SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451920|ref|YP_005239280.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451920|ref|YP_005239280.1|
Domain Number 1 Region: 26-115
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.08e-17
Family Hypothetical protein TM1112 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378451920|ref|YP_005239280.1|
Sequence length 124
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MQAFKLNQPVPELQPIGSVSLLGALPTEGDPQVAVAMIYGKPEDVFTCGLFSSTRGGFTM
IYPFTEHATVLEGEVELTVAGQEPIRFSPGDSWFVEQGTEVAWKVLTPRFVKHYLAKVES
HKQG
Download sequence
Identical sequences A0A0D6IDS2 A0A0F6B6N7 A0A0F7JBT5 A0A0H3NFX9 A0A0M0QW32 A0A0U1IP09 A0A265B3Q3 A0A2D3AHJ6 A0A2H9YIX0 E8XAH6 Q8ZM29
gi|525837014|ref|YP_008253691.1| gi|482905693|ref|YP_007904253.1| 454169.SeHA_C3370 99287.STM3127 gi|549725690|ref|YP_008645880.1| gi|378451920|ref|YP_005239280.1| gi|525829061|ref|YP_008252067.1| gi|378446478|ref|YP_005234110.1| gi|194447675|ref|YP_002047118.1| gi|378990445|ref|YP_005253609.1| gi|550902487|ref|YP_008671579.1| ABAO01000002|CDS_174591-174965 ABEL01000006|CDS_14723-14349 AE006468|CDS_3287494-3287120 CP001120|CDS_3279861-3279487 CP001363|CDS_3305747-3305373 FN424405|CDS_3278735-3278361 gi|378985721|ref|YP_005248877.1| gi|383497787|ref|YP_005398476.1| gi|16766427|ref|NP_462042.1| gi|386592827|ref|YP_006089227.1| 359595 APC23949 gi|526221493|ref|YP_008267331.1| NP_462042.1.58477 WP_001147546.1.100010 WP_001147546.1.100234 WP_001147546.1.100376 WP_001147546.1.100424 WP_001147546.1.100436 WP_001147546.1.100484 WP_001147546.1.100488 WP_001147546.1.100597 WP_001147546.1.100730 WP_001147546.1.10076 WP_001147546.1.100781 WP_001147546.1.100793 WP_001147546.1.100869 WP_001147546.1.100871 WP_001147546.1.100882 WP_001147546.1.101007 WP_001147546.1.101020 WP_001147546.1.101074 WP_001147546.1.101078 WP_001147546.1.101180 WP_001147546.1.101259 WP_001147546.1.101284 WP_001147546.1.101291 WP_001147546.1.1013 WP_001147546.1.101353 WP_001147546.1.101386 WP_001147546.1.101404 WP_001147546.1.101589 WP_001147546.1.101707 WP_001147546.1.101734 WP_001147546.1.101878 WP_001147546.1.101953 WP_001147546.1.10220 WP_001147546.1.10231 WP_001147546.1.10266 WP_001147546.1.10429 WP_001147546.1.10439 WP_001147546.1.10566 WP_001147546.1.10678 WP_001147546.1.10753 WP_001147546.1.10992 WP_001147546.1.11024 WP_001147546.1.11031 WP_001147546.1.11098 WP_001147546.1.1110 WP_001147546.1.11156 WP_001147546.1.11168 WP_001147546.1.11190 WP_001147546.1.11295 WP_001147546.1.11455 WP_001147546.1.11458 WP_001147546.1.11518 WP_001147546.1.11532 WP_001147546.1.11543 WP_001147546.1.11588 WP_001147546.1.11677 WP_001147546.1.11687 WP_001147546.1.11735 WP_001147546.1.11763 WP_001147546.1.11772 WP_001147546.1.11834 WP_001147546.1.11897 WP_001147546.1.12017 WP_001147546.1.12114 WP_001147546.1.12351 WP_001147546.1.12370 WP_001147546.1.12546 WP_001147546.1.1264 WP_001147546.1.12728 WP_001147546.1.12879 WP_001147546.1.12936 WP_001147546.1.12995 WP_001147546.1.13027 WP_001147546.1.13106 WP_001147546.1.13130 WP_001147546.1.13207 WP_001147546.1.13414 WP_001147546.1.13488 WP_001147546.1.13509 WP_001147546.1.13661 WP_001147546.1.13669 WP_001147546.1.13741 WP_001147546.1.1387 WP_001147546.1.13908 WP_001147546.1.13932 WP_001147546.1.13968 WP_001147546.1.14001 WP_001147546.1.14111 WP_001147546.1.14151 WP_001147546.1.14239 WP_001147546.1.14320 WP_001147546.1.14379 WP_001147546.1.14406 WP_001147546.1.14410 WP_001147546.1.14436 WP_001147546.1.14458 WP_001147546.1.14466 WP_001147546.1.14524 WP_001147546.1.14554 WP_001147546.1.14618 WP_001147546.1.14725 WP_001147546.1.14852 WP_001147546.1.1489 WP_001147546.1.14932 WP_001147546.1.15055 