SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378451993|ref|YP_005239353.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378451993|ref|YP_005239353.1|
Domain Number 1 Region: 388-621
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.85e-78
Family Type II DNA topoisomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 5-215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.02e-70
Family DNA gyrase/MutL, N-terminal domain 0.00000000252
Further Details:      
 
Domain Number 3 Region: 217-382
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.6e-47
Family DNA gyrase/MutL, second domain 0.0000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378451993|ref|YP_005239353.1|
Sequence length 630
Comment DNA topoisomerase IV subunit B [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MTQTYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILH
ADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVN
ALSKRVEVTVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDESFFDSPRFS
VSRLMHVLKAKAVLCPGVEITFKDEVNNSEQRWCYQDGLNDYLGEAVNGLPTLPEKPFIG
NFNGETEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNI
LPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFSLWLNQ
NVQAAEQLAEMAIASAQRRLRAAKKVVRKKLTSGPALPGKLADCTAQDLNRTELFLVEGD
SAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSDDLSQL
RYGKICILADADSDGLHIATLLCALFVRHFRALVKNGHVYVALPPLYRIDLGKEVYYALT
EEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTISDEDDQRTN
AMMDMLLAKKRSEDRRNWLQEKGDLADLDV
Download sequence
Identical sequences A0A0F6B6W0 A0A0F7JCH6 A0A0G2NS58 A0A0H2WU18 A0A0H3BNP8 A0A0H3NHZ6 A0A0K6N9G4 A0A0L9EK27 A0A0M0QWD5 A0A0R9N966 A0A0T7RRL8 A0A0U1GHS5 A0A1C2ZXM7 A0A1S1ALC0 A0A1X2V066 A0A1X2Y2A2 A0A221YQ69 A0A221Z8P8 A0A249UV67 A0A265B3Q8 A0A267SB08 A0A271CZ08 A0A2C6FP28 A0A2D1XMF7 A0A2D1Y164 A0A2D3AGG3 A0A2D3TRP6 A0A2G1P5U0 A0A2H9YJ32 A0A2I6M3U2 A0A2I6MV84 A0A2I6N977 A0A2I6NM20 A0A2I6NZY6 A0A2K2ZLA6 A6GVF5 B5F674 B5REE0 C0PYV2 E8XBB0 M7RPK7 P0A2I5 P0A2I6 Q57JT1 S4I621 S5HPV4 V1WYV9 V7ILY6
gi|378451993|ref|YP_005239353.1| gi|62181695|ref|YP_218112.1| gi|528821023|ref|YP_008362226.1| gi|197364051|ref|YP_002143688.1| gi|525836967|ref|YP_008253636.1| gi|525858929|ref|YP_008262441.1| gi|549480563|ref|YP_008614829.1| gi|383497840|ref|YP_005398529.1| gi|207858440|ref|YP_002245091.1| gi|379702443|ref|YP_005244171.1| gi|194450180|ref|YP_002047178.1| gi|378701087|ref|YP_005183044.1| gi|550902541|ref|YP_008671633.1| gi|198243780|ref|YP_002217161.1| gi|525814467|ref|YP_008244485.1| gi|16766481|ref|NP_462096.1| gi|452122998|ref|YP_007473246.1| gi|378446532|ref|YP_005234164.1| gi|378961280|ref|YP_005218766.1| gi|538363782|ref|YP_008507067.1| gi|161616170|ref|YP_001590135.1| gi|224584982|ref|YP_002638781.1| gi|386592878|ref|YP_006089278.1| gi|378990500|ref|YP_005253664.1| gi|488655565|ref|YP_007927368.1| gi|537438368|ref|YP_008482745.1| gi|29143443|ref|NP_806785.1| NP_457573.1.84458 NP_462096.1.58477 WP_000195318.1.100002 WP_000195318.1.100007 WP_000195318.1.100008 WP_000195318.1.100010 WP_000195318.1.100017 WP_000195318.1.100031 WP_000195318.1.100077 WP_000195318.1.100079 WP_000195318.1.100129 WP_000195318.1.10013 WP_000195318.1.100149 WP_000195318.1.100165 WP_000195318.1.100191 WP_000195318.1.100196 WP_000195318.1.1002 WP_000195318.1.100234 WP_000195318.1.100258 WP_000195318.1.100266 WP_000195318.1.100284 WP_000195318.1.100313 WP_000195318.1.100314 WP_000195318.1.100321 WP_000195318.1.100354 WP_000195318.1.100376 WP_000195318.1.100392 WP_000195318.1.100412 WP_000195318.1.100413 WP_000195318.1.100421 WP_000195318.1.100424 WP_000195318.1.100432 WP_000195318.1.100436 WP_000195318.1.100438 WP_000195318.1.100446 WP_000195318.1.100450 WP_000195318.1.100457 WP_000195318.1.100472 WP_000195318.1.100484 WP_000195318.1.100488 WP_000195318.1.100502 WP_000195318.1.100519 WP_000195318.1.100521 WP_000195318.1.100557 WP_000195318.1.100584 WP_000195318.1.100592 WP_000195318.1.100597 WP_000195318.1.100605 WP_000195318.1.100610 WP_000195318.1.100642 WP_000195318.1.10065 WP_000195318.1.100707 WP_000195318.1.100711 WP_000195318.1.100714 WP_000195318.1.100721 WP_000195318.1.100732 WP_000195318.1.100739 WP_000195318.1.10074 WP_000195318.1.100750 WP_000195318.1.10076 WP_000195318.1.100773 WP_000195318.1.100776 WP_000195318.1.100781 WP_000195318.1.100790 WP_000195318.1.100793 WP_000195318.1.100799 WP_000195318.1.10081 WP_000195318.1.100857 WP_000195318.1.100865 WP_000195318.1.100869 WP_000195318.1.100871 WP_000195318.1.100882 WP_000195318.1.100895 WP_000195318.1.100932 WP_000195318.1.100941 WP_000195318.1.100944 WP_000195318.1.100948 WP_000195318.1.101007 WP_000195318.1.101011 WP_000195318.1.101020 WP_000195318.1.101042 WP_000195318.1.101074 WP_000195318.1.101078 WP_000195318.1.10108 WP_000195318.1.101091 WP_000195318.1.101094 WP_000195318.1.101111 WP_000195318.1.101112 WP_000195318.1.101123 WP_000195318.1.101126 WP_000195318.1.101147 WP_000195318.1.101180 WP_000195318.1.101185 WP_000195318.1.101199 WP_000195318.1.101223 WP_000195318.1.101226 WP_000195318.1.101239 WP_000195318.1.10124 WP_000195318.1.101259 WP_000195318.1.101271 WP_000195318.1.101284 WP_000195318.1.101291 WP_000195318.1.1013 WP_000195318.1.101312 WP_000195318.1.101320 WP_000195318.1.101322 WP_000195318.1.101353 WP_000195318.1.101374 WP_000195318.1.101386 WP_000195318.1.101404 WP_000195318.1.101420 WP_000195318.1.101425 WP_000195318.1.101454 WP_000195318.1.101473 WP_000195318.1.101519 WP_000195318.1.101520 WP_000195318.1.101541 WP_000195318.1.101589 WP_000195318.1.101609 WP_000195318.1.101616 WP_000195318.1.101634 WP_000195318.1.101636 WP_000195318.1.101639 WP_000195318.1.10164 WP_000195318.1.101674 WP_000195318.1.101707 WP_000195318.1.101724 WP_000195318.1.101734 WP_000195318.1.101740 WP_000195318.1.101741 WP_000195318.1.101759 WP_000195318.1.10177 WP_000195318.1.101776 WP_000195318.1.101815 WP_000195318.1.101832 WP_000195318.1.101839 WP_000195318.1.101841 WP_000195318.1.101868 WP_000195318.1.101878 WP_000195318.1.101890 WP_000195318.1.101904 WP_000195318.1.10191 WP_000195318.1.101917 WP_000195318.1.101927 WP_000195318.1.101941 WP_000195318.1.101949 WP_000195318.1.101953 WP_000195318.1.101975 WP_000195318.1.102009 WP_000195318.1.102087 WP_000195318.1.102111 WP_000195318.1.10220 WP_000195318.1.10231 WP_000195318.1.10237 WP_000195318.1.10266 WP_000195318.1.10276 WP_000195318.1.10293 WP_000195318.1.10300 WP_000195318.1.10310 WP_000195318.1.10338 WP_000195318.1.1038 WP_000195318.1.10394 WP_000195318.1.104 WP_000195318.1.10401 WP_000195318.1.10428 WP_000195318.1.10429 WP_000195318.1.10439 WP_000195318.1.10459 WP_000195318.1.10463 WP_000195318.1.10465 WP_000195318.1.10475 WP_000195318.1.10498 WP_000195318.1.10507 WP_000195318.1.10511 WP_000195318.1.10521 WP_000195318.1.10532 WP_000195318.1.10562 WP_000195318.1.10568 WP_000195318.1.106 WP_000195318.1.10631 WP_000195318.1.10642 WP_000195318.1.10654 WP_000195318.1.10675 