SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451925|ref|YP_005239285.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451925|ref|YP_005239285.1|
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Hcp1-like 1.31e-46
Family Hcp1-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378451925|ref|YP_005239285.1|
Sequence length 161
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMNQIGK
Download sequence
Identical sequences A0A0D6IDM0 A0A0F6B6P2 A0A0F7JAB5 A0A0H3NHV0 A0A0M0QWB9 A0A0U1GGI7 A0A265B3C4 A0A2D3AGE8 A0A2H9YIY3 E8XAI0 Q8ZM26
gi|378990449|ref|YP_005253613.1| gi|194449910|ref|YP_002047123.1| ABAO01000002|CDS_170628-171113 ABEL01000006|CDS_18686-18201 AE006468|CDS_3291457-3290972 CP001120|CDS_3283824-3283339 CP001363|CDS_3309710-3309225 FN424405|CDS_3282698-3282213 gi|379702388|ref|YP_005244116.1| gi|383497791|ref|YP_005398480.1| gi|549725694|ref|YP_008645884.1| NP_462046.1.58477 WP_000338754.1.100010 WP_000338754.1.100234 WP_000338754.1.100376 WP_000338754.1.100424 WP_000338754.1.100436 WP_000338754.1.100484 WP_000338754.1.100488 WP_000338754.1.100597 WP_000338754.1.100730 WP_000338754.1.10076 WP_000338754.1.100781 WP_000338754.1.100793 WP_000338754.1.100869 WP_000338754.1.100871 WP_000338754.1.100882 WP_000338754.1.101007 WP_000338754.1.101020 WP_000338754.1.101074 WP_000338754.1.101078 WP_000338754.1.101180 WP_000338754.1.101259 WP_000338754.1.101284 WP_000338754.1.101291 WP_000338754.1.1013 WP_000338754.1.101353 WP_000338754.1.101386 WP_000338754.1.101404 WP_000338754.1.101420 WP_000338754.1.101589 WP_000338754.1.101707 WP_000338754.1.101734 WP_000338754.1.101878 WP_000338754.1.101953 WP_000338754.1.10220 WP_000338754.1.10231 WP_000338754.1.10266 WP_000338754.1.10429 WP_000338754.1.10439 WP_000338754.1.10566 WP_000338754.1.10678 WP_000338754.1.10753 WP_000338754.1.10992 WP_000338754.1.11024 WP_000338754.1.11031 WP_000338754.1.11098 WP_000338754.1.1110 WP_000338754.1.11156 WP_000338754.1.11168 WP_000338754.1.11190 WP_000338754.1.11295 WP_000338754.1.11455 WP_000338754.1.11458 WP_000338754.1.11518 WP_000338754.1.11532 WP_000338754.1.11543 WP_000338754.1.11588 WP_000338754.1.11677 WP_000338754.1.11687 WP_000338754.1.11735 WP_000338754.1.11763 WP_000338754.1.11772 WP_000338754.1.11834 WP_000338754.1.11897 WP_000338754.1.12017 WP_000338754.1.12114 WP_000338754.1.12351 WP_000338754.1.12370 WP_000338754.1.12546 WP_000338754.1.1264 WP_000338754.1.12728 WP_000338754.1.12879 WP_000338754.1.12936 WP_000338754.1.12995 WP_000338754.1.13027 WP_000338754.1.13106 WP_000338754.1.13130 WP_000338754.1.13207 WP_000338754.1.13414 WP_000338754.1.13488 WP_000338754.1.13509 WP_000338754.1.13661 WP_000338754.1.13669 WP_000338754.1.13741 WP_000338754.1.1387 WP_000338754.1.13908 WP_000338754.1.13932 WP_000338754.1.13968 WP_000338754.1.14001 WP_000338754.1.14111 WP_000338754.1.14151 WP_000338754.1.14239 WP_000338754.1.14320 WP_000338754.1.14379 WP_000338754.1.14406 WP_000338754.1.14410 WP_000338754.1.14436 WP_000338754.1.14458 WP_000338754.1.14466 WP_000338754.1.14524 WP_000338754.1.14554 WP_000338754.1.14618 WP_000338754.1.14725 WP_000338754.1.14852 WP_000338754.1.1489 WP_000338754.1.14932 WP_000338754.1.15055 WP_000338754.1.15124 WP_000338754.1.15223 WP_000338754.1.15226 WP_000338754.1.15316 WP_000338754.1.15369 WP_000338754.1.1540 WP_000338754.1.15508 WP_000338754.1.15784 WP_000338754.1.15830 WP_000338754.1.15862 WP_000338754.1.15910 WP_000338754.1.15986 WP_000338754.1.16004 WP_000338754.1.16047 WP_000338754.1.16062 WP_000338754.1.16063 WP_000338754.1.16103 WP_000338754.1.16226 WP_000338754.1.16233 WP_000338754.1.16284 WP_000338754.1.16328 WP_000338754.1.1635 WP_000338754.1.16361 