WP_001147546.1.15124 WP_001147546.1.15223 WP_001147546.1.15226 WP_001147546.1.15316 WP_001147546.1.15369 WP_001147546.1.1540 WP_001147546.1.15508 WP_001147546.1.15784 WP_001147546.1.15830 WP_001147546.1.15862 WP_001147546.1.15910 WP_001147546.1.15986 WP_001147546.1.16004 WP_001147546.1.16047 WP_001147546.1.16062 WP_001147546.1.16063 WP_001147546.1.16103 WP_001147546.1.16226 WP_001147546.1.16233 WP_001147546.1.16284 WP_001147546.1.16328 WP_001147546.1.1635 WP_001147546.1.16361 WP_001147546.1.16468 WP_001147546.1.16525 WP_001147546.1.16614 WP_001147546.1.16650 WP_001147546.1.16691 WP_001147546.1.16732 WP_001147546.1.16735 WP_001147546.1.16786 WP_001147546.1.16858 WP_001147546.1.16873 WP_001147546.1.16896 WP_001147546.1.16903 WP_001147546.1.16916 WP_001147546.1.16965 WP_001147546.1.1700 WP_001147546.1.17093 WP_001147546.1.17307 WP_001147546.1.174 WP_001147546.1.17480 WP_001147546.1.17546 WP_001147546.1.17702 WP_001147546.1.17705 WP_001147546.1.17743 WP_001147546.1.17891 WP_001147546.1.1798 WP_001147546.1.18019 WP_001147546.1.18111 WP_001147546.1.18122 WP_001147546.1.18163 WP_001147546.1.1818 WP_001147546.1.18254 WP_001147546.1.18265 WP_001147546.1.18267 WP_001147546.1.18468 WP_001147546.1.18607 WP_001147546.1.18705 WP_001147546.1.18715 WP_001147546.1.18776 WP_001147546.1.18822 WP_001147546.1.18881 WP_001147546.1.18940 WP_001147546.1.18949 WP_001147546.1.19053 WP_001147546.1.19273 WP_001147546.1.19320 WP_001147546.1.19458 WP_001147546.1.19460 WP_001147546.1.19461 WP_001147546.1.19588 WP_001147546.1.19614 WP_001147546.1.19616 WP_001147546.1.19702 WP_001147546.1.19706 WP_001147546.1.19724 WP_001147546.1.19749 WP_001147546.1.19784 WP_001147546.1.19793 WP_001147546.1.19802 WP_001147546.1.19809 WP_001147546.1.19867 WP_001147546.1.19975 WP_001147546.1.1998 WP_001147546.1.20 WP_001147546.1.2010 WP_001147546.1.20212 WP_001147546.1.20266 WP_001147546.1.20271 WP_001147546.1.20362 WP_001147546.1.20418 WP_001147546.1.20443 WP_001147546.1.20446 WP_001147546.1.20525 WP_001147546.1.2054 WP_001147546.1.20553 WP_001147546.1.20614 WP_001147546.1.20626 WP_001147546.1.20646 WP_001147546.1.20886 WP_001147546.1.20908 WP_001147546.1.21049 WP_001147546.1.21136 WP_001147546.1.21146 WP_001147546.1.21245 WP_001147546.1.21246 WP_001147546.1.21269 WP_001147546.1.21351 WP_001147546.1.21400 WP_001147546.1.21497 WP_001147546.1.21499 WP_001147546.1.21603 WP_001147546.1.21751 WP_001147546.1.21757 WP_001147546.1.21991 WP_001147546.1.22024 WP_001147546.1.2205 WP_001147546.1.22062 WP_001147546.1.22067 WP_001147546.1.2221 WP_001147546.1.22235 WP_001147546.1.2235 WP_001147546.1.22379 WP_001147546.1.22427 WP_001147546.1.2246 WP_001147546.1.22485 WP_001147546.1.22620 WP_001147546.1.22692 WP_001147546.1.22758 WP_001147546.1.22864 WP_001147546.1.22870 WP_001147546.1.22979 WP_001147546.1.23102 WP_001147546.1.23114 WP_001147546.1.2314 WP_001147546.1.23192 WP_001147546.1.23259 WP_001147546.1.23379 WP_001147546.1.23460 WP_001147546.1.23472 WP_001147546.1.23482 WP_001147546.1.23509 WP_001147546.1.23634 WP_001147546.1.2364 WP_001147546.1.23932 WP_001147546.1.23959 WP_001147546.1.24017 WP_001147546.1.24082 WP_001147546.1.24206 WP_001147546.1.24308 WP_001147546.1.24578 WP_001147546.1.24737 WP_001147546.1.24779 WP_001147546.1.25008 WP_001147546.1.25015 WP_001147546.1.25119 WP_001147546.1.25405 WP_001147546.1.25454 WP_001147546.1.25493 WP_001147546.1.25668 WP_001147546.1.25690 WP_001147546.1.2570 WP_001147546.1.25740 WP_001147546.1.25793 WP_001147546.1.25814 WP_001147546.1.25988 WP_001147546.1.26282 WP_001147546.1.26311 WP_001147546.1.26319 WP_001147546.1.26429 WP_001147546.1.26440 WP_001147546.1.26493 WP_001147546.1.26551 WP_001147546.1.26567 WP_001147546.1.26741 