WP_000195318.1.10677 WP_000195318.1.10678 WP_000195318.1.10711 WP_000195318.1.10753 WP_000195318.1.10755 WP_000195318.1.10797 WP_000195318.1.10868 WP_000195318.1.10873 WP_000195318.1.10898 WP_000195318.1.10926 WP_000195318.1.10936 WP_000195318.1.10992 WP_000195318.1.11000 WP_000195318.1.11012 WP_000195318.1.11024 WP_000195318.1.11031 WP_000195318.1.11055 WP_000195318.1.11098 WP_000195318.1.1110 WP_000195318.1.11119 WP_000195318.1.11142 WP_000195318.1.11156 WP_000195318.1.11168 WP_000195318.1.11190 WP_000195318.1.11213 WP_000195318.1.11216 WP_000195318.1.11239 WP_000195318.1.11253 WP_000195318.1.11254 WP_000195318.1.11295 WP_000195318.1.11304 WP_000195318.1.11314 WP_000195318.1.1135 WP_000195318.1.11362 WP_000195318.1.11369 WP_000195318.1.1137 WP_000195318.1.11385 WP_000195318.1.11405 WP_000195318.1.1142 WP_000195318.1.11426 WP_000195318.1.11429 WP_000195318.1.11455 WP_000195318.1.11458 WP_000195318.1.11479 WP_000195318.1.1150 WP_000195318.1.11511 WP_000195318.1.11518 WP_000195318.1.11526 WP_000195318.1.11528 WP_000195318.1.11532 WP_000195318.1.11543 WP_000195318.1.11544 WP_000195318.1.11557 WP_000195318.1.1156 WP_000195318.1.11565 WP_000195318.1.11567 WP_000195318.1.11588 WP_000195318.1.11603 WP_000195318.1.11621 WP_000195318.1.11638 WP_000195318.1.11677 WP_000195318.1.11687 WP_000195318.1.1169 WP_000195318.1.11735 WP_000195318.1.1174 WP_000195318.1.11763 WP_000195318.1.11772 WP_000195318.1.11810 WP_000195318.1.11824 WP_000195318.1.11834 WP_000195318.1.11841 WP_000195318.1.11865 WP_000195318.1.11868 WP_000195318.1.11875 WP_000195318.1.11897 WP_000195318.1.11900 WP_000195318.1.11914 WP_000195318.1.11936 WP_000195318.1.11964 WP_000195318.1.11978 WP_000195318.1.12007 WP_000195318.1.12017 WP_000195318.1.12025 WP_000195318.1.12027 WP_000195318.1.12040 WP_000195318.1.12047 WP_000195318.1.12059 WP_000195318.1.12061 WP_000195318.1.12063 WP_000195318.1.1207 WP_000195318.1.12106 WP_000195318.1.12114 WP_000195318.1.12141 WP_000195318.1.12144 WP_000195318.1.1215 WP_000195318.1.12159 WP_000195318.1.12160 WP_000195318.1.12168 WP_000195318.1.12172 WP_000195318.1.12192 WP_000195318.1.12210 WP_000195318.1.12280 WP_000195318.1.12282 WP_000195318.1.12308 WP_000195318.1.12340 WP_000195318.1.12351 WP_000195318.1.12364 WP_000195318.1.12370 WP_000195318.1.12374 WP_000195318.1.12396 WP_000195318.1.12397 WP_000195318.1.12398 WP_000195318.1.12456 WP_000195318.1.1246 WP_000195318.1.12472 WP_000195318.1.12484 WP_000195318.1.12485 WP_000195318.1.1250 WP_000195318.1.12546 WP_000195318.1.12568 WP_000195318.1.12569 WP_000195318.1.12581 WP_000195318.1.12585 WP_000195318.1.12620 WP_000195318.1.1264 WP_000195318.1.12650 WP_000195318.1.12683 WP_000195318.1.12696 WP_000195318.1.12701 WP_000195318.1.12718 WP_000195318.1.12726 WP_000195318.1.12727 WP_000195318.1.12728 WP_000195318.1.12741 WP_000195318.1.12834 WP_000195318.1.12864 WP_000195318.1.12865 WP_000195318.1.12877 WP_000195318.1.12879 WP_000195318.1.12936 WP_000195318.1.1299 WP_000195318.1.12995 WP_000195318.1.1300 WP_000195318.1.13027 WP_000195318.1.13076 WP_000195318.1.13101 WP_000195318.1.13102 WP_000195318.1.13106 WP_000195318.1.13108 WP_000195318.1.13130 WP_000195318.1.13161 WP_000195318.1.13207 WP_000195318.1.13247 WP_000195318.1.1326 WP_000195318.1.13262 WP_000195318.1.13274 WP_000195318.1.13291 WP_000195318.1.13311 WP_000195318.1.13314 WP_000195318.1.13334 WP_000195318.1.13338 WP_000195318.1.13342 WP_000195318.1.13352 WP_000195318.1.13367 WP_000195318.1.13391 WP_000195318.1.13406 WP_000195318.1.13414 WP_000195318.1.13429 WP_000195318.1.13440 WP_000195318.1.13443 WP_000195318.1.1346 WP_000195318.1.13476 WP_000195318.1.13488 WP_000195318.1.13509 WP_000195318.1.13528 WP_000195318.1.13543 WP_000195318.1.13573 WP_000195318.1.13599 WP_000195318.1.13602 WP_000195318.1.13625 WP_000195318.1.13661 WP_000195318.1.13669 WP_000195318.1.13677 WP_000195318.1.13686 WP_000195318.1.13691 WP_000195318.1.1372 WP_000195318.1.13741 WP_000195318.1.13750 WP_000195318.1.13764 WP_000195318.1.13799 WP_000195318.1.13819 WP_000195318.1.1382 WP_000195318.1.13827 WP_000195318.1.13829 WP_000195318.1.13848 WP_000195318.1.13857 WP_000195318.1.1387 WP_000195318.1.13908 WP_000195318.1.13932 WP_000195318.1.13967 WP_000195318.1.13968 WP_000195318.1.1397 WP_000195318.1.13972 WP_000195318.1.140 WP_000195318.1.14001 WP_000195318.1.1401 WP_000195318.1.14011 WP_000195318.1.14050 WP_000195318.1.14056 WP_000195318.1.1408 WP_000195318.1.14089 WP_000195318.1.14099 WP_000195318.1.14111 WP_000195318.1.1412 WP_000195318.1.14120 WP_000195318.1.14123 WP_000195318.1.14150 WP_000195318.1.14151 WP_000195318.1.14191 WP_000195318.1.14212 WP_000195318.1.14239 WP_000195318.1.14280 WP_000195318.1.14296 WP_000195318.1.14320 WP_000195318.1.14369 WP_000195318.1.14379 WP_000195318.1.14399 WP_000195318.1.1440 WP_000195318.1.14406 WP_000195318.1.14410 WP_000195318.1.14436 WP_000195318.1.14444 WP_000195318.1.14446 WP_000195318.1.14458 WP_000195318.1.14466 WP_000195318.1.14467 WP_000195318.1.14474 WP_000195318.1.14495 WP_000195318.1.14500 WP_000195318.1.14505 WP_000195318.1.14524 WP_000195318.1.14526 WP_000195318.1.14528 WP_000195318.1.14550 WP_000195318.1.14554 WP_000195318.1.14575 WP_000195318.1.146 WP_000195318.1.14618 WP_000195318.1.14688 WP_000195318.1.14701 WP_000195318.1.14703 WP_000195318.1.14706 WP_000195318.1.14708 WP_000195318.1.14719 WP_000195318.1.14725 WP_000195318.1.1473 WP_000195318.1.14737 WP_000195318.1.14789 WP_000195318.1.14793 WP_000195318.1.14808 WP_000195318.1.14810 WP_000195318.1.14819 WP_000195318.1.14852 WP_000195318.1.14876 WP_000195318.1.14877 WP_000195318.1.14884 WP_000195318.1.1489 WP_000195318.1.14894 WP_000195318.1.14913 WP_000195318.1.14917 WP_000195318.1.14927 WP_000195318.1.14930 WP_000195318.1.14932 WP_000195318.1.14948 WP_000195318.1.14964 WP_000195318.1.15011 WP_000195318.1.15046 WP_000195318.1.15054 WP_000195318.1.15055 WP_000195318.1.15059 WP_000195318.1.15067 WP_000195318.1.15100 WP_000195318.1.15102 WP_000195318.1.15124 WP_000195318.1.15184 WP_000195318.1.15214 WP_000195318.1.15223 WP_000195318.1.15226 WP_000195318.1.15244 WP_000195318.1.15265 WP_000195318.1.15276 WP_000195318.1.15316 WP_000195318.1.15318 WP_000195318.1.15353 WP_000195318.1.15362 WP_000195318.1.15369 WP_000195318.1.1540 WP_000195318.1.15415 WP_000195318.1.15423 WP_000195318.1.15433 WP_000195318.1.15439 WP_000195318.1.15468 WP_000195318.1.15479 WP_000195318.1.15483 WP_000195318.1.15487 WP_000195318.1.15508 WP_000195318.1.1551 WP_000195318.1.15535 WP_000195318.1.15585 WP_000195318.1.15586 WP_000195318.1.15597 WP_000195318.1.15612 WP_000195318.1.15616 WP_000195318.1.15625 WP_000195318.1.15627 WP_000195318.1.15637 WP_000195318.1.15644 WP_000195318.1.1568 WP_000195318.1.15708 WP_000195318.1.15710 WP_000195318.1.15717 WP_000195318.1.15775 WP_000195318.1.15777 WP_000195318.1.15784 WP_000195318.1.15795 WP_000195318.1.158 WP_000195318.1.15830 WP_000195318.1.15835 