SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451985|ref|YP_005239345.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451985|ref|YP_005239345.1|
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 6.54e-154
Family Type II DNA topoisomerase 0.00000000872
Further Details:      
 
Domain Number 2 Region: 494-736
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 5.23e-51
Family GyrA/ParC C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378451985|ref|YP_005239345.1|
Sequence length 752
Comment DNA topoisomerase IV subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSKYAELLLSELGQGTADWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAKAAITLIEQPKTTLDQLLDIVQGPDYPTEAEIITPRAEIRKIYENGRGSVR
MRAVWTKEDGAVVISALPHQVSGAKVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILTEWLAFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRSEDEPKPALMSRFGISETQAEAILEL
KLRHLAKLEEMKIRGEQDELEKERDQLQGILASERKMNTLLKKELQADADAYGDDRRSPL
REREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSN
QPVVFIDTTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVEHMLMEGDDQKLLMASDA
GYGFVCTFNDLVARNRAGKTLITLPENAHVMPPLVIEDEHDMLLAITQAGRMLMFPVDSL
PQLSKGKGNKIINIPSAEAAKGDDGLAHLYVLPPQSTLTIHVGKRKIKLRPEELQKVVGE
RGRRGTLMRGLQRIDRIEIDSPHRVSHGDSEE
Download sequence
Identical sequences A0A0D6ID50 A0A0F6B6V2 A0A0F7JAE8 A0A0H3NG19 A0A0U1IPP7 A0A0W3VI86 A0A249UU45 A0A2H9YJ26 P26973
NP_462089.1.58477 WP_001281908.1.100010 WP_001281908.1.100234 WP_001281908.1.100258 WP_001281908.1.100376 WP_001281908.1.100424 WP_001281908.1.100436 WP_001281908.1.100484 WP_001281908.1.100488 WP_001281908.1.100597 WP_001281908.1.10076 WP_001281908.1.100781 WP_001281908.1.100793 WP_001281908.1.100869 WP_001281908.1.100871 WP_001281908.1.100882 WP_001281908.1.101007 WP_001281908.1.101020 WP_001281908.1.101074 WP_001281908.1.101078 WP_001281908.1.101180 WP_001281908.1.101259 WP_001281908.1.101284 WP_001281908.1.101291 WP_001281908.1.101320 WP_001281908.1.101353 WP_001281908.1.101386 WP_001281908.1.101404 WP_001281908.1.101420 WP_001281908.1.101589 WP_001281908.1.101707 WP_001281908.1.101734 WP_001281908.1.101878 WP_001281908.1.101953 WP_001281908.1.10220 WP_001281908.1.10266 WP_001281908.1.10439 WP_001281908.1.10678 WP_001281908.1.10753 WP_001281908.1.10992 WP_001281908.1.11000 WP_001281908.1.11024 WP_001281908.1.11031 WP_001281908.1.11098 WP_001281908.1.11168 WP_001281908.1.11190 WP_001281908.1.11295 WP_001281908.1.11455 WP_001281908.1.11458 WP_001281908.1.11518 WP_001281908.1.11532 WP_001281908.1.11763 WP_001281908.1.11772 WP_001281908.1.11897 WP_001281908.1.12025 WP_001281908.1.12114 WP_001281908.1.12351 WP_001281908.1.12546 WP_001281908.1.1264 WP_001281908.1.12728 WP_001281908.1.12879 WP_001281908.1.12936 WP_001281908.1.12995 WP_001281908.1.13027 WP_001281908.1.13106 WP_001281908.1.13130 WP_001281908.1.13334 WP_001281908.1.13414 WP_001281908.1.13488 WP_001281908.1.13509 WP_001281908.1.13669 WP_001281908.1.13741 WP_001281908.1.1387 WP_001281908.1.13908 WP_001281908.1.13932 WP_001281908.1.13968 WP_001281908.1.14001 WP_001281908.1.14151 WP_001281908.1.14239 WP_001281908.1.14320 WP_001281908.1.14379 WP_001281908.1.14406 WP_001281908.1.14410 