WP_001147546.1.26919 WP_001147546.1.27010 WP_001147546.1.27084 WP_001147546.1.27173 WP_001147546.1.27206 WP_001147546.1.27223 WP_001147546.1.27423 WP_001147546.1.27544 WP_001147546.1.27561 WP_001147546.1.2763 WP_001147546.1.27665 WP_001147546.1.27707 WP_001147546.1.27761 WP_001147546.1.27857 WP_001147546.1.27977 WP_001147546.1.28032 WP_001147546.1.28094 WP_001147546.1.28170 WP_001147546.1.28302 WP_001147546.1.2835 WP_001147546.1.28370 WP_001147546.1.28538 WP_001147546.1.28575 WP_001147546.1.28625 WP_001147546.1.28655 WP_001147546.1.28694 WP_001147546.1.2879 WP_001147546.1.2890 WP_001147546.1.28938 WP_001147546.1.28946 WP_001147546.1.29006 WP_001147546.1.29010 WP_001147546.1.2910 WP_001147546.1.29113 WP_001147546.1.29509 WP_001147546.1.29588 WP_001147546.1.29601 WP_001147546.1.29606 WP_001147546.1.29615 WP_001147546.1.29619 WP_001147546.1.29704 WP_001147546.1.29827 WP_001147546.1.29969 WP_001147546.1.29990 WP_001147546.1.30006 WP_001147546.1.30022 WP_001147546.1.30027 WP_001147546.1.30180 WP_001147546.1.30202 WP_001147546.1.30469 WP_001147546.1.30505 WP_001147546.1.30507 WP_001147546.1.30535 WP_001147546.1.30547 WP_001147546.1.30794 WP_001147546.1.30833 WP_001147546.1.30835 WP_001147546.1.30972 WP_001147546.1.31 WP_001147546.1.31092 WP_001147546.1.31122 WP_001147546.1.3113 WP_001147546.1.31185 WP_001147546.1.3119 WP_001147546.1.31190 WP_001147546.1.31195 WP_001147546.1.31196 WP_001147546.1.31281 WP_001147546.1.31362 WP_001147546.1.31451 WP_001147546.1.31504 WP_001147546.1.31515 WP_001147546.1.31578 WP_001147546.1.31658 WP_001147546.1.31940 WP_001147546.1.31967 WP_001147546.1.31972 WP_001147546.1.32192 WP_001147546.1.32206 WP_001147546.1.32260 WP_001147546.1.32515 WP_001147546.1.32660 WP_001147546.1.32702 WP_001147546.1.32714 WP_001147546.1.32786 WP_001147546.1.32804 WP_001147546.1.32907 WP_001147546.1.33030 WP_001147546.1.33127 WP_001147546.1.33143 WP_001147546.1.33248 WP_001147546.1.33261 WP_001147546.1.333 WP_001147546.1.33492 WP_001147546.1.33553 WP_001147546.1.33580 WP_001147546.1.33592 WP_001147546.1.33894 WP_001147546.1.3394 WP_001147546.1.34043 WP_001147546.1.34075 WP_001147546.1.34257 WP_001147546.1.34279 WP_001147546.1.34319 WP_001147546.1.34417 WP_001147546.1.34453 WP_001147546.1.34610 WP_001147546.1.34856 WP_001147546.1.34975 WP_001147546.1.35045 WP_001147546.1.35129 WP_001147546.1.35184 WP_001147546.1.35193 WP_001147546.1.35404 WP_001147546.1.35408 WP_001147546.1.35425 WP_001147546.1.35446 WP_001147546.1.35463 WP_001147546.1.35503 WP_001147546.1.35509 WP_001147546.1.35590 WP_001147546.1.35892 WP_001147546.1.35940 WP_001147546.1.36003 WP_001147546.1.3601 WP_001147546.1.36017 WP_001147546.1.36547 WP_001147546.1.36609 WP_001147546.1.36690 WP_001147546.1.3670 WP_001147546.1.36705 WP_001147546.1.36918 WP_001147546.1.36931 WP_001147546.1.37073 WP_001147546.1.37111 WP_001147546.1.37112 WP_001147546.1.37256 WP_001147546.1.37293 WP_001147546.1.37370 WP_001147546.1.37376 WP_001147546.1.3744 WP_001147546.1.37498 WP_001147546.1.37504 WP_001147546.1.37618 WP_001147546.1.37968 WP_001147546.1.37978 WP_001147546.1.38125 WP_001147546.1.38145 WP_001147546.1.383 WP_001147546.1.38393 WP_001147546.1.3848 WP_001147546.1.38569 WP_001147546.1.38613 WP_001147546.1.38673 WP_001147546.1.38693 WP_001147546.1.38773 WP_001147546.1.38781 WP_001147546.1.38882 WP_001147546.1.38913 WP_001147546.1.39003 WP_001147546.1.39136 WP_001147546.1.39197 WP_001147546.1.39229 WP_001147546.1.39265 WP_001147546.1.39405 WP_001147546.1.39420 WP_001147546.1.39449 WP_001147546.1.39512 WP_001147546.1.39584 WP_001147546.1.39629 WP_001147546.1.39724 WP_001147546.1.39763 WP_001147546.1.39862 WP_001147546.1.39921 WP_001147546.1.39923 