.80850 WP_000017096.1.80868 WP_000017096.1.80881 WP_000017096.1.80939 WP_000017096.1.80941 WP_000017096.1.8096 WP_000017096.1.81037 WP_000017096.1.81062 WP_000017096.1.81069 WP_000017096.1.81149 WP_000017096.1.81175 WP_000017096.1.8119 WP_000017096.1.81193 WP_000017096.1.81404 WP_000017096.1.81410 WP_000017096.1.81425 WP_000017096.1.81667 WP_000017096.1.81743 WP_000017096.1.81750 WP_000017096.1.81785 WP_000017096.1.81902 WP_000017096.1.81941 WP_000017096.1.8196 WP_000017096.1.81974 WP_000017096.1.82037 WP_000017096.1.82144 WP_000017096.1.82337 WP_000017096.1.82352 WP_000017096.1.82479 WP_000017096.1.82503 WP_000017096.1.82515 WP_000017096.1.82529 WP_000017096.1.82562 WP_000017096.1.82637 WP_000017096.1.82676 WP_000017096.1.82761 WP_000017096.1.8282 WP_000017096.1.82841 WP_000017096.1.82895 WP_000017096.1.82899 WP_000017096.1.82908 WP_000017096.1.82937 WP_000017096.1.82944 WP_000017096.1.82956 WP_000017096.1.82964 WP_000017096.1.82992 WP_000017096.1.83061 WP_000017096.1.83092 WP_000017096.1.83128 WP_000017096.1.83139 WP_000017096.1.83163 WP_000017096.1.83247 WP_000017096.1.83305 WP_000017096.1.83365 WP_000017096.1.83388 WP_000017096.1.83413 WP_000017096.1.83491 WP_000017096.1.83523 WP_000017096.1.8354 WP_000017096.1.83598 WP_000017096.1.83650 WP_000017096.1.83710 WP_000017096.1.83721 WP_000017096.1.83739 WP_000017096.1.83759 WP_000017096.1.83760 WP_000017096.1.83854 WP_000017096.1.83979 WP_000017096.1.83995 WP_000017096.1.84031 WP_000017096.1.84103 WP_000017096.1.84179 WP_000017096.1.84198 WP_000017096.1.84205 WP_000017096.1.84229 WP_000017096.1.84283 WP_000017096.1.84325 WP_000017096.1.84355 WP_000017096.1.84373 WP_000017096.1.84392 WP_000017096.1.8441 WP_000017096.1.84459 WP_000017096.1.84523 WP_000017096.1.84532 WP_000017096.1.84554 WP_000017096.1.84644 WP_000017096.1.84659 WP_000017096.1.84693 WP_000017096.1.84711 WP_000017096.1.84745 WP_000017096.1.84860 WP_000017096.1.84899 WP_000017096.1.8497 WP_000017096.1.850 WP_000017096.1.85031 WP_000017096.1.85040 WP_000017096.1.85120 WP_000017096.1.85134 WP_000017096.1.85178 WP_000017096.1.85180 WP_000017096.1.85190 WP_000017096.1.8533 WP_000017096.1.8537 WP_000017096.1.8545 WP_000017096.1.85456 WP_000017096.1.85481 WP_000017096.1.85483 WP_000017096.1.8552 WP_000017096.1.85541 WP_000017096.1.8556 WP_000017096.1.85615 WP_000017096.1.85617 WP_000017096.1.85654 WP_000017096.1.85663 WP_000017096.1.85671 WP_000017096.1.85672 WP_000017096.1.85777 WP_000017096.1.85780 WP_000017096.1.85784 WP_000017096.1.85855 WP_000017096.1.85864 WP_000017096.1.85886 WP_000017096.1.85900 WP_000017096.1.85904 WP_000017096.1.85943 WP_000017096.1.85976 WP_000017096.1.86120 WP_000017096.1.86126 WP_000017096.1.86206 WP_000017096.1.86224 WP_000017096.1.86306 WP_000017096.1.86356 WP_000017096.1.86450 WP_000017096.1.86453 WP_000017096.1.86469 WP_000017096.1.86580 WP_000017096.1.86588 WP_000017096.1.86593 WP_000017096.1.86661 WP_000017096.1.8672 WP_000017096.1.86735 WP_000017096.1.8678 WP_000017096.1.86810 WP_000017096.1.8684 WP_000017096.1.86895 WP_000017096.1.86906 WP_000017096.1.86921 WP_000017096.1.86982 WP_000017096.1.87095 WP_000017096.1.87143 WP_000017096.1.87148 WP_000017096.1.87219 