WP_001281908.1.14466 WP_001281908.1.14524 WP_001281908.1.14554 WP_001281908.1.14725 WP_001281908.1.14852 WP_001281908.1.1489 WP_001281908.1.14932 WP_001281908.1.15055 WP_001281908.1.15124 WP_001281908.1.15223 WP_001281908.1.15226 WP_001281908.1.15316 WP_001281908.1.15369 WP_001281908.1.1540 WP_001281908.1.15508 WP_001281908.1.15784 WP_001281908.1.15830 WP_001281908.1.16062 WP_001281908.1.16063 WP_001281908.1.16103 WP_001281908.1.16226 WP_001281908.1.16233 WP_001281908.1.16284 WP_001281908.1.16328 WP_001281908.1.1635 WP_001281908.1.16468 WP_001281908.1.16614 WP_001281908.1.16650 WP_001281908.1.16686 WP_001281908.1.16691 WP_001281908.1.167 WP_001281908.1.16732 WP_001281908.1.16735 WP_001281908.1.16786 WP_001281908.1.16858 WP_001281908.1.16896 WP_001281908.1.16965 WP_001281908.1.1700 WP_001281908.1.17307 WP_001281908.1.174 WP_001281908.1.17480 WP_001281908.1.17546 WP_001281908.1.17702 WP_001281908.1.17705 WP_001281908.1.17747 WP_001281908.1.18019 WP_001281908.1.18111 WP_001281908.1.18163 WP_001281908.1.18265 WP_001281908.1.18267 WP_001281908.1.18282 WP_001281908.1.18468 WP_001281908.1.18607 WP_001281908.1.18705 WP_001281908.1.18715 WP_001281908.1.18776 WP_001281908.1.18822 WP_001281908.1.18881 WP_001281908.1.18940 WP_001281908.1.18949 WP_001281908.1.19053 WP_001281908.1.19458 WP_001281908.1.19460 WP_001281908.1.19461 WP_001281908.1.19614 WP_001281908.1.19642 WP_001281908.1.19702 WP_001281908.1.19706 WP_001281908.1.19724 WP_001281908.1.19749 WP_001281908.1.19784 WP_001281908.1.19802 WP_001281908.1.19809 WP_001281908.1.19867 WP_001281908.1.1998 WP_001281908.1.20 WP_001281908.1.2010 WP_001281908.1.20212 WP_001281908.1.20266 WP_001281908.1.20271 WP_001281908.1.20330 WP_001281908.1.20362 WP_001281908.1.20418 WP_001281908.1.20443 WP_001281908.1.20525 WP_001281908.1.2054 WP_001281908.1.20553 WP_001281908.1.20626 WP_001281908.1.20646 WP_001281908.1.20886 WP_001281908.1.20908 WP_001281908.1.21049 WP_001281908.1.21146 WP_001281908.1.21245 WP_001281908.1.21246 WP_001281908.1.21269 WP_001281908.1.21400 WP_001281908.1.21497 WP_001281908.1.21499 WP_001281908.1.21548 WP_001281908.1.21603 WP_001281908.1.21751 WP_001281908.1.21757 WP_001281908.1.22024 WP_001281908.1.2205 WP_001281908.1.22062 WP_001281908.1.22067 WP_001281908.1.2221 WP_001281908.1.2235 WP_001281908.1.22379 WP_001281908.1.22427 WP_001281908.1.2246 WP_001281908.1.22485 WP_001281908.1.22537 WP_001281908.1.22620 WP_001281908.1.22870 WP_001281908.1.22979 WP_001281908.1.23102 WP_001281908.1.23114 WP_001281908.1.2314 WP_001281908.1.23192 WP_001281908.1.23259 WP_001281908.1.23460 WP_001281908.1.23472 WP_001281908.1.23482 WP_001281908.1.23634 WP_001281908.1.2364 WP_001281908.1.23932 WP_001281908.1.24017 WP_001281908.1.24206 WP_001281908.1.24308 WP_001281908.1.24578 WP_001281908.1.24737 WP_001281908.1.24779 WP_001281908.1.25008 WP_001281908.1.25015 WP_001281908.1.25206 WP_001281908.1.25405 WP_001281908.1.25454 WP_001281908.1.25493 WP_001281908.1.25668 WP_001281908.1.25690 WP_001281908.1.2570 WP_001281908.1.25740 WP_001281908.1.25814 WP_001281908.1.25988 WP_001281908.1.26282 WP_001281908.1.26311 WP_001281908.1.26319 WP_001281908.1.26429 WP_001281908.1.26440 