WP_001147546.1.40017 WP_001147546.1.40072 WP_001147546.1.40073 WP_001147546.1.4011 WP_001147546.1.40208 WP_001147546.1.40240 WP_001147546.1.40257 WP_001147546.1.40292 WP_001147546.1.40305 WP_001147546.1.40311 WP_001147546.1.40341 WP_001147546.1.40380 WP_001147546.1.40395 WP_001147546.1.40465 WP_001147546.1.40710 WP_001147546.1.4075 WP_001147546.1.4087 WP_001147546.1.40877 WP_001147546.1.40996 WP_001147546.1.41017 WP_001147546.1.41018 WP_001147546.1.41086 WP_001147546.1.41091 WP_001147546.1.41226 WP_001147546.1.41279 WP_001147546.1.41516 WP_001147546.1.41554 WP_001147546.1.41572 WP_001147546.1.41591 WP_001147546.1.41662 WP_001147546.1.41708 WP_001147546.1.41761 WP_001147546.1.41882 WP_001147546.1.41979 WP_001147546.1.41985 WP_001147546.1.42104 WP_001147546.1.42156 WP_001147546.1.4222 WP_001147546.1.42243 WP_001147546.1.42320 WP_001147546.1.42342 WP_001147546.1.42422 WP_001147546.1.42444 WP_001147546.1.42676 WP_001147546.1.4276 WP_001147546.1.42864 WP_001147546.1.4288 WP_001147546.1.43018 WP_001147546.1.43041 WP_001147546.1.43077 WP_001147546.1.43244 WP_001147546.1.43312 WP_001147546.1.43334 WP_001147546.1.43339 WP_001147546.1.43371 WP_001147546.1.43437 WP_001147546.1.43522 WP_001147546.1.43613 WP_001147546.1.43668 WP_001147546.1.43778 WP_001147546.1.43886 WP_001147546.1.43951 WP_001147546.1.44005 WP_001147546.1.44043 WP_001147546.1.44099 WP_001147546.1.44121 WP_001147546.1.44291 WP_001147546.1.44300 WP_001147546.1.44310 WP_001147546.1.44386 WP_001147546.1.44433 WP_001147546.1.44479 WP_001147546.1.44640 WP_001147546.1.4467 WP_001147546.1.44747 WP_001147546.1.4485 WP_001147546.1.44877 WP_001147546.1.44927 WP_001147546.1.44933 WP_001147546.1.45067 WP_001147546.1.45074 WP_001147546.1.45079 WP_001147546.1.45098 WP_001147546.1.45145 WP_001147546.1.45177 WP_001147546.1.45184 WP_001147546.1.45259 WP_001147546.1.45349 WP_001147546.1.45365 WP_001147546.1.45434 WP_001147546.1.45550 WP_001147546.1.45582 WP_001147546.1.45585 WP_001147546.1.45622 WP_001147546.1.45660 WP_001147546.1.45690 WP_001147546.1.458 WP_001147546.1.45848 WP_001147546.1.46011 WP_001147546.1.46069 WP_001147546.1.46112 WP_001147546.1.46173 WP_001147546.1.46174 WP_001147546.1.46187 WP_001147546.1.46278 WP_001147546.1.46303 WP_001147546.1.46434 WP_001147546.1.46595 WP_001147546.1.46675 WP_001147546.1.47008 WP_001147546.1.47057 WP_001147546.1.47214 WP_001147546.1.47429 WP_001147546.1.47448 WP_001147546.1.4747 WP_001147546.1.47472 WP_001147546.1.47478 WP_001147546.1.47579 WP_001147546.1.47621 WP_001147546.1.47799 WP_001147546.1.48242 WP_001147546.1.48253 WP_001147546.1.483 WP_001147546.1.48367 WP_001147546.1.48377 WP_001147546.1.4853 WP_001147546.1.48788 WP_001147546.1.4885 WP_001147546.1.48894 WP_001147546.1.48919 WP_001147546.1.49084 WP_001147546.1.49113 WP_001147546.1.49155 WP_001147546.1.49204 WP_001147546.1.49239 WP_001147546.1.49256 WP_001147546.1.49290 WP_001147546.1.49340 WP_001147546.1.49366 WP_001147546.1.49490 WP_001147546.1.49515 WP_001147546.1.49572 WP_001147546.1.49686 WP_001147546.1.4979 WP_001147546.1.49803 WP_001147546.1.49805 WP_001147546.1.49929 WP_001147546.1.50080 WP_001147546.1.50161 WP_001147546.1.50211 WP_001147546.1.50376 WP_001147546.1.50389 WP_001147546.1.50404 WP_001147546.1.50676 WP_001147546.1.50804 WP_001147546.1.50808 WP_001147546.1.5088 WP_001147546.1.50908 WP_001147546.1.50941 WP_001147546.1.50999 WP_001147546.1.51014 WP_001147546.1.51022 WP_001147546.1.51066 WP_001147546.1.51179 WP_001147546.1.51182 WP_001147546.1.51186 WP_001147546.1.51224 WP_001147546.1.51487 WP_001147546.1.51488 WP_001147546.1.51634 WP_001147546.1.51649 WP_001147546.1.51686 WP_001147546.1.51756 WP_001147546.1.51831 WP_001147546.1.51911 