WP_000195318.1.15862 WP_000195318.1.15881 WP_000195318.1.15905 WP_000195318.1.15910 WP_000195318.1.1592 WP_000195318.1.15922 WP_000195318.1.15938 WP_000195318.1.15970 WP_000195318.1.15978 WP_000195318.1.15986 WP_000195318.1.15995 WP_000195318.1.16000 WP_000195318.1.16004 WP_000195318.1.16006 WP_000195318.1.1601 WP_000195318.1.16028 WP_000195318.1.16032 WP_000195318.1.16046 WP_000195318.1.16047 WP_000195318.1.16051 WP_000195318.1.16052 WP_000195318.1.16058 WP_000195318.1.16062 WP_000195318.1.16063 WP_000195318.1.16103 WP_000195318.1.1611 WP_000195318.1.16155 WP_000195318.1.16158 WP_000195318.1.16166 WP_000195318.1.16172 WP_000195318.1.16233 WP_000195318.1.1626 WP_000195318.1.16264 WP_000195318.1.16273 WP_000195318.1.16284 WP_000195318.1.16331 WP_000195318.1.16344 WP_000195318.1.1635 WP_000195318.1.16361 WP_000195318.1.16363 WP_000195318.1.16365 WP_000195318.1.16366 WP_000195318.1.16394 WP_000195318.1.16452 WP_000195318.1.16453 WP_000195318.1.16461 WP_000195318.1.16462 WP_000195318.1.16465 WP_000195318.1.16474 WP_000195318.1.16508 WP_000195318.1.16522 WP_000195318.1.16525 WP_000195318.1.16551 WP_000195318.1.16565 WP_000195318.1.16581 WP_000195318.1.16588 WP_000195318.1.16614 WP_000195318.1.16650 WP_000195318.1.16656 WP_000195318.1.16658 WP_000195318.1.16666 WP_000195318.1.1668 WP_000195318.1.16686 WP_000195318.1.16691 WP_000195318.1.167 WP_000195318.1.16710 WP_000195318.1.16729 WP_000195318.1.16732 WP_000195318.1.16735 WP_000195318.1.1674 WP_000195318.1.16767 WP_000195318.1.16786 WP_000195318.1.16804 WP_000195318.1.16817 WP_000195318.1.16826 WP_000195318.1.16846 WP_000195318.1.16855 WP_000195318.1.16858 WP_000195318.1.16873 WP_000195318.1.16879 WP_000195318.1.1689 WP_000195318.1.16893 WP_000195318.1.16896 WP_000195318.1.16903 WP_000195318.1.16905 WP_000195318.1.16910 WP_000195318.1.16916 WP_000195318.1.16941 WP_000195318.1.16942 WP_000195318.1.16948 WP_000195318.1.16949 WP_000195318.1.16965 WP_000195318.1.16972 WP_000195318.1.16998 WP_000195318.1.1700 WP_000195318.1.17031 WP_000195318.1.17049 WP_000195318.1.17058 WP_000195318.1.17060 WP_000195318.1.17078 WP_000195318.1.17093 WP_000195318.1.17096 WP_000195318.1.17098 WP_000195318.1.17105 WP_000195318.1.17188 WP_000195318.1.17202 WP_000195318.1.1722 WP_000195318.1.17285 WP_000195318.1.17302 WP_000195318.1.17307 WP_000195318.1.17308 WP_000195318.1.1733 WP_000195318.1.17368 WP_000195318.1.1737 WP_000195318.1.174 WP_000195318.1.17405 WP_000195318.1.17406 WP_000195318.1.17439 WP_000195318.1.17447 WP_000195318.1.17480 WP_000195318.1.17482 WP_000195318.1.1749 WP_000195318.1.17504 WP_000195318.1.17513 WP_000195318.1.17525 WP_000195318.1.17546 WP_000195318.1.17560 WP_000195318.1.17563 WP_000195318.1.1757 WP_000195318.1.17583 WP_000195318.1.17622 WP_000195318.1.17629 WP_000195318.1.17659 WP_000195318.1.17686 WP_000195318.1.17693 WP_000195318.1.17702 WP_000195318.1.17703 WP_000195318.1.17705 WP_000195318.1.17732 WP_000195318.1.17741 WP_000195318.1.17743 WP_000195318.1.17747 WP_000195318.1.17755 WP_000195318.1.17758 WP_000195318.1.17865 WP_000195318.1.17886 WP_000195318.1.17891 WP_000195318.1.17901 WP_000195318.1.17914 WP_000195318.1.17919 WP_000195318.1.17936 WP_000195318.1.17949 WP_000195318.1.17956 WP_000195318.1.1798 WP_000195318.1.17991 WP_000195318.1.18005 WP_000195318.1.1801 WP_000195318.1.18019 WP_000195318.1.18021 WP_000195318.1.18022 WP_000195318.1.18056 WP_000195318.1.18061 WP_000195318.1.1807 WP_000195318.1.18089 WP_000195318.1.18092 WP_000195318.1.18099 WP_000195318.1.18103 WP_000195318.1.18109 WP_000195318.1.18111 WP_000195318.1.18122 WP_000195318.1.18124 WP_000195318.1.1814 WP_000195318.1.18149 WP_000195318.1.18163 WP_000195318.1.18173 WP_000195318.1.18178 WP_000195318.1.1818 WP_000195318.1.18192 WP_000195318.1.18249 WP_000195318.1.1825 WP_000195318.1.18254 WP_000195318.1.18265 WP_000195318.1.18267 WP_000195318.1.18270 WP_000195318.1.18277 WP_000195318.1.18280 WP_000195318.1.18281 WP_000195318.1.18282 WP_000195318.1.18328 WP_000195318.1.18355 WP_000195318.1.18365 WP_000195318.1.18370 WP_000195318.1.18384 WP_000195318.1.18406 WP_000195318.1.18426 WP_000195318.1.18441 WP_000195318.1.18445 WP_000195318.1.18468 WP_000195318.1.18474 WP_000195318.1.18485 WP_000195318.1.18489 WP_000195318.1.18513 WP_000195318.1.18607 WP_000195318.1.18610 WP_000195318.1.18641 WP_000195318.1.18678 WP_000195318.1.18686 WP_000195318.1.18692 WP_000195318.1.18705 WP_000195318.1.18715 WP_000195318.1.18737 WP_000195318.1.18766 WP_000195318.1.18776 WP_000195318.1.1880 WP_000195318.1.18822 WP_000195318.1.18847 WP_000195318.1.1885 WP_000195318.1.18860 WP_000195318.1.18881 WP_000195318.1.18886 WP_000195318.1.18895 WP_000195318.1.18919 WP_000195318.1.18922 WP_000195318.1.18940 WP_000195318.1.18949 WP_000195318.1.1895 WP_000195318.1.18959 WP_000195318.1.1897 WP_000195318.1.18972 WP_000195318.1.19001 WP_000195318.1.19006 WP_000195318.1.19030 WP_000195318.1.19044 WP_000195318.1.19053 WP_000195318.1.19055 WP_000195318.1.19084 WP_000195318.1.19093 WP_000195318.1.19163 WP_000195318.1.19174 WP_000195318.1.19187 WP_000195318.1.19228 WP_000195318.1.19240 WP_000195318.1.19273 WP_000195318.1.19291 WP_000195318.1.19300 WP_000195318.1.19320 WP_000195318.1.19340 WP_000195318.1.19357 WP_000195318.1.19373 WP_000195318.1.19405 WP_000195318.1.19422 WP_000195318.1.19433 WP_000195318.1.19458 WP_000195318.1.19460 WP_000195318.1.19461 WP_000195318.1.19469 WP_000195318.1.19496 WP_000195318.1.19535 WP_000195318.1.19538 WP_000195318.1.1954 WP_000195318.1.1955 WP_000195318.1.19588 WP_000195318.1.19589 WP_000195318.1.19614 WP_000195318.1.19616 WP_000195318.1.19642 WP_000195318.1.19656 WP_000195318.1.19660 WP_000195318.1.19663 WP_000195318.1.1968 WP_000195318.1.19686 WP_000195318.1.19702 WP_000195318.1.19706 WP_000195318.1.19723 WP_000195318.1.19724 WP_000195318.1.19731 WP_000195318.1.19740 WP_000195318.1.19749 WP_000195318.1.19784 WP_000195318.1.19793 WP_000195318.1.19794 WP_000195318.1.19802 WP_000195318.1.19809 WP_000195318.1.19823 WP_000195318.1.19834 WP_000195318.1.19863 WP_000195318.1.19867 WP_000195318.1.19882 WP_000195318.1.19884 WP_000195318.1.1990 WP_000195318.1.1992 WP_000195318.1.19938 WP_000195318.1.19975 WP_000195318.1.1998 WP_000195318.1.19987 WP_000195318.1.19999 WP_000195318.1.20 WP_000195318.1.20023 WP_000195318.1.20081 WP_000195318.1.20086 WP_000195318.1.20089 WP_000195318.1.20091 WP_000195318.1.2010 WP_000195318.1.20119 WP_000195318.1.20212 WP_000195318.1.20218 WP_000195318.1.20254 WP_000195318.1.2026 WP_000195318.1.20261 WP_000195318.1.20266 WP_000195318.1.20271 WP_000195318.1.20296 WP_000195318.1.20330 WP_000195318.1.20349 WP_000195318.1.2036 WP_000195318.1.20362 WP_000195318.1.20364 WP_000195318.1.20376 WP_000195318.1.20391 WP_000195318.1.2041 WP_000195318.1.20415 WP_000195318.1.20418 WP_000195318.1.20419 WP_000195318.1.20425 WP_000195318.1.20437 WP_000195318.1.20443 WP_000195318.1.20446 WP_000195318.1.20465 