WP_001281908.1.26493 WP_001281908.1.26551 WP_001281908.1.26567 WP_001281908.1.27173 WP_001281908.1.27206 WP_001281908.1.27423 WP_001281908.1.27561 WP_001281908.1.2763 WP_001281908.1.27665 WP_001281908.1.27707 WP_001281908.1.27761 WP_001281908.1.2777 WP_001281908.1.27857 WP_001281908.1.27977 WP_001281908.1.28094 WP_001281908.1.28126 WP_001281908.1.28170 WP_001281908.1.28302 WP_001281908.1.2835 WP_001281908.1.28370 WP_001281908.1.28538 WP_001281908.1.28575 WP_001281908.1.28625 WP_001281908.1.28655 WP_001281908.1.28694 WP_001281908.1.2879 WP_001281908.1.2890 WP_001281908.1.28938 WP_001281908.1.28946 WP_001281908.1.29006 WP_001281908.1.29010 WP_001281908.1.2910 WP_001281908.1.29588 WP_001281908.1.29601 WP_001281908.1.29606 WP_001281908.1.29615 WP_001281908.1.29704 WP_001281908.1.29969 WP_001281908.1.30006 WP_001281908.1.30027 WP_001281908.1.30180 WP_001281908.1.30469 WP_001281908.1.30505 WP_001281908.1.30507 WP_001281908.1.30535 WP_001281908.1.30547 WP_001281908.1.30794 WP_001281908.1.30833 WP_001281908.1.30835 WP_001281908.1.30972 WP_001281908.1.31 WP_001281908.1.3113 WP_001281908.1.31185 WP_001281908.1.3119 WP_001281908.1.31190 WP_001281908.1.31196 WP_001281908.1.31219 WP_001281908.1.31281 WP_001281908.1.31362 WP_001281908.1.31504 WP_001281908.1.31515 WP_001281908.1.31578 WP_001281908.1.31658 WP_001281908.1.31940 WP_001281908.1.31967 WP_001281908.1.32192 WP_001281908.1.32206 WP_001281908.1.32438 WP_001281908.1.32515 WP_001281908.1.32527 WP_001281908.1.32660 WP_001281908.1.32702 WP_001281908.1.32714 WP_001281908.1.32786 WP_001281908.1.32804 WP_001281908.1.32860 WP_001281908.1.32907 WP_001281908.1.33030 WP_001281908.1.33127 WP_001281908.1.33143 WP_001281908.1.33248 WP_001281908.1.33261 WP_001281908.1.333 WP_001281908.1.33492 WP_001281908.1.33553 WP_001281908.1.33592 WP_001281908.1.33894 WP_001281908.1.34043 WP_001281908.1.34075 WP_001281908.1.34257 WP_001281908.1.34279 WP_001281908.1.34319 WP_001281908.1.34453 WP_001281908.1.34610 WP_001281908.1.34856 WP_001281908.1.34975 WP_001281908.1.34977 WP_001281908.1.35045 WP_001281908.1.35129 WP_001281908.1.35184 WP_001281908.1.35404 WP_001281908.1.35408 WP_001281908.1.35425 WP_001281908.1.35429 WP_001281908.1.35446 WP_001281908.1.35503 WP_001281908.1.35509 WP_001281908.1.35590 WP_001281908.1.35940 WP_001281908.1.36003 WP_001281908.1.3601 WP_001281908.1.36609 WP_001281908.1.36690 WP_001281908.1.3670 WP_001281908.1.36918 WP_001281908.1.36931 WP_001281908.1.37063 WP_001281908.1.37073 WP_001281908.1.37111 WP_001281908.1.37112 WP_001281908.1.37256 WP_001281908.1.37293 WP_001281908.1.37370 WP_001281908.1.37376 WP_001281908.1.3744 WP_001281908.1.37498 WP_001281908.1.37504 WP_001281908.1.37618 WP_001281908.1.37687 WP_001281908.1.37968 WP_001281908.1.37978 WP_001281908.1.38125 WP_001281908.1.38145 WP_001281908.1.383 WP_001281908.1.3848 WP_001281908.1.38613 WP_001281908.1.38673 WP_001281908.1.3869 WP_001281908.1.38693 WP_001281908.1.38882 WP_001281908.1.38913 WP_001281908.1.39003 WP_001281908.1.39136 WP_001281908.1.39197 WP_001281908.1.39229 WP_001281908.1.39405 WP_001281908.1.39449 WP_001281908.1.39512 WP_001281908.1.39556 WP_001281908.1.39629 WP_001281908.1.39763 