WP_000338754.1.16468 WP_000338754.1.16525 WP_000338754.1.16614 WP_000338754.1.16650 WP_000338754.1.16686 WP_000338754.1.16691 WP_000338754.1.16732 WP_000338754.1.16735 WP_000338754.1.16786 WP_000338754.1.16858 WP_000338754.1.16873 WP_000338754.1.16896 WP_000338754.1.16903 WP_000338754.1.16916 WP_000338754.1.16965 WP_000338754.1.1700 WP_000338754.1.17093 WP_000338754.1.17307 WP_000338754.1.174 WP_000338754.1.17480 WP_000338754.1.17546 WP_000338754.1.17702 WP_000338754.1.17705 WP_000338754.1.17743 WP_000338754.1.17891 WP_000338754.1.1798 WP_000338754.1.18019 WP_000338754.1.18111 WP_000338754.1.18122 WP_000338754.1.18163 WP_000338754.1.1818 WP_000338754.1.18254 WP_000338754.1.18265 WP_000338754.1.18267 WP_000338754.1.18468 WP_000338754.1.18607 WP_000338754.1.18715 WP_000338754.1.18776 WP_000338754.1.18822 WP_000338754.1.18881 WP_000338754.1.18940 WP_000338754.1.18949 WP_000338754.1.19053 WP_000338754.1.19273 WP_000338754.1.19320 WP_000338754.1.19458 WP_000338754.1.19460 WP_000338754.1.19461 WP_000338754.1.19588 WP_000338754.1.19614 WP_000338754.1.19616 WP_000338754.1.19702 WP_000338754.1.19706 WP_000338754.1.19724 WP_000338754.1.19749 WP_000338754.1.19784 WP_000338754.1.19793 WP_000338754.1.19802 WP_000338754.1.19809 WP_000338754.1.19867 WP_000338754.1.19975 WP_000338754.1.1998 WP_000338754.1.20 WP_000338754.1.2010 WP_000338754.1.20212 WP_000338754.1.20266 WP_000338754.1.20271 WP_000338754.1.20362 WP_000338754.1.20418 WP_000338754.1.20443 WP_000338754.1.20446 WP_000338754.1.20525 WP_000338754.1.2054 WP_000338754.1.20553 WP_000338754.1.20614 WP_000338754.1.20626 WP_000338754.1.20646 WP_000338754.1.20886 WP_000338754.1.20908 WP_000338754.1.21049 WP_000338754.1.21136 WP_000338754.1.21146 WP_000338754.1.21245 WP_000338754.1.21246 WP_000338754.1.21269 WP_000338754.1.21351 WP_000338754.1.21400 WP_000338754.1.21497 WP_000338754.1.21499 WP_000338754.1.21603 WP_000338754.1.21751 WP_000338754.1.21757 WP_000338754.1.21991 WP_000338754.1.22024 WP_000338754.1.2205 WP_000338754.1.22062 WP_000338754.1.22067 WP_000338754.1.2221 WP_000338754.1.22235 WP_000338754.1.2235 WP_000338754.1.22379 WP_000338754.1.22427 WP_000338754.1.2246 WP_000338754.1.22485 WP_000338754.1.22620 WP_000338754.1.22692 WP_000338754.1.22758 WP_000338754.1.22864 WP_000338754.1.22870 WP_000338754.1.22979 WP_000338754.1.23102 WP_000338754.1.23114 WP_000338754.1.2314 WP_000338754.1.23192 WP_000338754.1.23259 WP_000338754.1.23379 WP_000338754.1.23460 WP_000338754.1.23472 WP_000338754.1.23482 WP_000338754.1.23509 WP_000338754.1.23634 WP_000338754.1.2364 WP_000338754.1.23932 WP_000338754.1.23959 WP_000338754.1.24017 WP_000338754.1.24082 WP_000338754.1.24206 WP_000338754.1.24308 WP_000338754.1.24578 WP_000338754.1.24737 WP_000338754.1.24779 WP_000338754.1.25008 WP_000338754.1.25015 WP_000338754.1.25119 WP_000338754.1.25405 WP_000338754.1.25454 WP_000338754.1.25493 WP_000338754.1.25668 WP_000338754.1.25690 WP_000338754.1.2570 WP_000338754.1.25740 WP_000338754.1.25793 WP_000338754.1.25814 WP_000338754.1.25988 WP_000338754.1.26311 WP_000338754.1.26319 WP_000338754.1.26429 WP_000338754.1.26440 WP_000338754.1.26493 WP_000338754.1.26551 WP_000338754.1.26567 WP_000338754.1.26741 WP_000338754.1.26919 WP_000338754.1.27010 WP_000338754.1.27084 WP_000338754.1.27173 WP_000338754.1.27206 WP_000338754.1.27223 WP_000338754.1.27423 WP_000338754.1.27544 WP_000338754.1.2763 WP_000338754.1.27665 WP_000338754.1.27707 WP_000338754.1.27761 WP_000338754.1.2777 WP_000338754.1.27857 WP_000338754.1.27977 WP_000338754.1.28032 WP_000338754.1.28094 WP_000338754.1.28170 WP_000338754.1.28302 WP_000338754.1.2835 WP_000338754.1.28370 WP_000338754.1.28538 