WP_000195318.1.2047 WP_000195318.1.20488 WP_000195318.1.20492 WP_000195318.1.20503 WP_000195318.1.20525 WP_000195318.1.2053 WP_000195318.1.2054 WP_000195318.1.20553 WP_000195318.1.20564 WP_000195318.1.20573 WP_000195318.1.20614 WP_000195318.1.20626 WP_000195318.1.20631 WP_000195318.1.20635 WP_000195318.1.20646 WP_000195318.1.20695 WP_000195318.1.20700 WP_000195318.1.20718 WP_000195318.1.2073 WP_000195318.1.20740 WP_000195318.1.20760 WP_000195318.1.20767 WP_000195318.1.20787 WP_000195318.1.20789 WP_000195318.1.20795 WP_000195318.1.20810 WP_000195318.1.20828 WP_000195318.1.20839 WP_000195318.1.20862 WP_000195318.1.2087 WP_000195318.1.20883 WP_000195318.1.20886 WP_000195318.1.20900 WP_000195318.1.20908 WP_000195318.1.20947 WP_000195318.1.20953 WP_000195318.1.2101 WP_000195318.1.21010 WP_000195318.1.21049 WP_000195318.1.2106 WP_000195318.1.21062 WP_000195318.1.2107 WP_000195318.1.21075 WP_000195318.1.21079 WP_000195318.1.21086 WP_000195318.1.21089 WP_000195318.1.21103 WP_000195318.1.21136 WP_000195318.1.21144 WP_000195318.1.21146 WP_000195318.1.2116 WP_000195318.1.21162 WP_000195318.1.21165 WP_000195318.1.21184 WP_000195318.1.21185 WP_000195318.1.21194 WP_000195318.1.21202 WP_000195318.1.21241 WP_000195318.1.21245 WP_000195318.1.21246 WP_000195318.1.21260 WP_000195318.1.21269 WP_000195318.1.21286 WP_000195318.1.2130 WP_000195318.1.21309 WP_000195318.1.21326 WP_000195318.1.21332 WP_000195318.1.21351 WP_000195318.1.21362 WP_000195318.1.21366 WP_000195318.1.2139 WP_000195318.1.21399 WP_000195318.1.21400 WP_000195318.1.21404 WP_000195318.1.21423 WP_000195318.1.21443 WP_000195318.1.2146 WP_000195318.1.21473 WP_000195318.1.21497 WP_000195318.1.21499 WP_000195318.1.21534 WP_000195318.1.21548 WP_000195318.1.21603 WP_000195318.1.21616 WP_000195318.1.2166 WP_000195318.1.21674 WP_000195318.1.21681 WP_000195318.1.21692 WP_000195318.1.21715 WP_000195318.1.21728 WP_000195318.1.21730 WP_000195318.1.21750 WP_000195318.1.21751 WP_000195318.1.21757 WP_000195318.1.21792 WP_000195318.1.21825 WP_000195318.1.21845 WP_000195318.1.21877 WP_000195318.1.21886 WP_000195318.1.21909 WP_000195318.1.21910 WP_000195318.1.21940 WP_000195318.1.21946 WP_000195318.1.21950 WP_000195318.1.21966 WP_000195318.1.21981 WP_000195318.1.21991 WP_000195318.1.22019 WP_000195318.1.22024 WP_000195318.1.22030 WP_000195318.1.2205 WP_000195318.1.22051 WP_000195318.1.22062 WP_000195318.1.22064 WP_000195318.1.22067 WP_000195318.1.22069 WP_000195318.1.22096 WP_000195318.1.22117 WP_000195318.1.22118 WP_000195318.1.22126 WP_000195318.1.22136 WP_000195318.1.22158 WP_000195318.1.22162 WP_000195318.1.22169 WP_000195318.1.22205 WP_000195318.1.22208 WP_000195318.1.2221 WP_000195318.1.22235 WP_000195318.1.22240 WP_000195318.1.2227 WP_000195318.1.22270 WP_000195318.1.22296 WP_000195318.1.22315 WP_000195318.1.22323 WP_000195318.1.22337 WP_000195318.1.22346 WP_000195318.1.2235 WP_000195318.1.22379 WP_000195318.1.22388 WP_000195318.1.22427 WP_000195318.1.22449 WP_000195318.1.22451 WP_000195318.1.22453 WP_000195318.1.22454 WP_000195318.1.2246 WP_000195318.1.22460 WP_000195318.1.22476 WP_000195318.1.22485 WP_000195318.1.22514 WP_000195318.1.22537 WP_000195318.1.22565 WP_000195318.1.22566 WP_000195318.1.22575 WP_000195318.1.22582 WP_000195318.1.22590 WP_000195318.1.22595 WP_000195318.1.22604 WP_000195318.1.22605 WP_000195318.1.22614 WP_000195318.1.22620 WP_000195318.1.22623 WP_000195318.1.22652 WP_000195318.1.22676 WP_000195318.1.22683 WP_000195318.1.22692 WP_000195318.1.22758 WP_000195318.1.22760 WP_000195318.1.2283 WP_000195318.1.2284 WP_000195318.1.22845 WP_000195318.1.22857 WP_000195318.1.22864 WP_000195318.1.22870 WP_000195318.1.22880 WP_000195318.1.22902 WP_000195318.1.22926 WP_000195318.1.22943 WP_000195318.1.22947 WP_000195318.1.22966 WP_000195318.1.22967 WP_000195318.1.22979 WP_000195318.1.23010 WP_000195318.1.23040 WP_000195318.1.23053 WP_000195318.1.23080 WP_000195318.1.23102 WP_000195318.1.23114 WP_000195318.1.2314 WP_000195318.1.23148 WP_000195318.1.23155 WP_000195318.1.23169 WP_000195318.1.23172 WP_000195318.1.23175 WP_000195318.1.23192 WP_000195318.1.23201 WP_000195318.1.23218 WP_000195318.1.2324 WP_000195318.1.23246 WP_000195318.1.23258 WP_000195318.1.23259 WP_000195318.1.23279 WP_000195318.1.23309 WP_000195318.1.2331 WP_000195318.1.23311 WP_000195318.1.2332 WP_000195318.1.23329 WP_000195318.1.23340 WP_000195318.1.23343 WP_000195318.1.2336 WP_000195318.1.23379 WP_000195318.1.23412 WP_000195318.1.2342 WP_000195318.1.23442 WP_000195318.1.23444 WP_000195318.1.23460 WP_000195318.1.23472 WP_000195318.1.23482 WP_000195318.1.23485 WP_000195318.1.23492 WP_000195318.1.235 WP_000195318.1.23500 WP_000195318.1.23503 WP_000195318.1.23509 WP_000195318.1.23513 WP_000195318.1.23515 WP_000195318.1.23529 WP_000195318.1.23548 WP_000195318.1.23571 WP_000195318.1.2358 WP_000195318.1.23587 WP_000195318.1.23604 WP_000195318.1.23621 WP_000195318.1.23629 WP_000195318.1.23631 WP_000195318.1.23634 WP_000195318.1.23639 WP_000195318.1.2364 WP_000195318.1.23646 WP_000195318.1.23670 WP_000195318.1.23675 WP_000195318.1.23679 WP_000195318.1.237 WP_000195318.1.23720 WP_000195318.1.23728 WP_000195318.1.23736 WP_000195318.1.2375 WP_000195318.1.23755 WP_000195318.1.2376 WP_000195318.1.23783 WP_000195318.1.23787 WP_000195318.1.2380 WP_000195318.1.23801 WP_000195318.1.23819 WP_000195318.1.23932 WP_000195318.1.23959 WP_000195318.1.24017 WP_000195318.1.24028 WP_000195318.1.24061 WP_000195318.1.24082 WP_000195318.1.24117 WP_000195318.1.24138 WP_000195318.1.24145 WP_000195318.1.24158 WP_000195318.1.24206 WP_000195318.1.24214 WP_000195318.1.24250 WP_000195318.1.24259 WP_000195318.1.24291 WP_000195318.1.24297 WP_000195318.1.24303 WP_000195318.1.24308 WP_000195318.1.24322 WP_000195318.1.24361 WP_000195318.1.24376 WP_000195318.1.24392 WP_000195318.1.24394 WP_000195318.1.24400 WP_000195318.1.24408 WP_000195318.1.24409 WP_000195318.1.24412 WP_000195318.1.24419 WP_000195318.1.24420 WP_000195318.1.24444 WP_000195318.1.24450 WP_000195318.1.24476 WP_000195318.1.24494 WP_000195318.1.24521 WP_000195318.1.24555 WP_000195318.1.24578 WP_000195318.1.24619 WP_000195318.1.2467 WP_000195318.1.24673 WP_000195318.1.24686 WP_000195318.1.24688 WP_000195318.1.24689 WP_000195318.1.24696 WP_000195318.1.24716 WP_000195318.1.24723 WP_000195318.1.24737 WP_000195318.1.24779 WP_000195318.1.24803 WP_000195318.1.2481 WP_000195318.1.24832 WP_000195318.1.24839 WP_000195318.1.24873 WP_000195318.1.24901 WP_000195318.1.24944 WP_000195318.1.24964 WP_000195318.1.24995 WP_000195318.1.25008 WP_000195318.1.25015 WP_000195318.1.25017 WP_000195318.1.25032 WP_000195318.1.25036 WP_000195318.1.25041 WP_000195318.1.25053 WP_000195318.1.25064 WP_000195318.1.25072 WP_000195318.1.25119 WP_000195318.1.25130 WP_000195318.1.25140 WP_000195318.1.25159 WP_000195318.1.25175 WP_000195318.1.25185 WP_000195318.1.25196 WP_000195318.1.25205 WP_000195318.1.25206 WP_000195318.1.25210 