WP_000017096.1.8722 WP_000017096.1.87283 WP_000017096.1.87323 WP_000017096.1.8736 WP_000017096.1.87365 WP_000017096.1.87460 WP_000017096.1.87493 WP_000017096.1.87552 WP_000017096.1.87687 WP_000017096.1.87779 WP_000017096.1.87813 WP_000017096.1.87875 WP_000017096.1.87945 WP_000017096.1.8800 WP_000017096.1.88019 WP_000017096.1.88073 WP_000017096.1.8809 WP_000017096.1.88165 WP_000017096.1.88244 WP_000017096.1.88264 WP_000017096.1.88291 WP_000017096.1.88293 WP_000017096.1.88303 WP_000017096.1.8837 WP_000017096.1.88393 WP_000017096.1.88483 WP_000017096.1.8849 WP_000017096.1.88624 WP_000017096.1.88703 WP_000017096.1.88762 WP_000017096.1.88776 WP_000017096.1.88792 WP_000017096.1.88845 WP_000017096.1.88902 WP_000017096.1.8891 WP_000017096.1.88981 WP_000017096.1.89008 WP_000017096.1.89116 WP_000017096.1.89138 WP_000017096.1.89304 WP_000017096.1.89355 WP_000017096.1.89512 WP_000017096.1.89527 WP_000017096.1.89570 WP_000017096.1.89580 WP_000017096.1.89604 WP_000017096.1.89622 WP_000017096.1.89659 WP_000017096.1.89746 WP_000017096.1.89789 WP_000017096.1.89815 WP_000017096.1.89870 WP_000017096.1.89902 WP_000017096.1.89914 WP_000017096.1.89940 WP_000017096.1.8996 WP_000017096.1.89975 WP_000017096.1.9002 WP_000017096.1.90097 WP_000017096.1.90211 WP_000017096.1.90220 WP_000017096.1.90248 WP_000017096.1.90252 WP_000017096.1.90348 WP_000017096.1.90417 WP_000017096.1.90453 WP_000017096.1.90458 WP_000017096.1.90472 WP_000017096.1.90557 WP_000017096.1.90566 WP_000017096.1.90585 WP_000017096.1.90641 WP_000017096.1.90686 WP_000017096.1.90734 WP_000017096.1.90814 WP_000017096.1.90866 WP_000017096.1.90878 WP_000017096.1.9089 WP_000017096.1.9093 WP_000017096.1.91003 WP_000017096.1.91023 WP_000017096.1.91042 WP_000017096.1.91069 WP_000017096.1.91107 WP_000017096.1.91156 WP_000017096.1.91189 WP_000017096.1.91278 WP_000017096.1.9131 WP_000017096.1.91334 WP_000017096.1.91381 WP_000017096.1.91405 WP_000017096.1.91470 WP_000017096.1.91473 WP_000017096.1.91493 WP_000017096.1.91512 WP_000017096.1.91564 WP_000017096.1.91628 WP_000017096.1.91655 WP_000017096.1.91724 WP_000017096.1.91732 WP_000017096.1.91788 WP_000017096.1.91806 WP_000017096.1.91903 WP_000017096.1.91914 WP_000017096.1.92013 WP_000017096.1.92039 WP_000017096.1.92044 WP_000017096.1.92047 WP_000017096.1.92060 WP_000017096.1.92093 WP_000017096.1.92108 WP_000017096.1.92122 WP_000017096.1.92149 WP_000017096.1.92171 WP_000017096.1.92183 WP_000017096.1.92208 WP_000017096.1.92268 WP_000017096.1.92270 WP_000017096.1.92310 WP_000017096.1.92318 WP_000017096.1.92408 WP_000017096.1.92439 WP_000017096.1.92443 WP_000017096.1.92482 WP_000017096.1.9253 WP_000017096.1.92531 WP_000017096.1.92562 WP_000017096.1.92669 WP_000017096.1.92671 WP_000017096.1.92729 WP_000017096.1.92738 WP_000017096.1.92758 WP_000017096.1.92832 WP_000017096.1.92875 WP_000017096.1.92883 WP_000017096.1.92895 WP_000017096.1.92947 WP_000017096.1.92975 WP_000017096.1.93086 WP_000017096.1.93101 WP_000017096.1.93136 WP_000017096.1.93155 WP_000017096.1.93213 WP_000017096.1.93275 WP_000017096.1.93322 WP_000017096.1.93365 WP_000017096.1.93376 WP_000017096.1.93543 WP_000017096.1.93596 WP_000017096.1.93650 WP_000017096.1.93656 WP_000017096.1.93662 