WP_000338754.1.28575 WP_000338754.1.28625 WP_000338754.1.28655 WP_000338754.1.28694 WP_000338754.1.2879 WP_000338754.1.2890 WP_000338754.1.28938 WP_000338754.1.28946 WP_000338754.1.29006 WP_000338754.1.29010 WP_000338754.1.2910 WP_000338754.1.29113 WP_000338754.1.29509 WP_000338754.1.29588 WP_000338754.1.29601 WP_000338754.1.29606 WP_000338754.1.29615 WP_000338754.1.29619 WP_000338754.1.29704 WP_000338754.1.29827 WP_000338754.1.29969 WP_000338754.1.29990 WP_000338754.1.30006 WP_000338754.1.30022 WP_000338754.1.30027 WP_000338754.1.30180 WP_000338754.1.30202 WP_000338754.1.30469 WP_000338754.1.30505 WP_000338754.1.30507 WP_000338754.1.30535 WP_000338754.1.30547 WP_000338754.1.30794 WP_000338754.1.30833 WP_000338754.1.30835 WP_000338754.1.30972 WP_000338754.1.31 WP_000338754.1.31092 WP_000338754.1.31122 WP_000338754.1.3113 WP_000338754.1.31185 WP_000338754.1.3119 WP_000338754.1.31190 WP_000338754.1.31195 WP_000338754.1.31196 WP_000338754.1.31281 WP_000338754.1.31362 WP_000338754.1.31451 WP_000338754.1.31504 WP_000338754.1.31515 WP_000338754.1.31578 WP_000338754.1.31658 WP_000338754.1.31940 WP_000338754.1.31967 WP_000338754.1.31972 WP_000338754.1.32192 WP_000338754.1.32206 WP_000338754.1.32260 WP_000338754.1.32438 WP_000338754.1.32515 WP_000338754.1.32660 WP_000338754.1.32702 WP_000338754.1.32714 WP_000338754.1.32786 WP_000338754.1.32804 WP_000338754.1.32907 WP_000338754.1.33030 WP_000338754.1.33127 WP_000338754.1.33143 WP_000338754.1.33248 WP_000338754.1.33261 WP_000338754.1.333 WP_000338754.1.33492 WP_000338754.1.33553 WP_000338754.1.33580 WP_000338754.1.33592 WP_000338754.1.33894 WP_000338754.1.3394 WP_000338754.1.34043 WP_000338754.1.34075 WP_000338754.1.34257 WP_000338754.1.34279 WP_000338754.1.34319 WP_000338754.1.34417 WP_000338754.1.34453 WP_000338754.1.34610 WP_000338754.1.34856 WP_000338754.1.34975 WP_000338754.1.35045 WP_000338754.1.35129 WP_000338754.1.35184 WP_000338754.1.35193 WP_000338754.1.35404 WP_000338754.1.35408 WP_000338754.1.35425 WP_000338754.1.35446 WP_000338754.1.35463 WP_000338754.1.35503 WP_000338754.1.35509 WP_000338754.1.35590 WP_000338754.1.35892 WP_000338754.1.35940 WP_000338754.1.36003 WP_000338754.1.3601 WP_000338754.1.36017 WP_000338754.1.36547 WP_000338754.1.36609 WP_000338754.1.36690 WP_000338754.1.3670 WP_000338754.1.36705 WP_000338754.1.36918 WP_000338754.1.36931 WP_000338754.1.37073 WP_000338754.1.37111 WP_000338754.1.37112 WP_000338754.1.37256 WP_000338754.1.37293 WP_000338754.1.37376 WP_000338754.1.3744 WP_000338754.1.37498 WP_000338754.1.37504 WP_000338754.1.37618 WP_000338754.1.37968 WP_000338754.1.37978 WP_000338754.1.38125 WP_000338754.1.38145 WP_000338754.1.383 WP_000338754.1.38393 WP_000338754.1.3848 WP_000338754.1.38569 WP_000338754.1.38613 WP_000338754.1.38673 WP_000338754.1.38693 WP_000338754.1.38773 WP_000338754.1.38781 WP_000338754.1.38882 WP_000338754.1.38913 WP_000338754.1.39003 WP_000338754.1.39136 WP_000338754.1.39197 WP_000338754.1.39229 WP_000338754.1.39265 WP_000338754.1.39405 WP_000338754.1.39420 WP_000338754.1.39449 WP_000338754.1.39512 WP_000338754.1.39584 WP_000338754.1.39629 WP_000338754.1.39724 WP_000338754.1.39763 WP_000338754.1.39862 WP_000338754.1.39921 WP_000338754.1.39923 WP_000338754.1.40017 WP_000338754.1.40072 WP_000338754.1.40073 WP_000338754.1.4011 WP_000338754.1.40208 WP_000338754.1.40240 WP_000338754.1.40257 WP_000338754.1.40292 WP_000338754.1.40305 WP_000338754.1.40311 WP_000338754.1.40341 WP_000338754.1.40380 WP_000338754.1.40395 WP_000338754.1.40465 WP_000338754.1.40710 WP_000338754.1.4075 WP_000338754.1.4087 WP_000338754.1.40877 WP_000338754.1.40996 WP_000338754.1.41017 WP_000338754.1.41018 