WP_000195318.1.25217 WP_000195318.1.25219 WP_000195318.1.25229 WP_000195318.1.2525 WP_000195318.1.25297 WP_000195318.1.25304 WP_000195318.1.25354 WP_000195318.1.25374 WP_000195318.1.25397 WP_000195318.1.25405 WP_000195318.1.25421 WP_000195318.1.25426 WP_000195318.1.25454 WP_000195318.1.25475 WP_000195318.1.25490 WP_000195318.1.25493 WP_000195318.1.25498 WP_000195318.1.25514 WP_000195318.1.2554 WP_000195318.1.25546 WP_000195318.1.25564 WP_000195318.1.25603 WP_000195318.1.25618 WP_000195318.1.25668 WP_000195318.1.2568 WP_000195318.1.25690 WP_000195318.1.2570 WP_000195318.1.25700 WP_000195318.1.25703 WP_000195318.1.25708 WP_000195318.1.25709 WP_000195318.1.25740 WP_000195318.1.25780 WP_000195318.1.25793 WP_000195318.1.25809 WP_000195318.1.25814 WP_000195318.1.25821 WP_000195318.1.25825 WP_000195318.1.25833 WP_000195318.1.25835 WP_000195318.1.25846 WP_000195318.1.25882 WP_000195318.1.25911 WP_000195318.1.25928 WP_000195318.1.25932 WP_000195318.1.25951 WP_000195318.1.25963 WP_000195318.1.25988 WP_000195318.1.26001 WP_000195318.1.26075 WP_000195318.1.26083 WP_000195318.1.26093 WP_000195318.1.26107 WP_000195318.1.26122 WP_000195318.1.26129 WP_000195318.1.26194 WP_000195318.1.26199 WP_000195318.1.26213 WP_000195318.1.26217 WP_000195318.1.26224 WP_000195318.1.26232 WP_000195318.1.26269 WP_000195318.1.26272 WP_000195318.1.26282 WP_000195318.1.26286 WP_000195318.1.26288 WP_000195318.1.26311 WP_000195318.1.26319 WP_000195318.1.26363 WP_000195318.1.26384 WP_000195318.1.26394 WP_000195318.1.26426 WP_000195318.1.26429 WP_000195318.1.26440 WP_000195318.1.26441 WP_000195318.1.26491 WP_000195318.1.26493 WP_000195318.1.26512 WP_000195318.1.26532 WP_000195318.1.2654 WP_000195318.1.26551 WP_000195318.1.26554 WP_000195318.1.26563 WP_000195318.1.26567 WP_000195318.1.26576 WP_000195318.1.26582 WP_000195318.1.26587 WP_000195318.1.26636 WP_000195318.1.26646 WP_000195318.1.2667 WP_000195318.1.26687 WP_000195318.1.26689 WP_000195318.1.26709 WP_000195318.1.2672 WP_000195318.1.26741 WP_000195318.1.26750 WP_000195318.1.26758 WP_000195318.1.26787 WP_000195318.1.26794 WP_000195318.1.26833 WP_000195318.1.26856 WP_000195318.1.26882 WP_000195318.1.26883 WP_000195318.1.26892 WP_000195318.1.26908 WP_000195318.1.26919 WP_000195318.1.2692 WP_000195318.1.26924 WP_000195318.1.26936 WP_000195318.1.26980 WP_000195318.1.270 WP_000195318.1.27008 WP_000195318.1.27010 WP_000195318.1.27027 WP_000195318.1.27051 WP_000195318.1.27055 WP_000195318.1.27070 WP_000195318.1.27072 WP_000195318.1.27084 WP_000195318.1.27111 WP_000195318.1.2713 WP_000195318.1.2717 WP_000195318.1.27173 WP_000195318.1.272 WP_000195318.1.27206 WP_000195318.1.27223 WP_000195318.1.2723 WP_000195318.1.27255 WP_000195318.1.27272 WP_000195318.1.27282 WP_000195318.1.27285 WP_000195318.1.27309 WP_000195318.1.27314 WP_000195318.1.27342 WP_000195318.1.27383 WP_000195318.1.27419 WP_000195318.1.27423 WP_000195318.1.27452 WP_000195318.1.27513 WP_000195318.1.27522 WP_000195318.1.27523 WP_000195318.1.27535 WP_000195318.1.27544 WP_000195318.1.27547 WP_000195318.1.27565 WP_000195318.1.27595 WP_000195318.1.27598 WP_000195318.1.27616 WP_000195318.1.2763 WP_000195318.1.27632 WP_000195318.1.27638 WP_000195318.1.27655 WP_000195318.1.27658 WP_000195318.1.27665 WP_000195318.1.27679 WP_000195318.1.27706 WP_000195318.1.27707 WP_000195318.1.27713 WP_000195318.1.27755 WP_000195318.1.27761 WP_000195318.1.2777 WP_000195318.1.27775 WP_000195318.1.27776 WP_000195318.1.27798 WP_000195318.1.27800 WP_000195318.1.27815 WP_000195318.1.27833 WP_000195318.1.27857 WP_000195318.1.27883 WP_000195318.1.27892 WP_000195318.1.27900 WP_000195318.1.27945 WP_000195318.1.27969 WP_000195318.1.27977 WP_000195318.1.27995 WP_000195318.1.27997 WP_000195318.1.28002 WP_000195318.1.28004 WP_000195318.1.28032 WP_000195318.1.28037 WP_000195318.1.28056 WP_000195318.1.2806 WP_000195318.1.28073 WP_000195318.1.2809 WP_000195318.1.28094 WP_000195318.1.28116 WP_000195318.1.28126 WP_000195318.1.28139 WP_000195318.1.28170 WP_000195318.1.28174 WP_000195318.1.28200 WP_000195318.1.2822 WP_000195318.1.28225 WP_000195318.1.28229 WP_000195318.1.28232 WP_000195318.1.28233 WP_000195318.1.2825 WP_000195318.1.28267 WP_000195318.1.2829 WP_000195318.1.28301 WP_000195318.1.28302 WP_000195318.1.28303 WP_000195318.1.2835 WP_000195318.1.28370 WP_000195318.1.28384 WP_000195318.1.28386 WP_000195318.1.28393 WP_000195318.1.28395 WP_000195318.1.284 WP_000195318.1.2845 WP_000195318.1.28462 WP_000195318.1.28479 WP_000195318.1.28504 WP_000195318.1.28514 WP_000195318.1.2853 WP_000195318.1.28538 WP_000195318.1.28570 WP_000195318.1.28575 WP_000195318.1.28612 WP_000195318.1.28620 WP_000195318.1.28625 WP_000195318.1.28655 WP_000195318.1.28673 WP_000195318.1.28694 WP_000195318.1.287 WP_000195318.1.2873 WP_000195318.1.28733 WP_000195318.1.28773 WP_000195318.1.28775 WP_000195318.1.28776 WP_000195318.1.2879 WP_000195318.1.28811 WP_000195318.1.28830 WP_000195318.1.2890 WP_000195318.1.28902 WP_000195318.1.28917 WP_000195318.1.28921 WP_000195318.1.28938 WP_000195318.1.28946 WP_000195318.1.28948 WP_000195318.1.28962 WP_000195318.1.28963 WP_000195318.1.28977 WP_000195318.1.29006 WP_000195318.1.29010 WP_000195318.1.29023 WP_000195318.1.29042 WP_000195318.1.2905 WP_000195318.1.2907 WP_000195318.1.29081 WP_000195318.1.29099 WP_000195318.1.2910 WP_000195318.1.29113 WP_000195318.1.29130 WP_000195318.1.29168 WP_000195318.1.29174 WP_000195318.1.29190 WP_000195318.1.29203 WP_000195318.1.29218 WP_000195318.1.29237 WP_000195318.1.2924 WP_000195318.1.29248 WP_000195318.1.29255 WP_000195318.1.29265 WP_000195318.1.29274 WP_000195318.1.2932 WP_000195318.1.29349 WP_000195318.1.29379 WP_000195318.1.29422 WP_000195318.1.29436 WP_000195318.1.29439 WP_000195318.1.2946 WP_000195318.1.29462 WP_000195318.1.29509 WP_000195318.1.29530 WP_000195318.1.29563 WP_000195318.1.29576 WP_000195318.1.29588 WP_000195318.1.29601 WP_000195318.1.29606 WP_000195318.1.29615 WP_000195318.1.29619 WP_000195318.1.29682 WP_000195318.1.29704 WP_000195318.1.29711 WP_000195318.1.29727 WP_000195318.1.29732 WP_000195318.1.29743 WP_000195318.1.29774 WP_000195318.1.29782 WP_000195318.1.29827 WP_000195318.1.29833 WP_000195318.1.2984 WP_000195318.1.29845 WP_000195318.1.29851 WP_000195318.1.29865 WP_000195318.1.29886 WP_000195318.1.29919 WP_000195318.1.29923 WP_000195318.1.29924 WP_000195318.1.2994 WP_000195318.1.29964 WP_000195318.1.29969 WP_000195318.1.29983 WP_000195318.1.29990 WP_000195318.1.30006 WP_000195318.1.30009 WP_000195318.1.30013 WP_000195318.1.30018 WP_000195318.1.30022 WP_000195318.1.30027 WP_000195318.1.30034 WP_000195318.1.30049 WP_000195318.1.3005 WP_000195318.1.30059 WP_000195318.1.30086 WP_000195318.1.30165 WP_000195318.1.3017 WP_000195318.1.30170 WP_000195318.1.30172 WP_000195318.1.30179 WP_000195318.1.30180 WP_000195318.1.30185 WP_000195318.1.30195 WP_000195318.1.30202 WP_000195318.1.30210 WP_000195318.1.30213 WP_000195318.1.30225 