WP_001281908.1.39862 WP_001281908.1.39923 WP_001281908.1.40017 WP_001281908.1.40072 WP_001281908.1.40073 WP_001281908.1.4011 WP_001281908.1.40208 WP_001281908.1.40240 WP_001281908.1.40257 WP_001281908.1.40292 WP_001281908.1.40305 WP_001281908.1.40311 WP_001281908.1.40380 WP_001281908.1.40395 WP_001281908.1.40465 WP_001281908.1.40508 WP_001281908.1.40710 WP_001281908.1.4075 WP_001281908.1.4087 WP_001281908.1.40877 WP_001281908.1.41017 WP_001281908.1.41086 WP_001281908.1.41091 WP_001281908.1.41226 WP_001281908.1.41279 WP_001281908.1.41516 WP_001281908.1.41554 WP_001281908.1.41572 WP_001281908.1.41591 WP_001281908.1.41662 WP_001281908.1.41708 WP_001281908.1.41761 WP_001281908.1.41859 WP_001281908.1.41882 WP_001281908.1.41979 WP_001281908.1.41985 WP_001281908.1.42104 WP_001281908.1.42320 WP_001281908.1.42342 WP_001281908.1.42422 WP_001281908.1.4276 WP_001281908.1.42864 WP_001281908.1.4288 WP_001281908.1.43018 WP_001281908.1.43041 WP_001281908.1.43244 WP_001281908.1.43312 WP_001281908.1.43334 WP_001281908.1.43351 WP_001281908.1.43437 WP_001281908.1.43522 WP_001281908.1.43613 WP_001281908.1.43668 WP_001281908.1.43886 WP_001281908.1.44005 WP_001281908.1.44043 WP_001281908.1.44099 WP_001281908.1.44121 WP_001281908.1.44291 WP_001281908.1.44310 WP_001281908.1.44479 WP_001281908.1.44640 WP_001281908.1.4467 WP_001281908.1.44747 WP_001281908.1.4485 WP_001281908.1.44877 WP_001281908.1.44927 WP_001281908.1.44971 WP_001281908.1.45067 WP_001281908.1.45074 WP_001281908.1.45079 WP_001281908.1.45098 WP_001281908.1.45177 WP_001281908.1.45259 WP_001281908.1.45344 WP_001281908.1.45349 WP_001281908.1.45365 WP_001281908.1.45550 WP_001281908.1.45585 WP_001281908.1.45660 WP_001281908.1.45690 WP_001281908.1.45797 WP_001281908.1.458 WP_001281908.1.46011 WP_001281908.1.46069 WP_001281908.1.46173 WP_001281908.1.46174 WP_001281908.1.46187 WP_001281908.1.46303 WP_001281908.1.46595 WP_001281908.1.46675 WP_001281908.1.46930 WP_001281908.1.47057 WP_001281908.1.47214 WP_001281908.1.47429 WP_001281908.1.47448 WP_001281908.1.4747 WP_001281908.1.47472 WP_001281908.1.47478 WP_001281908.1.47621 WP_001281908.1.47799 WP_001281908.1.48242 WP_001281908.1.48253 WP_001281908.1.483 WP_001281908.1.48367 WP_001281908.1.48377 WP_001281908.1.4853 WP_001281908.1.48788 WP_001281908.1.4885 WP_001281908.1.48894 WP_001281908.1.48919 WP_001281908.1.49084 WP_001281908.1.49155 WP_001281908.1.49204 WP_001281908.1.49239 WP_001281908.1.49256 WP_001281908.1.49290 WP_001281908.1.49340 WP_001281908.1.49366 WP_001281908.1.49490 WP_001281908.1.49515 WP_001281908.1.49572 WP_001281908.1.4979 WP_001281908.1.49803 WP_001281908.1.49805 WP_001281908.1.49929 WP_001281908.1.50080 WP_001281908.1.50161 WP_001281908.1.50211 WP_001281908.1.50376 WP_001281908.1.50389 WP_001281908.1.50676 WP_001281908.1.50774 WP_001281908.1.50804 WP_001281908.1.50808 WP_001281908.1.5088 WP_001281908.1.50908 WP_001281908.1.50941 WP_001281908.1.51014 WP_001281908.1.51022 WP_001281908.1.51179 WP_001281908.1.51182 WP_001281908.1.51186 WP_001281908.1.51487 WP_001281908.1.51488 WP_001281908.1.51634 WP_001281908.1.51649 WP_001281908.1.51686 WP_001281908.1.51756 WP_001281908.1.51911 WP_001281908.1.51932 