WP_000338754.1.41086 WP_000338754.1.41091 WP_000338754.1.41226 WP_000338754.1.41279 WP_000338754.1.41516 WP_000338754.1.41554 WP_000338754.1.41572 WP_000338754.1.41591 WP_000338754.1.41662 WP_000338754.1.41708 WP_000338754.1.41761 WP_000338754.1.41882 WP_000338754.1.41979 WP_000338754.1.41985 WP_000338754.1.42104 WP_000338754.1.42156 WP_000338754.1.4222 WP_000338754.1.42243 WP_000338754.1.42320 WP_000338754.1.42342 WP_000338754.1.42422 WP_000338754.1.42444 WP_000338754.1.42676 WP_000338754.1.4276 WP_000338754.1.42864 WP_000338754.1.4288 WP_000338754.1.43018 WP_000338754.1.43041 WP_000338754.1.43077 WP_000338754.1.43244 WP_000338754.1.43312 WP_000338754.1.43334 WP_000338754.1.43339 WP_000338754.1.43371 WP_000338754.1.43437 WP_000338754.1.43522 WP_000338754.1.43613 WP_000338754.1.43668 WP_000338754.1.43778 WP_000338754.1.43886 WP_000338754.1.43951 WP_000338754.1.44005 WP_000338754.1.44043 WP_000338754.1.44099 WP_000338754.1.44121 WP_000338754.1.44291 WP_000338754.1.44300 WP_000338754.1.44310 WP_000338754.1.44386 WP_000338754.1.44433 WP_000338754.1.44479 WP_000338754.1.44640 WP_000338754.1.4467 WP_000338754.1.44747 WP_000338754.1.4485 WP_000338754.1.44877 WP_000338754.1.44927 WP_000338754.1.44933 WP_000338754.1.45067 WP_000338754.1.45074 WP_000338754.1.45079 WP_000338754.1.45098 WP_000338754.1.45145 WP_000338754.1.45177 WP_000338754.1.45184 WP_000338754.1.45259 WP_000338754.1.45349 WP_000338754.1.45365 WP_000338754.1.45434 WP_000338754.1.45550 WP_000338754.1.45582 WP_000338754.1.45585 WP_000338754.1.45622 WP_000338754.1.45660 WP_000338754.1.45690 WP_000338754.1.458 WP_000338754.1.45848 WP_000338754.1.46011 WP_000338754.1.46069 WP_000338754.1.46112 WP_000338754.1.46173 WP_000338754.1.46174 WP_000338754.1.46187 WP_000338754.1.46278 WP_000338754.1.46303 WP_000338754.1.46434 WP_000338754.1.46595 WP_000338754.1.46675 WP_000338754.1.47008 WP_000338754.1.47057 WP_000338754.1.47214 WP_000338754.1.47429 WP_000338754.1.47448 WP_000338754.1.4747 WP_000338754.1.47472 WP_000338754.1.47478 WP_000338754.1.47579 WP_000338754.1.47621 WP_000338754.1.47799 WP_000338754.1.48242 WP_000338754.1.48253 WP_000338754.1.483 WP_000338754.1.48367 WP_000338754.1.4853 WP_000338754.1.48788 WP_000338754.1.4885 WP_000338754.1.48876 WP_000338754.1.48894 WP_000338754.1.48919 WP_000338754.1.49084 WP_000338754.1.49113 WP_000338754.1.49155 WP_000338754.1.49204 WP_000338754.1.49239 WP_000338754.1.49256 WP_000338754.1.49290 WP_000338754.1.49340 WP_000338754.1.49366 WP_000338754.1.49490 WP_000338754.1.49515 WP_000338754.1.49572 WP_000338754.1.49686 WP_000338754.1.4979 WP_000338754.1.49803 WP_000338754.1.49805 WP_000338754.1.49929 WP_000338754.1.50080 WP_000338754.1.50161 WP_000338754.1.50211 WP_000338754.1.50376 WP_000338754.1.50389 WP_000338754.1.50404 WP_000338754.1.50676 WP_000338754.1.50804 WP_000338754.1.50808 WP_000338754.1.5088 WP_000338754.1.50908 WP_000338754.1.50941 WP_000338754.1.50999 WP_000338754.1.51014 WP_000338754.1.51022 WP_000338754.1.51066 WP_000338754.1.51179 WP_000338754.1.51182 WP_000338754.1.51186 WP_000338754.1.51224 WP_000338754.1.51487 WP_000338754.1.51488 WP_000338754.1.51634 WP_000338754.1.51649 WP_000338754.1.51686 WP_000338754.1.51756 WP_000338754.1.51831 WP_000338754.1.51911 WP_000338754.1.51932 WP_000338754.1.51989 WP_000338754.1.52121 WP_000338754.1.52170 WP_000338754.1.52336 WP_000338754.1.52346 WP_000338754.1.52353 WP_000338754.1.52361 WP_000338754.1.52653 WP_000338754.1.52656 WP_000338754.1.52692 WP_000338754.1.52743 WP_000338754.1.52857 WP_000338754.1.52866 WP_000338754.1.52898 WP_000338754.1.52915 WP_000338754.1.52949 WP_000338754.1.52985 WP_000338754.1.53190 WP_000338754.1.53272 