WP_000017096.1.93671 WP_000017096.1.937 WP_000017096.1.93705 WP_000017096.1.93761 WP_000017096.1.93767 WP_000017096.1.93803 WP_000017096.1.93804 WP_000017096.1.9389 WP_000017096.1.93994 WP_000017096.1.94072 WP_000017096.1.94132 WP_000017096.1.94162 WP_000017096.1.94167 WP_000017096.1.94168 WP_000017096.1.94198 WP_000017096.1.9432 WP_000017096.1.94354 WP_000017096.1.94379 WP_000017096.1.94380 WP_000017096.1.94458 WP_000017096.1.94557 WP_000017096.1.94562 WP_000017096.1.94565 WP_000017096.1.94584 WP_000017096.1.94588 WP_000017096.1.94622 WP_000017096.1.94674 WP_000017096.1.94722 WP_000017096.1.94796 WP_000017096.1.9481 WP_000017096.1.94862 WP_000017096.1.94959 WP_000017096.1.94967 WP_000017096.1.94971 WP_000017096.1.95051 WP_000017096.1.95085 WP_000017096.1.95121 WP_000017096.1.9516 WP_000017096.1.95282 WP_000017096.1.9530 WP_000017096.1.95465 WP_000017096.1.95546 WP_000017096.1.95630 WP_000017096.1.95641 WP_000017096.1.95703 WP_000017096.1.9574 WP_000017096.1.95803 WP_000017096.1.95840 WP_000017096.1.95901 WP_000017096.1.95911 WP_000017096.1.95940 WP_000017096.1.9609 WP_000017096.1.96139 WP_000017096.1.96172 WP_000017096.1.96190 WP_000017096.1.96260 WP_000017096.1.9627 WP_000017096.1.96317 WP_000017096.1.96335 WP_000017096.1.96343 WP_000017096.1.9644 WP_000017096.1.96469 WP_000017096.1.96497 WP_000017096.1.96500 WP_000017096.1.96555 WP_000017096.1.96563 WP_000017096.1.96721 WP_000017096.1.96732 WP_000017096.1.96758 WP_000017096.1.96771 WP_000017096.1.96798 WP_000017096.1.96902 WP_000017096.1.97015 WP_000017096.1.97145 WP_000017096.1.97190 WP_000017096.1.97318 WP_000017096.1.97337 WP_000017096.1.97368 WP_000017096.1.97369 WP_000017096.1.97534 WP_000017096.1.97594 WP_000017096.1.97597 WP_000017096.1.97613 WP_000017096.1.97620 WP_000017096.1.97640 WP_000017096.1.97726 WP_000017096.1.97727 WP_000017096.1.97732 WP_000017096.1.97736 WP_000017096.1.9775 WP_000017096.1.97772 WP_000017096.1.97846 WP_000017096.1.97983 WP_000017096.1.98006 WP_000017096.1.98019 WP_000017096.1.98022 WP_000017096.1.9805 WP_000017096.1.98110 WP_000017096.1.98124 WP_000017096.1.98146 WP_000017096.1.98201 WP_000017096.1.98219 WP_000017096.1.98250 WP_000017096.1.98314 WP_000017096.1.98403 WP_000017096.1.9841 WP_000017096.1.98438 WP_000017096.1.98446 WP_000017096.1.98483 WP_000017096.1.98495 WP_000017096.1.98513 WP_000017096.1.98531 WP_000017096.1.98577 WP_000017096.1.98676 WP_000017096.1.98677 WP_000017096.1.98760 WP_000017096.1.98763 WP_000017096.1.98843 WP_000017096.1.9887 WP_000017096.1.98899 WP_000017096.1.98931 WP_000017096.1.9898 WP_000017096.1.99083 WP_000017096.1.99098 WP_000017096.1.99184 WP_000017096.1.9919 WP_000017096.1.99198 WP_000017096.1.99267 WP_000017096.1.99276 WP_000017096.1.99370 WP_000017096.1.99469 WP_000017096.1.9954 WP_000017096.1.99561 WP_000017096.1.99637 WP_000017096.1.99646 WP_000017096.1.99657 WP_000017096.1.99660 WP_000017096.1.99712 WP_000017096.1.99725 WP_000017096.1.99813 WP_000017096.1.99858 WP_000017096.1.99889 WP_000017096.1.99958 gi|378701004|ref|YP_005182961.1| gi|528820932|ref|YP_008362135.1| gi|538363689|ref|YP_008506974.1| gi|378990417|ref|YP_005253581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]