WP_001147546.1.51932 WP_001147546.1.51989 WP_001147546.1.52121 WP_001147546.1.52170 WP_001147546.1.52336 WP_001147546.1.52346 WP_001147546.1.52353 WP_001147546.1.52361 WP_001147546.1.52653 WP_001147546.1.52656 WP_001147546.1.52692 WP_001147546.1.52743 WP_001147546.1.52857 WP_001147546.1.52866 WP_001147546.1.52898 WP_001147546.1.52915 WP_001147546.1.52949 WP_001147546.1.52985 WP_001147546.1.53190 WP_001147546.1.53272 WP_001147546.1.53406 WP_001147546.1.53466 WP_001147546.1.53529 WP_001147546.1.53543 WP_001147546.1.53757 WP_001147546.1.53812 WP_001147546.1.53905 WP_001147546.1.54033 WP_001147546.1.54075 WP_001147546.1.54196 WP_001147546.1.54209 WP_001147546.1.54271 WP_001147546.1.54274 WP_001147546.1.54319 WP_001147546.1.54364 WP_001147546.1.54400 WP_001147546.1.54526 WP_001147546.1.54644 WP_001147546.1.54662 WP_001147546.1.54722 WP_001147546.1.54749 WP_001147546.1.54764 WP_001147546.1.55008 WP_001147546.1.55152 WP_001147546.1.55156 WP_001147546.1.55285 WP_001147546.1.55325 WP_001147546.1.55430 WP_001147546.1.55475 WP_001147546.1.5560 WP_001147546.1.55647 WP_001147546.1.55743 WP_001147546.1.55768 WP_001147546.1.55782 WP_001147546.1.55796 WP_001147546.1.55973 WP_001147546.1.56002 WP_001147546.1.56012 WP_001147546.1.56105 WP_001147546.1.56238 WP_001147546.1.56244 WP_001147546.1.56286 WP_001147546.1.56304 WP_001147546.1.56414 WP_001147546.1.56438 WP_001147546.1.56559 WP_001147546.1.56560 WP_001147546.1.56614 WP_001147546.1.56660 WP_001147546.1.56671 WP_001147546.1.56682 WP_001147546.1.56875 WP_001147546.1.56877 WP_001147546.1.57168 WP_001147546.1.57187 WP_001147546.1.57356 WP_001147546.1.57377 WP_001147546.1.57418 WP_001147546.1.57433 WP_001147546.1.57515 WP_001147546.1.57529 WP_001147546.1.57576 WP_001147546.1.57601 WP_001147546.1.57607 WP_001147546.1.5774 WP_001147546.1.57763 WP_001147546.1.57890 WP_001147546.1.57891 WP_001147546.1.57978 WP_001147546.1.5801 WP_001147546.1.58041 WP_001147546.1.58358 WP_001147546.1.58407 WP_001147546.1.58418 WP_001147546.1.58548 WP_001147546.1.5858 WP_001147546.1.58662 WP_001147546.1.58669 WP_001147546.1.58745 WP_001147546.1.58803 WP_001147546.1.5886 WP_001147546.1.59094 WP_001147546.1.59224 WP_001147546.1.59321 WP_001147546.1.59375 WP_001147546.1.59420 WP_001147546.1.59458 WP_001147546.1.59490 WP_001147546.1.59508 WP_001147546.1.59684 WP_001147546.1.59694 WP_001147546.1.59771 WP_001147546.1.5979 WP_001147546.1.59953 WP_001147546.1.60008 WP_001147546.1.60021 WP_001147546.1.60069 WP_001147546.1.60140 WP_001147546.1.60155 WP_001147546.1.60285 WP_001147546.1.60379 WP_001147546.1.60464 WP_001147546.1.60545 WP_001147546.1.60561 WP_001147546.1.60772 WP_001147546.1.60874 WP_001147546.1.60941 WP_001147546.1.61078 WP_001147546.1.6114 WP_001147546.1.61232 WP_001147546.1.6129 WP_001147546.1.61296 WP_001147546.1.61345 WP_001147546.1.61417 WP_001147546.1.61574 WP_001147546.1.61712 WP_001147546.1.61714 WP_001147546.1.61730 WP_001147546.1.61857 WP_001147546.1.61918 WP_001147546.1.61952 WP_001147546.1.62007 WP_001147546.1.62020 WP_001147546.1.62025 WP_001147546.1.6209 WP_001147546.1.62204 WP_001147546.1.62257 WP_001147546.1.62304 WP_001147546.1.62364 WP_001147546.1.62374 WP_001147546.1.62403 WP_001147546.1.6253 WP_001147546.1.62853 WP_001147546.1.62903 WP_001147546.1.62910 WP_001147546.1.62955 WP_001147546.1.63181 WP_001147546.1.63203 WP_001147546.1.63256 WP_001147546.1.63290 WP_001147546.1.63382 WP_001147546.1.63432 WP_001147546.1.63461 WP_001147546.1.63479 WP_001147546.1.63577 WP_001147546.1.63664 WP_001147546.1.63718 WP_001147546.1.6375 WP_001147546.1.63757 WP_001147546.1.63797 WP_001147546.1.63834 WP_001147546.1.64018 WP_001147546.1.64046 WP_001147546.1.6423 WP_001147546.1.64244 