WP_000338754.1.53406 WP_000338754.1.53466 WP_000338754.1.53529 WP_000338754.1.53543 WP_000338754.1.53757 WP_000338754.1.53812 WP_000338754.1.53905 WP_000338754.1.54033 WP_000338754.1.54075 WP_000338754.1.54196 WP_000338754.1.54209 WP_000338754.1.54271 WP_000338754.1.54274 WP_000338754.1.54319 WP_000338754.1.54364 WP_000338754.1.54400 WP_000338754.1.54526 WP_000338754.1.54644 WP_000338754.1.54662 WP_000338754.1.54722 WP_000338754.1.54749 WP_000338754.1.54764 WP_000338754.1.55008 WP_000338754.1.55152 WP_000338754.1.55156 WP_000338754.1.55285 WP_000338754.1.55325 WP_000338754.1.55430 WP_000338754.1.55475 WP_000338754.1.5560 WP_000338754.1.55647 WP_000338754.1.55743 WP_000338754.1.55768 WP_000338754.1.55782 WP_000338754.1.55796 WP_000338754.1.55973 WP_000338754.1.56002 WP_000338754.1.56012 WP_000338754.1.56105 WP_000338754.1.56238 WP_000338754.1.56244 WP_000338754.1.56286 WP_000338754.1.56304 WP_000338754.1.56414 WP_000338754.1.56438 WP_000338754.1.56559 WP_000338754.1.56560 WP_000338754.1.56601 WP_000338754.1.56614 WP_000338754.1.56660 WP_000338754.1.56671 WP_000338754.1.56682 WP_000338754.1.56877 WP_000338754.1.57168 WP_000338754.1.57187 WP_000338754.1.57356 WP_000338754.1.57377 WP_000338754.1.57418 WP_000338754.1.57433 WP_000338754.1.57515 WP_000338754.1.57529 WP_000338754.1.57576 WP_000338754.1.57601 WP_000338754.1.57607 WP_000338754.1.5774 WP_000338754.1.57763 WP_000338754.1.57862 WP_000338754.1.57890 WP_000338754.1.57891 WP_000338754.1.57978 WP_000338754.1.5801 WP_000338754.1.58041 WP_000338754.1.58358 WP_000338754.1.58407 WP_000338754.1.58418 WP_000338754.1.58548 WP_000338754.1.5858 WP_000338754.1.58662 WP_000338754.1.58669 WP_000338754.1.58745 WP_000338754.1.58803 WP_000338754.1.5886 WP_000338754.1.59094 WP_000338754.1.59224 WP_000338754.1.59321 WP_000338754.1.59375 WP_000338754.1.59420 WP_000338754.1.59458 WP_000338754.1.59490 WP_000338754.1.59508 WP_000338754.1.59684 WP_000338754.1.59694 WP_000338754.1.59771 WP_000338754.1.5979 WP_000338754.1.59953 WP_000338754.1.60008 WP_000338754.1.60021 WP_000338754.1.60069 WP_000338754.1.60140 WP_000338754.1.60155 WP_000338754.1.60285 WP_000338754.1.60379 WP_000338754.1.60464 WP_000338754.1.60545 WP_000338754.1.60561 WP_000338754.1.60772 WP_000338754.1.60874 WP_000338754.1.60941 WP_000338754.1.61078 WP_000338754.1.6114 WP_000338754.1.61232 WP_000338754.1.6129 WP_000338754.1.61296 WP_000338754.1.61345 WP_000338754.1.61417 WP_000338754.1.61574 WP_000338754.1.61712 WP_000338754.1.61714 WP_000338754.1.61730 WP_000338754.1.61857 WP_000338754.1.61918 WP_000338754.1.61952 WP_000338754.1.62007 WP_000338754.1.62020 WP_000338754.1.62025 WP_000338754.1.6209 WP_000338754.1.62204 WP_000338754.1.62257 WP_000338754.1.62304 WP_000338754.1.62364 WP_000338754.1.62374 WP_000338754.1.62403 WP_000338754.1.6253 WP_000338754.1.62853 WP_000338754.1.62903 WP_000338754.1.62910 WP_000338754.1.62955 WP_000338754.1.63181 WP_000338754.1.63203 WP_000338754.1.63256 WP_000338754.1.63290 WP_000338754.1.63382 WP_000338754.1.63432 WP_000338754.1.63461 WP_000338754.1.63479 WP_000338754.1.63577 WP_000338754.1.63664 WP_000338754.1.63718 WP_000338754.1.6375 WP_000338754.1.63757 WP_000338754.1.63797 WP_000338754.1.63834 WP_000338754.1.64018 WP_000338754.1.64046 WP_000338754.1.6423 WP_000338754.1.64244 WP_000338754.1.64387 WP_000338754.1.64403 WP_000338754.1.64649 WP_000338754.1.64702 WP_000338754.1.64757 WP_000338754.1.64781 WP_000338754.1.64831 WP_000338754.1.6489 WP_000338754.1.64894 WP_000338754.1.65018 WP_000338754.1.65028 WP_000338754.1.65171 WP_000338754.1.65248 WP_000338754.1.65269 WP_000338754.1.6535 WP_000338754.1.65474 WP_000338754.1.65633 WP_000338754.1.6565 