WP_000195318.1.30238 WP_000195318.1.30246 WP_000195318.1.30278 WP_000195318.1.30331 WP_000195318.1.30354 WP_000195318.1.30356 WP_000195318.1.30357 WP_000195318.1.30362 WP_000195318.1.30386 WP_000195318.1.3042 WP_000195318.1.30425 WP_000195318.1.30437 WP_000195318.1.30448 WP_000195318.1.30469 WP_000195318.1.30489 WP_000195318.1.30492 WP_000195318.1.30505 WP_000195318.1.30507 WP_000195318.1.30517 WP_000195318.1.30535 WP_000195318.1.30542 WP_000195318.1.30547 WP_000195318.1.30548 WP_000195318.1.30555 WP_000195318.1.30556 WP_000195318.1.30572 WP_000195318.1.30585 WP_000195318.1.30589 WP_000195318.1.30602 WP_000195318.1.30618 WP_000195318.1.30619 WP_000195318.1.30627 WP_000195318.1.30635 WP_000195318.1.3066 WP_000195318.1.30664 WP_000195318.1.3067 WP_000195318.1.3068 WP_000195318.1.30696 WP_000195318.1.30752 WP_000195318.1.3076 WP_000195318.1.30794 WP_000195318.1.3080 WP_000195318.1.30803 WP_000195318.1.30806 WP_000195318.1.30819 WP_000195318.1.30823 WP_000195318.1.30833 WP_000195318.1.30835 WP_000195318.1.3089 WP_000195318.1.30909 WP_000195318.1.30934 WP_000195318.1.3095 WP_000195318.1.30968 WP_000195318.1.30972 WP_000195318.1.31 WP_000195318.1.31001 WP_000195318.1.31011 WP_000195318.1.31042 WP_000195318.1.31046 WP_000195318.1.31066 WP_000195318.1.31069 WP_000195318.1.31078 WP_000195318.1.31086 WP_000195318.1.31092 WP_000195318.1.31111 WP_000195318.1.31122 WP_000195318.1.3113 WP_000195318.1.31139 WP_000195318.1.3114 WP_000195318.1.31145 WP_000195318.1.31155 WP_000195318.1.31167 WP_000195318.1.31171 WP_000195318.1.31182 WP_000195318.1.31185 WP_000195318.1.31190 WP_000195318.1.31195 WP_000195318.1.31196 WP_000195318.1.31198 WP_000195318.1.3121 WP_000195318.1.31210 WP_000195318.1.31214 WP_000195318.1.31219 WP_000195318.1.3124 WP_000195318.1.31251 WP_000195318.1.31262 WP_000195318.1.3127 WP_000195318.1.31272 WP_000195318.1.31281 WP_000195318.1.31303 WP_000195318.1.31335 WP_000195318.1.31352 WP_000195318.1.31362 WP_000195318.1.31413 WP_000195318.1.31435 WP_000195318.1.31446 WP_000195318.1.31451 WP_000195318.1.31476 WP_000195318.1.31504 WP_000195318.1.31515 WP_000195318.1.31533 WP_000195318.1.31546 WP_000195318.1.31578 WP_000195318.1.31585 WP_000195318.1.31658 WP_000195318.1.31665 WP_000195318.1.3167 WP_000195318.1.3170 WP_000195318.1.31725 WP_000195318.1.31782 WP_000195318.1.31799 WP_000195318.1.31845 WP_000195318.1.3185 WP_000195318.1.31854 WP_000195318.1.31895 WP_000195318.1.31901 WP_000195318.1.31927 WP_000195318.1.31940 WP_000195318.1.31951 WP_000195318.1.31952 WP_000195318.1.31967 WP_000195318.1.31983 WP_000195318.1.32006 WP_000195318.1.32041 WP_000195318.1.32042 WP_000195318.1.32056 WP_000195318.1.32109 WP_000195318.1.32116 WP_000195318.1.32170 WP_000195318.1.32189 WP_000195318.1.32192 WP_000195318.1.32202 WP_000195318.1.32204 WP_000195318.1.32206 WP_000195318.1.32252 WP_000195318.1.32255 WP_000195318.1.32260 WP_000195318.1.32263 WP_000195318.1.32274 WP_000195318.1.32277 WP_000195318.1.32293 WP_000195318.1.32299 WP_000195318.1.32309 WP_000195318.1.32357 WP_000195318.1.32368 WP_000195318.1.32408 WP_000195318.1.32423 WP_000195318.1.32424 WP_000195318.1.32425 WP_000195318.1.32434 WP_000195318.1.32438 WP_000195318.1.32458 WP_000195318.1.32460 WP_000195318.1.32491 WP_000195318.1.32493 WP_000195318.1.32515 WP_000195318.1.32519 WP_000195318.1.32527 WP_000195318.1.32529 WP_000195318.1.32545 WP_000195318.1.32563 WP_000195318.1.32624 WP_000195318.1.32629 WP_000195318.1.32643 WP_000195318.1.32660 WP_000195318.1.32668 WP_000195318.1.32702 WP_000195318.1.32714 WP_000195318.1.32725 WP_000195318.1.32740 WP_000195318.1.32750 WP_000195318.1.3278 WP_000195318.1.32786 WP_000195318.1.32804 WP_000195318.1.32832 WP_000195318.1.32838 WP_000195318.1.32848 WP_000195318.1.32860 WP_000195318.1.32868 WP_000195318.1.32881 WP_000195318.1.32899 WP_000195318.1.329 WP_000195318.1.3290 WP_000195318.1.32900 WP_000195318.1.32902 WP_000195318.1.32907 WP_000195318.1.32930 WP_000195318.1.32940 WP_000195318.1.32941 WP_000195318.1.3296 WP_000195318.1.32961 WP_000195318.1.32966 WP_000195318.1.32977 WP_000195318.1.32985 WP_000195318.1.33030 WP_000195318.1.33037 WP_000195318.1.3304 WP_000195318.1.3305 WP_000195318.1.33051 WP_000195318.1.33065 WP_000195318.1.3310 WP_000195318.1.33106 WP_000195318.1.33122 WP_000195318.1.33127 WP_000195318.1.33143 WP_000195318.1.33144 WP_000195318.1.33160 WP_000195318.1.33208 WP_000195318.1.33247 WP_000195318.1.33248 WP_000195318.1.33253 WP_000195318.1.33261 WP_000195318.1.33270 WP_000195318.1.33280 WP_000195318.1.33283 WP_000195318.1.333 WP_000195318.1.33313 WP_000195318.1.33339 WP_000195318.1.33382 WP_000195318.1.33392 WP_000195318.1.33409 WP_000195318.1.33420 WP_000195318.1.33486 WP_000195318.1.33490 WP_000195318.1.33492 WP_000195318.1.33499 WP_000195318.1.335 WP_000195318.1.33501 WP_000195318.1.33504 WP_000195318.1.33553 WP_000195318.1.3356 WP_000195318.1.33580 WP_000195318.1.33586 WP_000195318.1.33592 WP_000195318.1.33629 WP_000195318.1.3364 WP_000195318.1.33659 WP_000195318.1.33693 WP_000195318.1.3370 WP_000195318.1.33730 WP_000195318.1.33817 WP_000195318.1.33825 WP_000195318.1.33865 WP_000195318.1.33894 WP_000195318.1.3392 WP_000195318.1.33926 WP_000195318.1.3394 WP_000195318.1.3396 WP_000195318.1.33969 WP_000195318.1.33986 WP_000195318.1.34 WP_000195318.1.34001 WP_000195318.1.34022 WP_000195318.1.34043 WP_000195318.1.34059 WP_000195318.1.34075 WP_000195318.1.34081 WP_000195318.1.34084 WP_000195318.1.34091 WP_000195318.1.34107 WP_000195318.1.34118 WP_000195318.1.34126 WP_000195318.1.34179 WP_000195318.1.34184 WP_000195318.1.34185 WP_000195318.1.34211 WP_000195318.1.34214 WP_000195318.1.34234 WP_000195318.1.34257 WP_000195318.1.34279 WP_000195318.1.34284 WP_000195318.1.34292 WP_000195318.1.34304 WP_000195318.1.34319 WP_000195318.1.34330 WP_000195318.1.34376 WP_000195318.1.3438 WP_000195318.1.34417 WP_000195318.1.34424 WP_000195318.1.34431 WP_000195318.1.34453 WP_000195318.1.34454 WP_000195318.1.34458 WP_000195318.1.34484 WP_000195318.1.34496 WP_000195318.1.34517 WP_000195318.1.34610 WP_000195318.1.34614 WP_000195318.1.34659 WP_000195318.1.34665 WP_000195318.1.34684 WP_000195318.1.34694 WP_000195318.1.34703 WP_000195318.1.34704 WP_000195318.1.34707 WP_000195318.1.34711 WP_000195318.1.34745 WP_000195318.1.34751 WP_000195318.1.34801 WP_000195318.1.34808 WP_000195318.1.34817 WP_000195318.1.34820 WP_000195318.1.34824 WP_000195318.1.34834 WP_000195318.1.34854 WP_000195318.1.34856 WP_000195318.1.34881 WP_000195318.1.3489 WP_000195318.1.34932 WP_000195318.1.34962 WP_000195318.1.34972 WP_000195318.1.34975 WP_000195318.1.34977 WP_000195318.1.35001 WP_000195318.1.35035 WP_000195318.1.35040 WP_000195318.1.35045 WP_000195318.1.35074 WP_000195318.1.35075 WP_000195318.1.35129 WP_000195318.1.35175 WP_000195318.1.35184 WP_000195318.1.35193 WP_000195318.1.35274 WP_000195318.1.35298 WP_000195318.1.35321 WP_000195318.1.35331 WP_000195318.1.35332 