WP_001147546.1.64387 WP_001147546.1.64403 WP_001147546.1.64649 WP_001147546.1.64702 WP_001147546.1.64757 WP_001147546.1.64781 WP_001147546.1.64831 WP_001147546.1.6489 WP_001147546.1.64894 WP_001147546.1.65018 WP_001147546.1.65028 WP_001147546.1.65171 WP_001147546.1.65248 WP_001147546.1.65269 WP_001147546.1.6535 WP_001147546.1.65474 WP_001147546.1.65572 WP_001147546.1.65633 WP_001147546.1.6565 WP_001147546.1.65696 WP_001147546.1.6575 WP_001147546.1.65782 WP_001147546.1.65940 WP_001147546.1.65956 WP_001147546.1.66049 WP_001147546.1.6630 WP_001147546.1.66314 WP_001147546.1.66330 WP_001147546.1.66358 WP_001147546.1.66362 WP_001147546.1.6638 WP_001147546.1.6640 WP_001147546.1.66678 WP_001147546.1.66698 WP_001147546.1.6680 WP_001147546.1.66834 WP_001147546.1.66901 WP_001147546.1.66962 WP_001147546.1.67037 WP_001147546.1.67045 WP_001147546.1.67100 WP_001147546.1.67181 WP_001147546.1.67235 WP_001147546.1.67268 WP_001147546.1.67347 WP_001147546.1.6739 WP_001147546.1.67465 WP_001147546.1.67552 WP_001147546.1.67682 WP_001147546.1.67829 WP_001147546.1.67887 WP_001147546.1.68073 WP_001147546.1.68201 WP_001147546.1.68206 WP_001147546.1.6827 WP_001147546.1.68275 WP_001147546.1.68401 WP_001147546.1.68477 WP_001147546.1.6849 WP_001147546.1.68547 WP_001147546.1.68589 WP_001147546.1.68655 WP_001147546.1.68656 WP_001147546.1.68778 WP_001147546.1.68787 WP_001147546.1.68894 WP_001147546.1.68928 WP_001147546.1.68975 WP_001147546.1.69001 WP_001147546.1.69006 WP_001147546.1.6904 WP_001147546.1.6913 WP_001147546.1.69146 WP_001147546.1.69151 WP_001147546.1.69255 WP_001147546.1.69359 WP_001147546.1.69397 WP_001147546.1.6954 WP_001147546.1.69564 WP_001147546.1.69644 WP_001147546.1.69704 WP_001147546.1.69758 WP_001147546.1.7021 WP_001147546.1.70241 WP_001147546.1.70269 WP_001147546.1.70289 WP_001147546.1.70447 WP_001147546.1.70485 WP_001147546.1.70643 WP_001147546.1.70683 WP_001147546.1.70883 WP_001147546.1.70922 WP_001147546.1.70948 WP_001147546.1.70959 WP_001147546.1.71023 WP_001147546.1.71116 WP_001147546.1.71146 WP_001147546.1.71165 WP_001147546.1.71188 WP_001147546.1.71202 WP_001147546.1.71243 WP_001147546.1.71306 WP_001147546.1.71337 WP_001147546.1.71363 WP_001147546.1.71378 WP_001147546.1.71401 WP_001147546.1.71636 WP_001147546.1.71702 WP_001147546.1.71750 WP_001147546.1.71798 WP_001147546.1.71845 WP_001147546.1.71881 WP_001147546.1.71908 WP_001147546.1.71952 WP_001147546.1.71973 WP_001147546.1.72105 WP_001147546.1.72203 WP_001147546.1.72376 WP_001147546.1.72403 WP_001147546.1.72594 WP_001147546.1.72728 WP_001147546.1.72871 WP_001147546.1.72975 WP_001147546.1.73125 WP_001147546.1.7315 WP_001147546.1.73200 WP_001147546.1.7334 WP_001147546.1.73377 WP_001147546.1.73461 WP_001147546.1.73481 WP_001147546.1.7356 WP_001147546.1.73581 WP_001147546.1.73617 WP_001147546.1.73753 WP_001147546.1.73758 WP_001147546.1.73794 WP_001147546.1.73847 WP_001147546.1.7387 WP_001147546.1.73924 WP_001147546.1.74029 WP_001147546.1.74181 WP_001147546.1.74191 WP_001147546.1.7433 WP_001147546.1.74379 WP_001147546.1.74410 WP_001147546.1.74466 WP_001147546.1.745 WP_001147546.1.74529 WP_001147546.1.74545 WP_001147546.1.74745 WP_001147546.1.7491 WP_001147546.1.75129 WP_001147546.1.75187 WP_001147546.1.75288 WP_001147546.1.75334 WP_001147546.1.75362 WP_001147546.1.75385 WP_001147546.1.75392 WP_001147546.1.75760 WP_001147546.1.75764 WP_001147546.1.75837 WP_001147546.1.75874 WP_001147546.1.75945 WP_001147546.1.76020 WP_001147546.1.76252 WP_001147546.1.76327 WP_001147546.1.76445 WP_001147546.1.7660 WP_001147546.1.76673 WP_001147546.1.76706 WP_001147546.1.76721 WP_001147546.1.76756 WP_001147546.1.76760 WP_001147546.1.76875 WP_001147546.1.76880 