WP_000338754.1.65696 WP_000338754.1.6575 WP_000338754.1.65782 WP_000338754.1.65940 WP_000338754.1.65956 WP_000338754.1.66049 WP_000338754.1.6630 WP_000338754.1.66314 WP_000338754.1.66330 WP_000338754.1.66358 WP_000338754.1.66362 WP_000338754.1.6638 WP_000338754.1.6640 WP_000338754.1.66678 WP_000338754.1.66698 WP_000338754.1.6680 WP_000338754.1.66834 WP_000338754.1.66901 WP_000338754.1.66962 WP_000338754.1.67037 WP_000338754.1.67045 WP_000338754.1.67100 WP_000338754.1.67181 WP_000338754.1.67235 WP_000338754.1.67268 WP_000338754.1.67347 WP_000338754.1.6739 WP_000338754.1.67465 WP_000338754.1.67552 WP_000338754.1.67682 WP_000338754.1.67829 WP_000338754.1.67887 WP_000338754.1.68073 WP_000338754.1.68201 WP_000338754.1.68206 WP_000338754.1.6827 WP_000338754.1.68275 WP_000338754.1.68401 WP_000338754.1.68477 WP_000338754.1.6849 WP_000338754.1.68547 WP_000338754.1.68589 WP_000338754.1.68655 WP_000338754.1.68656 WP_000338754.1.68778 WP_000338754.1.68787 WP_000338754.1.68894 WP_000338754.1.68928 WP_000338754.1.68975 WP_000338754.1.69001 WP_000338754.1.69006 WP_000338754.1.6904 WP_000338754.1.6913 WP_000338754.1.69146 WP_000338754.1.69151 WP_000338754.1.69255 WP_000338754.1.69359 WP_000338754.1.69397 WP_000338754.1.6954 WP_000338754.1.69564 WP_000338754.1.69644 WP_000338754.1.69704 WP_000338754.1.69758 WP_000338754.1.7021 WP_000338754.1.70241 WP_000338754.1.70269 WP_000338754.1.70289 WP_000338754.1.70447 WP_000338754.1.70485 WP_000338754.1.70643 WP_000338754.1.70683 WP_000338754.1.70883 WP_000338754.1.70922 WP_000338754.1.70948 WP_000338754.1.70959 WP_000338754.1.71023 WP_000338754.1.71116 WP_000338754.1.71146 WP_000338754.1.71165 WP_000338754.1.71188 WP_000338754.1.71202 WP_000338754.1.71243 WP_000338754.1.71306 WP_000338754.1.71337 WP_000338754.1.71363 WP_000338754.1.71378 WP_000338754.1.71401 WP_000338754.1.71636 WP_000338754.1.71702 WP_000338754.1.71750 WP_000338754.1.71798 WP_000338754.1.71845 WP_000338754.1.71881 WP_000338754.1.71908 WP_000338754.1.71952 WP_000338754.1.71973 WP_000338754.1.72105 WP_000338754.1.72203 WP_000338754.1.72376 WP_000338754.1.72403 WP_000338754.1.72594 WP_000338754.1.72728 WP_000338754.1.72871 WP_000338754.1.72975 WP_000338754.1.73125 WP_000338754.1.7315 WP_000338754.1.73200 WP_000338754.1.7334 WP_000338754.1.73377 WP_000338754.1.73461 WP_000338754.1.73481 WP_000338754.1.7356 WP_000338754.1.73581 WP_000338754.1.73617 WP_000338754.1.73753 WP_000338754.1.73758 WP_000338754.1.73794 WP_000338754.1.73847 WP_000338754.1.7387 WP_000338754.1.73924 WP_000338754.1.74029 WP_000338754.1.74181 WP_000338754.1.74191 WP_000338754.1.7433 WP_000338754.1.74379 WP_000338754.1.74410 WP_000338754.1.74466 WP_000338754.1.745 WP_000338754.1.74529 WP_000338754.1.74545 WP_000338754.1.74745 WP_000338754.1.7491 WP_000338754.1.75129 WP_000338754.1.75187 WP_000338754.1.75288 WP_000338754.1.75334 WP_000338754.1.75362 WP_000338754.1.75385 WP_000338754.1.75392 WP_000338754.1.75760 WP_000338754.1.75764 WP_000338754.1.75837 WP_000338754.1.75874 WP_000338754.1.75945 WP_000338754.1.76020 WP_000338754.1.76252 WP_000338754.1.76327 WP_000338754.1.76445 WP_000338754.1.7660 WP_000338754.1.76673 WP_000338754.1.76706 WP_000338754.1.76721 WP_000338754.1.76756 WP_000338754.1.76760 WP_000338754.1.76875 WP_000338754.1.76880 WP_000338754.1.76899 WP_000338754.1.77038 WP_000338754.1.77047 WP_000338754.1.77080 WP_000338754.1.7712 WP_000338754.1.77177 WP_000338754.1.77180 WP_000338754.1.77244 WP_000338754.1.77267 WP_000338754.1.77292 WP_000338754.1.77349 WP_000338754.1.77514 WP_000338754.1.77529 WP_000338754.1.77549 WP_000338754.1.77692 WP_000338754.1.77710 WP_000338754.1.7782 WP_000338754.1.77851 