WP_001281908.1.51989 WP_001281908.1.52121 WP_001281908.1.52148 WP_001281908.1.52353 WP_001281908.1.52361 WP_001281908.1.52653 WP_001281908.1.52656 WP_001281908.1.52743 WP_001281908.1.52857 WP_001281908.1.52898 WP_001281908.1.52915 WP_001281908.1.53190 WP_001281908.1.53406 WP_001281908.1.53436 WP_001281908.1.53466 WP_001281908.1.53543 WP_001281908.1.53757 WP_001281908.1.53812 WP_001281908.1.54033 WP_001281908.1.54075 WP_001281908.1.542 WP_001281908.1.54209 WP_001281908.1.54271 WP_001281908.1.54273 WP_001281908.1.54274 WP_001281908.1.54319 WP_001281908.1.54364 WP_001281908.1.54400 WP_001281908.1.54644 WP_001281908.1.54662 WP_001281908.1.54722 WP_001281908.1.54749 WP_001281908.1.54764 WP_001281908.1.55008 WP_001281908.1.55152 WP_001281908.1.55156 WP_001281908.1.55285 WP_001281908.1.55475 WP_001281908.1.55647 WP_001281908.1.55743 WP_001281908.1.55768 WP_001281908.1.55782 WP_001281908.1.55796 WP_001281908.1.55993 WP_001281908.1.56002 WP_001281908.1.56012 WP_001281908.1.56105 WP_001281908.1.56238 WP_001281908.1.56286 WP_001281908.1.56414 WP_001281908.1.56438 WP_001281908.1.56560 WP_001281908.1.56597 WP_001281908.1.56601 WP_001281908.1.56614 WP_001281908.1.56671 WP_001281908.1.56682 WP_001281908.1.56875 WP_001281908.1.56877 WP_001281908.1.57168 WP_001281908.1.57187 WP_001281908.1.57232 WP_001281908.1.57377 WP_001281908.1.57418 WP_001281908.1.57433 WP_001281908.1.57515 WP_001281908.1.57529 WP_001281908.1.57576 WP_001281908.1.57601 WP_001281908.1.57607 WP_001281908.1.57763 WP_001281908.1.57862 WP_001281908.1.57890 WP_001281908.1.57891 WP_001281908.1.57978 WP_001281908.1.5801 WP_001281908.1.58041 WP_001281908.1.58418 WP_001281908.1.5854 WP_001281908.1.58548 WP_001281908.1.5858 WP_001281908.1.58662 WP_001281908.1.58669 WP_001281908.1.58745 WP_001281908.1.58803 WP_001281908.1.5886 WP_001281908.1.59094 WP_001281908.1.59224 WP_001281908.1.59375 WP_001281908.1.59458 WP_001281908.1.59490 WP_001281908.1.59508 WP_001281908.1.5953 WP_001281908.1.59684 WP_001281908.1.59694 WP_001281908.1.59771 WP_001281908.1.5979 WP_001281908.1.59953 WP_001281908.1.60008 WP_001281908.1.60021 WP_001281908.1.60069 WP_001281908.1.60140 WP_001281908.1.60155 WP_001281908.1.60285 WP_001281908.1.60379 WP_001281908.1.60464 WP_001281908.1.60874 WP_001281908.1.60941 WP_001281908.1.61078 WP_001281908.1.6114 WP_001281908.1.61232 WP_001281908.1.6129 WP_001281908.1.61417 WP_001281908.1.61574 WP_001281908.1.61609 WP_001281908.1.61712 WP_001281908.1.61714 WP_001281908.1.61730 WP_001281908.1.61857 WP_001281908.1.61918 WP_001281908.1.61952 WP_001281908.1.62007 WP_001281908.1.62025 WP_001281908.1.62204 WP_001281908.1.62304 WP_001281908.1.62364 WP_001281908.1.62374 WP_001281908.1.62403 WP_001281908.1.6253 WP_001281908.1.62570 WP_001281908.1.62853 WP_001281908.1.62903 WP_001281908.1.62955 WP_001281908.1.63063 WP_001281908.1.63181 WP_001281908.1.63256 WP_001281908.1.63290 WP_001281908.1.63382 WP_001281908.1.63461 WP_001281908.1.63479 WP_001281908.1.63577 WP_001281908.1.63664 WP_001281908.1.63718 WP_001281908.1.6375 WP_001281908.1.63757 WP_001281908.1.63834 WP_001281908.1.64046 WP_001281908.1.6423 WP_001281908.1.64244 WP_001281908.1.64403 