WP_001147546.1.76899 WP_001147546.1.77038 WP_001147546.1.77047 WP_001147546.1.77080 WP_001147546.1.7712 WP_001147546.1.77177 WP_001147546.1.77180 WP_001147546.1.77244 WP_001147546.1.77267 WP_001147546.1.77292 WP_001147546.1.77349 WP_001147546.1.77514 WP_001147546.1.77529 WP_001147546.1.77549 WP_001147546.1.77692 WP_001147546.1.77710 WP_001147546.1.7782 WP_001147546.1.77851 WP_001147546.1.77898 WP_001147546.1.77918 WP_001147546.1.77960 WP_001147546.1.78033 WP_001147546.1.78076 WP_001147546.1.78096 WP_001147546.1.78100 WP_001147546.1.78110 WP_001147546.1.78120 WP_001147546.1.78372 WP_001147546.1.78383 WP_001147546.1.78407 WP_001147546.1.7861 WP_001147546.1.78618 WP_001147546.1.78673 WP_001147546.1.78735 WP_001147546.1.78802 WP_001147546.1.78830 WP_001147546.1.78835 WP_001147546.1.78838 WP_001147546.1.78871 WP_001147546.1.78874 WP_001147546.1.78918 WP_001147546.1.78930 WP_001147546.1.79151 WP_001147546.1.79167 WP_001147546.1.79335 WP_001147546.1.79462 WP_001147546.1.79472 WP_001147546.1.79490 WP_001147546.1.79495 WP_001147546.1.79529 WP_001147546.1.79570 WP_001147546.1.7964 WP_001147546.1.79659 WP_001147546.1.79668 WP_001147546.1.79708 WP_001147546.1.79734 WP_001147546.1.79845 WP_001147546.1.80077 WP_001147546.1.80137 WP_001147546.1.80182 WP_001147546.1.80296 WP_001147546.1.80366 WP_001147546.1.80741 WP_001147546.1.80780 WP_001147546.1.80831 WP_001147546.1.80850 WP_001147546.1.80881 WP_001147546.1.80939 WP_001147546.1.8096 WP_001147546.1.81037 WP_001147546.1.81069 WP_001147546.1.81149 WP_001147546.1.81175 WP_001147546.1.8119 WP_001147546.1.81193 WP_001147546.1.81305 WP_001147546.1.81320 WP_001147546.1.81328 WP_001147546.1.81354 WP_001147546.1.81425 WP_001147546.1.81528 WP_001147546.1.81735 WP_001147546.1.81750 WP_001147546.1.81760 WP_001147546.1.81785 WP_001147546.1.81902 WP_001147546.1.81974 WP_001147546.1.82192 WP_001147546.1.82232 WP_001147546.1.82337 WP_001147546.1.82464 WP_001147546.1.82479 WP_001147546.1.82503 WP_001147546.1.82515 WP_001147546.1.82676 WP_001147546.1.82761 WP_001147546.1.8282 WP_001147546.1.82944 WP_001147546.1.82956 WP_001147546.1.83092 WP_001147546.1.83163 WP_001147546.1.83305 WP_001147546.1.83413 WP_001147546.1.83491 WP_001147546.1.83523 WP_001147546.1.8354 WP_001147546.1.83721 WP_001147546.1.83760 WP_001147546.1.83995 WP_001147546.1.84103 WP_001147546.1.84283 WP_001147546.1.84291 WP_001147546.1.84392 WP_001147546.1.84397 WP_001147546.1.8441 WP_001147546.1.84532 WP_001147546.1.84554 WP_001147546.1.84659 WP_001147546.1.84899 WP_001147546.1.8497 WP_001147546.1.85134 WP_001147546.1.85178 WP_001147546.1.85180 WP_001147546.1.85190 WP_001147546.1.8533 WP_001147546.1.8545 WP_001147546.1.85481 WP_001147546.1.85483 WP_001147546.1.85541 WP_001147546.1.8556 WP_001147546.1.85568 WP_001147546.1.85615 WP_001147546.1.85617 WP_001147546.1.85663 WP_001147546.1.85671 WP_001147546.1.85672 WP_001147546.1.85777 WP_001147546.1.85886 WP_001147546.1.85900 WP_001147546.1.85904 WP_001147546.1.85976 WP_001147546.1.86043 WP_001147546.1.86173 WP_001147546.1.86306 WP_001147546.1.86356 WP_001147546.1.86450 WP_001147546.1.86469 WP_001147546.1.86580 WP_001147546.1.86588 WP_001147546.1.86661 WP_001147546.1.8671 WP_001147546.1.8678 WP_001147546.1.86810 WP_001147546.1.8684 WP_001147546.1.86895 WP_001147546.1.86906 WP_001147546.1.87095 WP_001147546.1.87323 WP_001147546.1.8736 WP_001147546.1.87460 WP_001147546.1.87552 WP_001147546.1.87695 WP_001147546.1.87779 WP_001147546.1.87899 WP_001147546.1.8792 WP_001147546.1.87945 WP_001147546.1.88019 WP_001147546.1.88073 WP_001147546.1.8809 WP_001147546.1.88092 WP_001147546.1.88291 WP_001147546.1.88293 WP_001147546.1.8837 WP_001147546.1.88393 WP_001147546.1.88703 