WP_000338754.1.77898 WP_000338754.1.77918 WP_000338754.1.77960 WP_000338754.1.78033 WP_000338754.1.78076 WP_000338754.1.78096 WP_000338754.1.78100 WP_000338754.1.78110 WP_000338754.1.78120 WP_000338754.1.78372 WP_000338754.1.78383 WP_000338754.1.78407 WP_000338754.1.7861 WP_000338754.1.78618 WP_000338754.1.78673 WP_000338754.1.78735 WP_000338754.1.78802 WP_000338754.1.78830 WP_000338754.1.78835 WP_000338754.1.78838 WP_000338754.1.78871 WP_000338754.1.78874 WP_000338754.1.78918 WP_000338754.1.78930 WP_000338754.1.79151 WP_000338754.1.79167 WP_000338754.1.79335 WP_000338754.1.79462 WP_000338754.1.79472 WP_000338754.1.79490 WP_000338754.1.79495 WP_000338754.1.79529 WP_000338754.1.79570 WP_000338754.1.7964 WP_000338754.1.79659 WP_000338754.1.79668 WP_000338754.1.79708 WP_000338754.1.79734 WP_000338754.1.79845 WP_000338754.1.80077 WP_000338754.1.80137 WP_000338754.1.80182 WP_000338754.1.80296 WP_000338754.1.80366 WP_000338754.1.80741 WP_000338754.1.80780 WP_000338754.1.80831 WP_000338754.1.80850 WP_000338754.1.80881 WP_000338754.1.80939 WP_000338754.1.8096 WP_000338754.1.81037 WP_000338754.1.81069 WP_000338754.1.81149 WP_000338754.1.81175 WP_000338754.1.8119 WP_000338754.1.81193 WP_000338754.1.81305 WP_000338754.1.81320 WP_000338754.1.81328 WP_000338754.1.81354 WP_000338754.1.81425 WP_000338754.1.81528 WP_000338754.1.81735 WP_000338754.1.81750 WP_000338754.1.81760 WP_000338754.1.81785 WP_000338754.1.81902 WP_000338754.1.81974 WP_000338754.1.82192 WP_000338754.1.82232 WP_000338754.1.82337 WP_000338754.1.82395 WP_000338754.1.82464 WP_000338754.1.82479 WP_000338754.1.82503 WP_000338754.1.82515 WP_000338754.1.82676 WP_000338754.1.82761 WP_000338754.1.8282 WP_000338754.1.82944 WP_000338754.1.82956 WP_000338754.1.83092 WP_000338754.1.83163 WP_000338754.1.83305 WP_000338754.1.83413 WP_000338754.1.83491 WP_000338754.1.83523 WP_000338754.1.8354 WP_000338754.1.83721 WP_000338754.1.83760 WP_000338754.1.83995 WP_000338754.1.84103 WP_000338754.1.84283 WP_000338754.1.84291 WP_000338754.1.84392 WP_000338754.1.84397 WP_000338754.1.8441 WP_000338754.1.84532 WP_000338754.1.84554 WP_000338754.1.84659 WP_000338754.1.84899 WP_000338754.1.8497 WP_000338754.1.85040 WP_000338754.1.85134 WP_000338754.1.85178 WP_000338754.1.85180 WP_000338754.1.85190 WP_000338754.1.8533 WP_000338754.1.8545 WP_000338754.1.85481 WP_000338754.1.85483 WP_000338754.1.85541 WP_000338754.1.8556 WP_000338754.1.85568 WP_000338754.1.85615 WP_000338754.1.85617 WP_000338754.1.85663 WP_000338754.1.85671 WP_000338754.1.85672 WP_000338754.1.85777 WP_000338754.1.85886 WP_000338754.1.85900 WP_000338754.1.85904 WP_000338754.1.85976 WP_000338754.1.86043 WP_000338754.1.86173 WP_000338754.1.86306 WP_000338754.1.86356 WP_000338754.1.86450 WP_000338754.1.86469 WP_000338754.1.86580 WP_000338754.1.86588 WP_000338754.1.86661 WP_000338754.1.8671 WP_000338754.1.8672 WP_000338754.1.8678 WP_000338754.1.86810 WP_000338754.1.8684 WP_000338754.1.86895 WP_000338754.1.86906 WP_000338754.1.87095 WP_000338754.1.87323 WP_000338754.1.8736 WP_000338754.1.87460 WP_000338754.1.87552 WP_000338754.1.87695 WP_000338754.1.87779 WP_000338754.1.87899 WP_000338754.1.8792 WP_000338754.1.87945 WP_000338754.1.88019 WP_000338754.1.88073 WP_000338754.1.8809 WP_000338754.1.88092 WP_000338754.1.88291 WP_000338754.1.88293 WP_000338754.1.8837 WP_000338754.1.88393 WP_000338754.1.88703 WP_000338754.1.88792 WP_000338754.1.88902 WP_000338754.1.8891 WP_000338754.1.88957 WP_000338754.1.88980 WP_000338754.1.88981 WP_000338754.1.89008 WP_000338754.1.89114 WP_000338754.1.89116 WP_000338754.1.89119 WP_000338754.1.89138 WP_000338754.1.89304 WP_000338754.1.89512 WP_000338754.1.89527 