WP_001281908.1.64649 WP_001281908.1.64702 WP_001281908.1.64757 WP_001281908.1.64781 WP_001281908.1.64831 WP_001281908.1.6489 WP_001281908.1.65018 WP_001281908.1.65028 WP_001281908.1.65171 WP_001281908.1.65248 WP_001281908.1.6535 WP_001281908.1.65474 WP_001281908.1.65572 WP_001281908.1.65633 WP_001281908.1.6565 WP_001281908.1.65696 WP_001281908.1.6575 WP_001281908.1.65782 WP_001281908.1.6630 WP_001281908.1.66314 WP_001281908.1.66358 WP_001281908.1.66362 WP_001281908.1.6638 WP_001281908.1.6640 WP_001281908.1.66600 WP_001281908.1.66698 WP_001281908.1.6680 WP_001281908.1.66834 WP_001281908.1.66901 WP_001281908.1.66962 WP_001281908.1.67037 WP_001281908.1.67045 WP_001281908.1.67181 WP_001281908.1.67268 WP_001281908.1.67347 WP_001281908.1.67552 WP_001281908.1.67682 WP_001281908.1.67829 WP_001281908.1.67887 WP_001281908.1.68201 WP_001281908.1.68206 WP_001281908.1.6827 WP_001281908.1.68275 WP_001281908.1.6849 WP_001281908.1.68547 WP_001281908.1.68589 WP_001281908.1.68655 WP_001281908.1.68656 WP_001281908.1.68778 WP_001281908.1.68787 WP_001281908.1.68894 WP_001281908.1.68928 WP_001281908.1.68975 WP_001281908.1.69006 WP_001281908.1.6913 WP_001281908.1.69146 WP_001281908.1.69255 WP_001281908.1.69397 WP_001281908.1.69564 WP_001281908.1.69644 WP_001281908.1.69704 WP_001281908.1.7021 WP_001281908.1.70241 WP_001281908.1.70269 WP_001281908.1.70289 WP_001281908.1.70447 WP_001281908.1.70485 WP_001281908.1.70643 WP_001281908.1.70883 WP_001281908.1.70922 WP_001281908.1.70948 WP_001281908.1.71146 WP_001281908.1.71165 WP_001281908.1.71188 WP_001281908.1.71202 WP_001281908.1.71243 WP_001281908.1.71306 WP_001281908.1.71378 WP_001281908.1.71401 WP_001281908.1.71481 WP_001281908.1.71691 WP_001281908.1.71702 WP_001281908.1.71750 WP_001281908.1.71881 WP_001281908.1.71908 WP_001281908.1.71952 WP_001281908.1.71973 WP_001281908.1.72105 WP_001281908.1.72203 WP_001281908.1.72372 WP_001281908.1.72376 WP_001281908.1.72594 WP_001281908.1.72871 WP_001281908.1.72975 WP_001281908.1.73062 WP_001281908.1.7315 WP_001281908.1.73200 WP_001281908.1.7334 WP_001281908.1.73377 WP_001281908.1.73481 WP_001281908.1.7356 WP_001281908.1.73561 WP_001281908.1.73581 WP_001281908.1.73617 WP_001281908.1.73667 WP_001281908.1.73753 WP_001281908.1.73758 WP_001281908.1.73794 WP_001281908.1.7387 WP_001281908.1.73926 WP_001281908.1.74181 WP_001281908.1.74191 WP_001281908.1.74379 WP_001281908.1.74410 WP_001281908.1.74466 WP_001281908.1.74529 WP_001281908.1.74545 WP_001281908.1.74745 WP_001281908.1.75129 WP_001281908.1.75187 WP_001281908.1.75288 WP_001281908.1.75334 WP_001281908.1.75362 WP_001281908.1.75385 WP_001281908.1.75392 WP_001281908.1.75760 WP_001281908.1.75764 WP_001281908.1.75828 WP_001281908.1.75837 WP_001281908.1.75874 WP_001281908.1.75945 WP_001281908.1.76020 WP_001281908.1.76252 WP_001281908.1.76445 WP_001281908.1.7660 WP_001281908.1.76673 WP_001281908.1.76706 WP_001281908.1.76721 WP_001281908.1.76756 WP_001281908.1.76760 WP_001281908.1.76875 WP_001281908.1.76880 WP_001281908.1.76899 WP_001281908.1.77038 WP_001281908.1.77047 WP_001281908.1.77080 WP_001281908.1.7712 WP_001281908.1.77180 WP_001281908.1.77244 WP_001281908.1.77292 WP_001281908.1.77349 