WP_000195318.1.35404 WP_000195318.1.35408 WP_000195318.1.3541 WP_000195318.1.35425 WP_000195318.1.35429 WP_000195318.1.35446 WP_000195318.1.35460 WP_000195318.1.35463 WP_000195318.1.35494 WP_000195318.1.35503 WP_000195318.1.35507 WP_000195318.1.35509 WP_000195318.1.35532 WP_000195318.1.3556 WP_000195318.1.35560 WP_000195318.1.35563 WP_000195318.1.35570 WP_000195318.1.35590 WP_000195318.1.35594 WP_000195318.1.35619 WP_000195318.1.35624 WP_000195318.1.35628 WP_000195318.1.35648 WP_000195318.1.3566 WP_000195318.1.3570 WP_000195318.1.35712 WP_000195318.1.35713 WP_000195318.1.3572 WP_000195318.1.35736 WP_000195318.1.35777 WP_000195318.1.35791 WP_000195318.1.35795 WP_000195318.1.35809 WP_000195318.1.35835 WP_000195318.1.35868 WP_000195318.1.35870 WP_000195318.1.35887 WP_000195318.1.35892 WP_000195318.1.35916 WP_000195318.1.35936 WP_000195318.1.35940 WP_000195318.1.35961 WP_000195318.1.36000 WP_000195318.1.36003 WP_000195318.1.3601 WP_000195318.1.36011 WP_000195318.1.36017 WP_000195318.1.36034 WP_000195318.1.36036 WP_000195318.1.36037 WP_000195318.1.36057 WP_000195318.1.36063 WP_000195318.1.36069 WP_000195318.1.3610 WP_000195318.1.36157 WP_000195318.1.36172 WP_000195318.1.36229 WP_000195318.1.36232 WP_000195318.1.36236 WP_000195318.1.36286 WP_000195318.1.36291 WP_000195318.1.36298 WP_000195318.1.36323 WP_000195318.1.36343 WP_000195318.1.36409 WP_000195318.1.36425 WP_000195318.1.36445 WP_000195318.1.36460 WP_000195318.1.3649 WP_000195318.1.36495 WP_000195318.1.36512 WP_000195318.1.36526 WP_000195318.1.36542 WP_000195318.1.36547 WP_000195318.1.36567 WP_000195318.1.36579 WP_000195318.1.36584 WP_000195318.1.36586 WP_000195318.1.36592 WP_000195318.1.36609 WP_000195318.1.36617 WP_000195318.1.36618 WP_000195318.1.36643 WP_000195318.1.36652 WP_000195318.1.36663 WP_000195318.1.36685 WP_000195318.1.36690 WP_000195318.1.3670 WP_000195318.1.36701 WP_000195318.1.36705 WP_000195318.1.36721 WP_000195318.1.36764 WP_000195318.1.36765 WP_000195318.1.36779 WP_000195318.1.36792 WP_000195318.1.36798 WP_000195318.1.36802 WP_000195318.1.36821 WP_000195318.1.36839 WP_000195318.1.36853 WP_000195318.1.36875 WP_000195318.1.3688 WP_000195318.1.36885 WP_000195318.1.36889 WP_000195318.1.36899 WP_000195318.1.36918 WP_000195318.1.36931 WP_000195318.1.36948 WP_000195318.1.36949 WP_000195318.1.36950 WP_000195318.1.36978 WP_000195318.1.37013 WP_000195318.1.37021 WP_000195318.1.37029 WP_000195318.1.37063 WP_000195318.1.37073 WP_000195318.1.37100 WP_000195318.1.37111 WP_000195318.1.37112 WP_000195318.1.37114 WP_000195318.1.37133 WP_000195318.1.37147 WP_000195318.1.37158 WP_000195318.1.37190 WP_000195318.1.37191 WP_000195318.1.37200 WP_000195318.1.37256 WP_000195318.1.3726 WP_000195318.1.37267 WP_000195318.1.3728 WP_000195318.1.37293 WP_000195318.1.37297 WP_000195318.1.37303 WP_000195318.1.37320 WP_000195318.1.3734 WP_000195318.1.37351 WP_000195318.1.37363 WP_000195318.1.37370 WP_000195318.1.37376 WP_000195318.1.37405 WP_000195318.1.3744 WP_000195318.1.37478 WP_000195318.1.3748 WP_000195318.1.37498 WP_000195318.1.37504 WP_000195318.1.3751 WP_000195318.1.37513 WP_000195318.1.37521 WP_000195318.1.37558 WP_000195318.1.3756 WP_000195318.1.37584 WP_000195318.1.37590 WP_000195318.1.37593 WP_000195318.1.37600 WP_000195318.1.37610 WP_000195318.1.37618 WP_000195318.1.37659 WP_000195318.1.37662 WP_000195318.1.37666 WP_000195318.1.37675 WP_000195318.1.37687 WP_000195318.1.37691 WP_000195318.1.3771 WP_000195318.1.37719 WP_000195318.1.37761 WP_000195318.1.37775 WP_000195318.1.37777 WP_000195318.1.3778 WP_000195318.1.37848 WP_000195318.1.37864 WP_000195318.1.379 WP_000195318.1.3790 WP_000195318.1.37911 WP_000195318.1.37941 WP_000195318.1.37965 WP_000195318.1.37968 WP_000195318.1.37978 WP_000195318.1.38026 WP_000195318.1.38037 WP_000195318.1.38055 WP_000195318.1.38061 WP_000195318.1.38108 WP_000195318.1.38113 WP_000195318.1.38125 WP_000195318.1.38145 WP_000195318.1.3816 WP_000195318.1.38199 WP_000195318.1.38207 WP_000195318.1.38261 WP_000195318.1.38266 WP_000195318.1.38273 WP_000195318.1.3828 WP_000195318.1.383 WP_000195318.1.38310 WP_000195318.1.38322 WP_000195318.1.3834 WP_000195318.1.38341 WP_000195318.1.38344 WP_000195318.1.38349 WP_000195318.1.38351 WP_000195318.1.3838 WP_000195318.1.38381 WP_000195318.1.38393 WP_000195318.1.38440 WP_000195318.1.38452 WP_000195318.1.3848 WP_000195318.1.38512 WP_000195318.1.38515 WP_000195318.1.38569 WP_000195318.1.38595 WP_000195318.1.3860 WP_000195318.1.38609 WP_000195318.1.38613 WP_000195318.1.38620 WP_000195318.1.38622 WP_000195318.1.38642 WP_000195318.1.38673 WP_000195318.1.3869 WP_000195318.1.38693 WP_000195318.1.38740 WP_000195318.1.38773 WP_000195318.1.38781 WP_000195318.1.38797 WP_000195318.1.38830 WP_000195318.1.38857 WP_000195318.1.38881 WP_000195318.1.38882 WP_000195318.1.38895 WP_000195318.1.3891 WP_000195318.1.38913 WP_000195318.1.38942 WP_000195318.1.38983 WP_000195318.1.38995 WP_000195318.1.38996 WP_000195318.1.39003 WP_000195318.1.39048 WP_000195318.1.39055 WP_000195318.1.39056 WP_000195318.1.39059 WP_000195318.1.39065 WP_000195318.1.3907 WP_000195318.1.39075 WP_000195318.1.39105 WP_000195318.1.39112 WP_000195318.1.39113 WP_000195318.1.39128 WP_000195318.1.39136 WP_000195318.1.39140 WP_000195318.1.39146 WP_000195318.1.39147 WP_000195318.1.39183 WP_000195318.1.39197 WP_000195318.1.39229 WP_000195318.1.39235 WP_000195318.1.39265 WP_000195318.1.39275 WP_000195318.1.39312 WP_000195318.1.39395 WP_000195318.1.39405 WP_000195318.1.39414 WP_000195318.1.39435 WP_000195318.1.39449 WP_000195318.1.39466 WP_000195318.1.39471 WP_000195318.1.39497 WP_000195318.1.39502 WP_000195318.1.39503 WP_000195318.1.39512 WP_000195318.1.39530 WP_000195318.1.39553 WP_000195318.1.39556 WP_000195318.1.39576 WP_000195318.1.39584 WP_000195318.1.39609 WP_000195318.1.39614 WP_000195318.1.39619 WP_000195318.1.39620 WP_000195318.1.39624 WP_000195318.1.39629 WP_000195318.1.39632 WP_000195318.1.39667 WP_000195318.1.39722 WP_000195318.1.39723 WP_000195318.1.39724 WP_000195318.1.39763 WP_000195318.1.39775 WP_000195318.1.39808 WP_000195318.1.39862 WP_000195318.1.39879 WP_000195318.1.39890 WP_000195318.1.39921 WP_000195318.1.39923 WP_000195318.1.39941 WP_000195318.1.39945 WP_000195318.1.39953 WP_000195318.1.40008 WP_000195318.1.40017 WP_000195318.1.40025 WP_000195318.1.40031 WP_000195318.1.40072 WP_000195318.1.40073 WP_000195318.1.40081 WP_000195318.1.40097 WP_000195318.1.401 WP_000195318.1.4011 WP_000195318.1.40111 WP_000195318.1.40155 WP_000195318.1.40158 WP_000195318.1.40160 WP_000195318.1.40167 WP_000195318.1.40171 WP_000195318.1.40205 WP_000195318.1.40208 WP_000195318.1.40224 WP_000195318.1.40229 WP_000195318.1.40240 WP_000195318.1.40254 WP_000195318.1.40257 WP_000195318.1.40258 WP_000195318.1.40259 WP_000195318.1.40279 WP_000195318.1.40292 WP_000195318.1.40305 WP_000195318.1.40307 WP_000195318.1.40311 WP_000195318.1.40341 WP_000195318.1.40361 