WP_001147546.1.88792 WP_001147546.1.88902 WP_001147546.1.8891 WP_001147546.1.88957 WP_001147546.1.88980 WP_001147546.1.88981 WP_001147546.1.89008 WP_001147546.1.89114 WP_001147546.1.89116 WP_001147546.1.89119 WP_001147546.1.89138 WP_001147546.1.89304 WP_001147546.1.89512 WP_001147546.1.89527 WP_001147546.1.89570 WP_001147546.1.89604 WP_001147546.1.89622 WP_001147546.1.89657 WP_001147546.1.89659 WP_001147546.1.89765 WP_001147546.1.89817 WP_001147546.1.89902 WP_001147546.1.8996 WP_001147546.1.90097 WP_001147546.1.90252 WP_001147546.1.90417 WP_001147546.1.90453 WP_001147546.1.90458 WP_001147546.1.90557 WP_001147546.1.90585 WP_001147546.1.90641 WP_001147546.1.90734 WP_001147546.1.91003 WP_001147546.1.91056 WP_001147546.1.91069 WP_001147546.1.91179 WP_001147546.1.91278 WP_001147546.1.91512 WP_001147546.1.91564 WP_001147546.1.91621 WP_001147546.1.91628 WP_001147546.1.91655 WP_001147546.1.91724 WP_001147546.1.91732 WP_001147546.1.91788 WP_001147546.1.92013 WP_001147546.1.92093 WP_001147546.1.92108 WP_001147546.1.92165 WP_001147546.1.92183 WP_001147546.1.92208 WP_001147546.1.92268 WP_001147546.1.92310 WP_001147546.1.92443 WP_001147546.1.92482 WP_001147546.1.92531 WP_001147546.1.92669 WP_001147546.1.92671 WP_001147546.1.92738 WP_001147546.1.92893 WP_001147546.1.93059 WP_001147546.1.93086 WP_001147546.1.93101 WP_001147546.1.93136 WP_001147546.1.93155 WP_001147546.1.93339 WP_001147546.1.93365 WP_001147546.1.93543 WP_001147546.1.93650 WP_001147546.1.93656 WP_001147546.1.93662 WP_001147546.1.937 WP_001147546.1.93705 WP_001147546.1.93804 WP_001147546.1.9389 WP_001147546.1.93937 WP_001147546.1.93994 WP_001147546.1.94072 WP_001147546.1.94162 WP_001147546.1.94168 WP_001147546.1.94198 WP_001147546.1.9432 WP_001147546.1.94354 WP_001147546.1.94380 WP_001147546.1.94458 WP_001147546.1.94565 WP_001147546.1.94584 WP_001147546.1.94655 WP_001147546.1.94674 WP_001147546.1.94796 WP_001147546.1.94959 WP_001147546.1.95051 WP_001147546.1.95085 WP_001147546.1.95121 WP_001147546.1.95248 WP_001147546.1.95277 WP_001147546.1.95282 WP_001147546.1.95388 WP_001147546.1.95546 WP_001147546.1.95630 WP_001147546.1.95670 WP_001147546.1.95691 WP_001147546.1.95911 WP_001147546.1.95939 WP_001147546.1.96004 WP_001147546.1.96139 WP_001147546.1.96162 WP_001147546.1.96317 WP_001147546.1.96343 WP_001147546.1.9644 WP_001147546.1.96469 WP_001147546.1.96500 WP_001147546.1.96555 WP_001147546.1.96563 WP_001147546.1.96732 WP_001147546.1.9674 WP_001147546.1.96771 WP_001147546.1.97015 WP_001147546.1.97047 WP_001147546.1.97143 WP_001147546.1.97145 WP_001147546.1.97190 WP_001147546.1.97297 WP_001147546.1.97318 WP_001147546.1.97369 WP_001147546.1.97477 WP_001147546.1.97487 WP_001147546.1.97594 WP_001147546.1.97597 WP_001147546.1.97613 WP_001147546.1.97620 WP_001147546.1.97631 WP_001147546.1.97727 WP_001147546.1.97732 WP_001147546.1.97736 WP_001147546.1.9775 WP_001147546.1.97846 WP_001147546.1.9799 WP_001147546.1.98006 WP_001147546.1.98019 WP_001147546.1.98022 WP_001147546.1.98110 WP_001147546.1.98146 WP_001147546.1.98170 WP_001147546.1.98219 WP_001147546.1.9826 WP_001147546.1.9841 WP_001147546.1.98495 WP_001147546.1.98531 WP_001147546.1.98577 WP_001147546.1.98676 WP_001147546.1.98677 WP_001147546.1.98760 WP_001147546.1.98843 WP_001147546.1.9898 WP_001147546.1.99098 WP_001147546.1.99184 WP_001147546.1.99267 WP_001147546.1.99276 WP_001147546.1.99626 WP_001147546.1.99646 WP_001147546.1.99657 WP_001147546.1.99660 WP_001147546.1.99712 WP_001147546.1.99813 WP_001147546.1.99858 WP_001147546.1.99889 WP_001147546.1.99958 gi|378701033|ref|YP_005182990.1| gi|525814410|ref|YP_008244428.1| gi|379702384|ref|YP_005244112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]