WP_001281908.1.77514 WP_001281908.1.77529 WP_001281908.1.77549 WP_001281908.1.77692 WP_001281908.1.7782 WP_001281908.1.77851 WP_001281908.1.77898 WP_001281908.1.77918 WP_001281908.1.77960 WP_001281908.1.78033 WP_001281908.1.78076 WP_001281908.1.78096 WP_001281908.1.78100 WP_001281908.1.78110 WP_001281908.1.78120 WP_001281908.1.78383 WP_001281908.1.78407 WP_001281908.1.7861 WP_001281908.1.78618 WP_001281908.1.78673 WP_001281908.1.78802 WP_001281908.1.78830 WP_001281908.1.78835 WP_001281908.1.78871 WP_001281908.1.78874 WP_001281908.1.78918 WP_001281908.1.78930 WP_001281908.1.79151 WP_001281908.1.79167 WP_001281908.1.79335 WP_001281908.1.79462 WP_001281908.1.79490 WP_001281908.1.79495 WP_001281908.1.79529 WP_001281908.1.79570 WP_001281908.1.7964 WP_001281908.1.79659 WP_001281908.1.79668 WP_001281908.1.79708 WP_001281908.1.79845 WP_001281908.1.80077 WP_001281908.1.80137 WP_001281908.1.80182 WP_001281908.1.80296 WP_001281908.1.80366 WP_001281908.1.80780 WP_001281908.1.80831 WP_001281908.1.80850 WP_001281908.1.80881 WP_001281908.1.8096 WP_001281908.1.81037 WP_001281908.1.81069 WP_001281908.1.81149 WP_001281908.1.81175 WP_001281908.1.8119 WP_001281908.1.81193 WP_001281908.1.81410 WP_001281908.1.81425 WP_001281908.1.81750 WP_001281908.1.81785 WP_001281908.1.81902 WP_001281908.1.81974 WP_001281908.1.82337 WP_001281908.1.82479 WP_001281908.1.82503 WP_001281908.1.82515 WP_001281908.1.82676 WP_001281908.1.82761 WP_001281908.1.8282 WP_001281908.1.82944 WP_001281908.1.82956 WP_001281908.1.83092 WP_001281908.1.83163 WP_001281908.1.83305 WP_001281908.1.83365 WP_001281908.1.83413 WP_001281908.1.83491 WP_001281908.1.83523 WP_001281908.1.8354 WP_001281908.1.83651 WP_001281908.1.83721 WP_001281908.1.83760 WP_001281908.1.83995 WP_001281908.1.84103 WP_001281908.1.84283 WP_001281908.1.84392 WP_001281908.1.8441 WP_001281908.1.84532 WP_001281908.1.84659 WP_001281908.1.84693 WP_001281908.1.84899 WP_001281908.1.8497 WP_001281908.1.85040 WP_001281908.1.85178 WP_001281908.1.85180 WP_001281908.1.85190 WP_001281908.1.8533 WP_001281908.1.8545 WP_001281908.1.85481 WP_001281908.1.85483 WP_001281908.1.85541 WP_001281908.1.8556 WP_001281908.1.85615 WP_001281908.1.85617 WP_001281908.1.85663 WP_001281908.1.85671 WP_001281908.1.85777 WP_001281908.1.85855 WP_001281908.1.85886 WP_001281908.1.85900 WP_001281908.1.85904 WP_001281908.1.85976 WP_001281908.1.86306 WP_001281908.1.86356 WP_001281908.1.86450 WP_001281908.1.86469 WP_001281908.1.86580 WP_001281908.1.86588 WP_001281908.1.86661 WP_001281908.1.8672 WP_001281908.1.8678 WP_001281908.1.86810 WP_001281908.1.8684 WP_001281908.1.86895 WP_001281908.1.86906 WP_001281908.1.87095 WP_001281908.1.87323 WP_001281908.1.8736 WP_001281908.1.87460 WP_001281908.1.87552 WP_001281908.1.87779 WP_001281908.1.88019 WP_001281908.1.8809 WP_001281908.1.88291 WP_001281908.1.88293 WP_001281908.1.8837 WP_001281908.1.88393 WP_001281908.1.88703 WP_001281908.1.88792 WP_001281908.1.88902 WP_001281908.1.8891 WP_001281908.1.88981 WP_001281908.1.89116 WP_001281908.1.89138 WP_001281908.1.89512 WP_001281908.1.89527 WP_001281908.1.89570 WP_001281908.1.89604 WP_001281908.1.89622 WP_001281908.1.89659 WP_001281908.1.8996 