WP_000338754.1.89570 WP_000338754.1.89604 WP_000338754.1.89622 WP_000338754.1.89657 WP_000338754.1.89659 WP_000338754.1.89765 WP_000338754.1.89817 WP_000338754.1.89902 WP_000338754.1.8996 WP_000338754.1.90097 WP_000338754.1.90252 WP_000338754.1.90417 WP_000338754.1.90453 WP_000338754.1.90557 WP_000338754.1.90585 WP_000338754.1.90641 WP_000338754.1.90734 WP_000338754.1.91003 WP_000338754.1.91056 WP_000338754.1.91069 WP_000338754.1.91179 WP_000338754.1.91278 WP_000338754.1.91512 WP_000338754.1.91564 WP_000338754.1.91621 WP_000338754.1.91628 WP_000338754.1.91655 WP_000338754.1.91724 WP_000338754.1.91732 WP_000338754.1.91788 WP_000338754.1.92013 WP_000338754.1.92093 WP_000338754.1.92108 WP_000338754.1.92165 WP_000338754.1.92183 WP_000338754.1.92208 WP_000338754.1.92268 WP_000338754.1.92310 WP_000338754.1.92443 WP_000338754.1.92482 WP_000338754.1.92531 WP_000338754.1.92669 WP_000338754.1.92671 WP_000338754.1.92738 WP_000338754.1.92893 WP_000338754.1.93059 WP_000338754.1.93086 WP_000338754.1.93101 WP_000338754.1.93136 WP_000338754.1.93155 WP_000338754.1.93339 WP_000338754.1.93365 WP_000338754.1.93543 WP_000338754.1.93650 WP_000338754.1.93656 WP_000338754.1.93662 WP_000338754.1.937 WP_000338754.1.93705 WP_000338754.1.93804 WP_000338754.1.9389 WP_000338754.1.93937 WP_000338754.1.93994 WP_000338754.1.94072 WP_000338754.1.94162 WP_000338754.1.94168 WP_000338754.1.94198 WP_000338754.1.9432 WP_000338754.1.94354 WP_000338754.1.94380 WP_000338754.1.94458 WP_000338754.1.94565 WP_000338754.1.94584 WP_000338754.1.94655 WP_000338754.1.94674 WP_000338754.1.94796 WP_000338754.1.94959 WP_000338754.1.95051 WP_000338754.1.95085 WP_000338754.1.95121 WP_000338754.1.95248 WP_000338754.1.95277 WP_000338754.1.95282 WP_000338754.1.95388 WP_000338754.1.95630 WP_000338754.1.95670 WP_000338754.1.95691 WP_000338754.1.95911 WP_000338754.1.95939 WP_000338754.1.96004 WP_000338754.1.96139 WP_000338754.1.96162 WP_000338754.1.96317 WP_000338754.1.96343 WP_000338754.1.9644 WP_000338754.1.96469 WP_000338754.1.96500 WP_000338754.1.96555 WP_000338754.1.96563 WP_000338754.1.96732 WP_000338754.1.9674 WP_000338754.1.96771 WP_000338754.1.97015 WP_000338754.1.97047 WP_000338754.1.97143 WP_000338754.1.97145 WP_000338754.1.97190 WP_000338754.1.97297 WP_000338754.1.97318 WP_000338754.1.97369 WP_000338754.1.97477 WP_000338754.1.97487 WP_000338754.1.97594 WP_000338754.1.97597 WP_000338754.1.97613 WP_000338754.1.97620 WP_000338754.1.97631 WP_000338754.1.97727 WP_000338754.1.97732 WP_000338754.1.97736 WP_000338754.1.9775 WP_000338754.1.97846 WP_000338754.1.9799 WP_000338754.1.98006 WP_000338754.1.98019 WP_000338754.1.98022 WP_000338754.1.98110 WP_000338754.1.98146 WP_000338754.1.98170 WP_000338754.1.98219 WP_000338754.1.9826 WP_000338754.1.9841 WP_000338754.1.98495 WP_000338754.1.98531 WP_000338754.1.98577 WP_000338754.1.98676 WP_000338754.1.98677 WP_000338754.1.98760 WP_000338754.1.9898 WP_000338754.1.99098 WP_000338754.1.99184 WP_000338754.1.99267 WP_000338754.1.99276 WP_000338754.1.99626 WP_000338754.1.99646 WP_000338754.1.99657 WP_000338754.1.99660 WP_000338754.1.99712 WP_000338754.1.99813 WP_000338754.1.99858 WP_000338754.1.99889 WP_000338754.1.99958 gi|525814414|ref|YP_008244432.1| gi|525829058|ref|YP_008252063.1| gi|378446482|ref|YP_005234114.1| gi|386592831|ref|YP_006089231.1| gi|378985725|ref|YP_005248881.1| gi|378701037|ref|YP_005182994.1| gi|550902491|ref|YP_008671583.1| gi|378451925|ref|YP_005239285.1| 454169.SeHA_C3375 99287.STM3131 gi|482905697|ref|YP_007904257.1| gi|526221496|ref|YP_008267335.1| gi|525837011|ref|YP_008253687.1| gi|16766431|ref|NP_462046.1| APC23951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]