WP_001281908.1.90097 WP_001281908.1.90252 WP_001281908.1.90417 WP_001281908.1.90453 WP_001281908.1.90458 WP_001281908.1.90557 WP_001281908.1.90585 WP_001281908.1.90641 WP_001281908.1.90734 WP_001281908.1.91003 WP_001281908.1.91069 WP_001281908.1.91278 WP_001281908.1.9131 WP_001281908.1.91512 WP_001281908.1.91524 WP_001281908.1.91564 WP_001281908.1.91628 WP_001281908.1.91655 WP_001281908.1.91724 WP_001281908.1.91732 WP_001281908.1.91788 WP_001281908.1.92013 WP_001281908.1.92060 WP_001281908.1.92093 WP_001281908.1.92108 WP_001281908.1.92171 WP_001281908.1.92183 WP_001281908.1.92208 WP_001281908.1.92268 WP_001281908.1.92310 WP_001281908.1.92318 WP_001281908.1.92443 WP_001281908.1.92482 WP_001281908.1.92531 WP_001281908.1.92669 WP_001281908.1.92671 WP_001281908.1.92738 WP_001281908.1.93086 WP_001281908.1.93101 WP_001281908.1.93136 WP_001281908.1.93155 WP_001281908.1.93275 WP_001281908.1.93365 WP_001281908.1.93376 WP_001281908.1.93543 WP_001281908.1.93650 WP_001281908.1.93656 WP_001281908.1.93662 WP_001281908.1.937 WP_001281908.1.93705 WP_001281908.1.93804 WP_001281908.1.9389 WP_001281908.1.93994 WP_001281908.1.94072 WP_001281908.1.94162 WP_001281908.1.94168 WP_001281908.1.94198 WP_001281908.1.9432 WP_001281908.1.94354 WP_001281908.1.94380 WP_001281908.1.94458 WP_001281908.1.94565 WP_001281908.1.94584 WP_001281908.1.94674 WP_001281908.1.94796 WP_001281908.1.94959 WP_001281908.1.95051 WP_001281908.1.95085 WP_001281908.1.95121 WP_001281908.1.95282 WP_001281908.1.95546 WP_001281908.1.95630 WP_001281908.1.95911 WP_001281908.1.96139 WP_001281908.1.96317 WP_001281908.1.96343 WP_001281908.1.9644 WP_001281908.1.96469 WP_001281908.1.96497 WP_001281908.1.96500 WP_001281908.1.96555 WP_001281908.1.96563 WP_001281908.1.96732 WP_001281908.1.96771 WP_001281908.1.97015 WP_001281908.1.97145 WP_001281908.1.97190 WP_001281908.1.97318 WP_001281908.1.97369 WP_001281908.1.97594 WP_001281908.1.97597 WP_001281908.1.97613 WP_001281908.1.97620 WP_001281908.1.97727 WP_001281908.1.97732 WP_001281908.1.97736 WP_001281908.1.9775 WP_001281908.1.97846 WP_001281908.1.98006 WP_001281908.1.98019 WP_001281908.1.98022 WP_001281908.1.98110 WP_001281908.1.98146 WP_001281908.1.98219 WP_001281908.1.9841 WP_001281908.1.98495 WP_001281908.1.98531 WP_001281908.1.98577 WP_001281908.1.98676 WP_001281908.1.98677 WP_001281908.1.98760 WP_001281908.1.98843 WP_001281908.1.9898 WP_001281908.1.99072 WP_001281908.1.99098 WP_001281908.1.99184 WP_001281908.1.99267 WP_001281908.1.99276 WP_001281908.1.99646 WP_001281908.1.99657 WP_001281908.1.99660 WP_001281908.1.99712 WP_001281908.1.99813 WP_001281908.1.99858 WP_001281908.1.99889 WP_001281908.1.99958 gi|378701080|ref|YP_005183037.1| gi|16766474|ref|NP_462089.1| gi|378990493|ref|YP_005253657.1| 99287.STM3174 gi|482905742|ref|YP_007904302.1| ABAM02000001|CDS_3712912-3710654 ABAO01000002|CDS_122879-125137 AE006468|CDS_3339205-3336947 CP001363|CDS_3357457-3355199 FN424405|CDS_3330447-3328189 gi|378451985|ref|YP_005239345.1| gi|550902534|ref|YP_008671626.1| gi|378446525|ref|YP_005234157.1| gi|526221534|ref|YP_008267378.1| gi|525836973|ref|YP_008253643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]