WP_000195318.1.40374 WP_000195318.1.40380 WP_000195318.1.40395 WP_000195318.1.4042 WP_000195318.1.40465 WP_000195318.1.40467 WP_000195318.1.40493 WP_000195318.1.40496 WP_000195318.1.40508 WP_000195318.1.40517 WP_000195318.1.40528 WP_000195318.1.40533 WP_000195318.1.40577 WP_000195318.1.40583 WP_000195318.1.40605 WP_000195318.1.40622 WP_000195318.1.40648 WP_000195318.1.40693 WP_000195318.1.40695 WP_000195318.1.40698 WP_000195318.1.40710 WP_000195318.1.40722 WP_000195318.1.40745 WP_000195318.1.4075 WP_000195318.1.40750 WP_000195318.1.40763 WP_000195318.1.40771 WP_000195318.1.40788 WP_000195318.1.40849 WP_000195318.1.40854 WP_000195318.1.4087 WP_000195318.1.40877 WP_000195318.1.40910 WP_000195318.1.40924 WP_000195318.1.40930 WP_000195318.1.40932 WP_000195318.1.40935 WP_000195318.1.40946 WP_000195318.1.40973 WP_000195318.1.40979 WP_000195318.1.40996 WP_000195318.1.41004 WP_000195318.1.41017 WP_000195318.1.41018 WP_000195318.1.41048 WP_000195318.1.41050 WP_000195318.1.41070 WP_000195318.1.41074 WP_000195318.1.41086 WP_000195318.1.4109 WP_000195318.1.41091 WP_000195318.1.41097 WP_000195318.1.41116 WP_000195318.1.41128 WP_000195318.1.41132 WP_000195318.1.41176 WP_000195318.1.41192 WP_000195318.1.41225 WP_000195318.1.41226 WP_000195318.1.41251 WP_000195318.1.41258 WP_000195318.1.41265 WP_000195318.1.41277 WP_000195318.1.41279 WP_000195318.1.41299 WP_000195318.1.41305 WP_000195318.1.41308 WP_000195318.1.41310 WP_000195318.1.41335 WP_000195318.1.41345 WP_000195318.1.4136 WP_000195318.1.41375 WP_000195318.1.4141 WP_000195318.1.41415 WP_000195318.1.41427 WP_000195318.1.41434 WP_000195318.1.41438 WP_000195318.1.41440 WP_000195318.1.41459 WP_000195318.1.41468 WP_000195318.1.41498 WP_000195318.1.41516 WP_000195318.1.41524 WP_000195318.1.41528 WP_000195318.1.41554 WP_000195318.1.41572 WP_000195318.1.41591 WP_000195318.1.41593 WP_000195318.1.41610 WP_000195318.1.41628 WP_000195318.1.41631 WP_000195318.1.41658 WP_000195318.1.41659 WP_000195318.1.41662 WP_000195318.1.41688 WP_000195318.1.41690 WP_000195318.1.41708 WP_000195318.1.41716 WP_000195318.1.41724 WP_000195318.1.41735 WP_000195318.1.41746 WP_000195318.1.41761 WP_000195318.1.4178 WP_000195318.1.41789 WP_000195318.1.41799 WP_000195318.1.41802 WP_000195318.1.41824 WP_000195318.1.41836 WP_000195318.1.4184 WP_000195318.1.41859 WP_000195318.1.41862 WP_000195318.1.41877 WP_000195318.1.41882 WP_000195318.1.41894 WP_000195318.1.41897 WP_000195318.1.41904 WP_000195318.1.41911 WP_000195318.1.41929 WP_000195318.1.41931 WP_000195318.1.41938 WP_000195318.1.41949 WP_000195318.1.41978 WP_000195318.1.41979 WP_000195318.1.41985 WP_000195318.1.41994 WP_000195318.1.41998 WP_000195318.1.42009 WP_000195318.1.42081 WP_000195318.1.42098 WP_000195318.1.42104 WP_000195318.1.42109 WP_000195318.1.42111 WP_000195318.1.42136 WP_000195318.1.42156 WP_000195318.1.422 WP_000195318.1.42200 WP_000195318.1.4222 WP_000195318.1.42238 WP_000195318.1.42243 WP_000195318.1.42244 WP_000195318.1.42248 WP_000195318.1.42257 WP_000195318.1.42261 WP_000195318.1.42263 WP_000195318.1.42276 WP_000195318.1.4229 WP_000195318.1.42320 WP_000195318.1.42322 WP_000195318.1.42328 WP_000195318.1.42342 WP_000195318.1.42349 WP_000195318.1.42356 WP_000195318.1.42364 WP_000195318.1.42371 WP_000195318.1.42372 WP_000195318.1.42391 WP_000195318.1.42392 WP_000195318.1.42399 WP_000195318.1.42404 WP_000195318.1.42422 WP_000195318.1.42433 WP_000195318.1.42444 WP_000195318.1.42453 WP_000195318.1.42491 WP_000195318.1.4257 WP_000195318.1.42595 WP_000195318.1.42605 WP_000195318.1.42655 WP_000195318.1.42666 WP_000195318.1.42675 WP_000195318.1.42676 WP_000195318.1.42683 WP_000195318.1.42685 WP_000195318.1.42701 WP_000195318.1.42707 WP_000195318.1.42734 WP_000195318.1.4276 WP_000195318.1.42767 WP_000195318.1.42794 WP_000195318.1.42797 WP_000195318.1.42805 WP_000195318.1.42829 WP_000195318.1.42859 WP_000195318.1.42861 WP_000195318.1.42864 WP_000195318.1.4288 WP_000195318.1.42887 WP_000195318.1.4289 WP_000195318.1.42892 WP_000195318.1.42923 WP_000195318.1.42932 WP_000195318.1.42978 WP_000195318.1.4298 WP_000195318.1.42981 WP_000195318.1.43008 WP_000195318.1.43016 WP_000195318.1.43018 WP_000195318.1.43019 WP_000195318.1.43041 WP_000195318.1.43068 WP_000195318.1.43069 WP_000195318.1.43077 WP_000195318.1.43089 WP_000195318.1.43126 WP_000195318.1.43128 WP_000195318.1.43141 WP_000195318.1.43160 WP_000195318.1.43161 WP_000195318.1.43190 WP_000195318.1.43198 WP_000195318.1.43201 WP_000195318.1.43244 WP_000195318.1.4326 WP_000195318.1.43272 WP_000195318.1.43276 WP_000195318.1.43290 WP_000195318.1.43292 WP_000195318.1.43299 WP_000195318.1.43312 WP_000195318.1.4332 WP_000195318.1.43334 WP_000195318.1.43339 WP_000195318.1.43351 WP_000195318.1.43371 WP_000195318.1.43437 WP_000195318.1.43438 WP_000195318.1.4344 WP_000195318.1.43441 WP_000195318.1.43476 WP_000195318.1.43508 WP_000195318.1.43513 WP_000195318.1.43520 WP_000195318.1.43522 WP_000195318.1.43528 WP_000195318.1.43535 WP_000195318.1.43606 WP_000195318.1.43613 WP_000195318.1.43633 WP_000195318.1.43637 WP_000195318.1.43651 WP_000195318.1.43654 WP_000195318.1.43668 WP_000195318.1.43676 WP_000195318.1.43685 WP_000195318.1.43710 WP_000195318.1.43711 WP_000195318.1.43722 WP_000195318.1.4373 WP_000195318.1.43778 WP_000195318.1.43782 WP_000195318.1.43785 WP_000195318.1.43801 WP_000195318.1.43812 WP_000195318.1.43828 WP_000195318.1.43839 WP_000195318.1.43864 WP_000195318.1.43873 WP_000195318.1.43875 WP_000195318.1.43878 WP_000195318.1.43886 WP_000195318.1.43888 WP_000195318.1.43919 WP_000195318.1.43951 WP_000195318.1.43954 WP_000195318.1.43974 WP_000195318.1.44010 WP_000195318.1.4404 WP_000195318.1.44043 WP_000195318.1.44049 WP_000195318.1.4405 WP_000195318.1.44063 WP_000195318.1.44099 WP_000195318.1.44101 WP_000195318.1.44121 WP_000195318.1.44144 WP_000195318.1.44160 WP_000195318.1.44180 WP_000195318.1.44187 WP_000195318.1.44191 WP_000195318.1.4422 WP_000195318.1.4423 WP_000195318.1.44248 WP_000195318.1.44250 WP_000195318.1.44262 WP_000195318.1.44268 WP_000195318.1.4427 WP_000195318.1.44291 WP_000195318.1.44296 WP_000195318.1.44300 WP_000195318.1.44310 WP_000195318.1.44337 WP_000195318.1.44343 WP_000195318.1.44351 WP_000195318.1.44359 WP_000195318.1.44360 WP_000195318.1.44397 WP_000195318.1.4440 WP_000195318.1.44416 WP_000195318.1.44431 WP_000195318.1.44433 WP_000195318.1.44438 WP_000195318.1.44440 WP_000195318.1.44443 WP_000195318.1.44453 WP_000195318.1.44474 WP_000195318.1.44479 WP_000195318.1.44549 WP_000195318.1.44593 WP_000195318.1.44606 WP_000195318.1.44607 WP_000195318.1.44636 WP_000195318.1.44640 WP_000195318.1.4467 WP_000195318.1.44678 WP_000195318.1.44687 WP_000195318.1.44702 WP_000195318.1.44705 WP_000195318.1.44747 WP_000195318.1.44762 WP_000195318.1.44781 WP_000195318.1.44791 WP_000195318.1.44795 WP_000195318.1.44815 WP_000195318.1.44831 WP_000195318.1.44833 WP_000195318.1.4485 WP_000195318.1.44877 WP_000195318.1.44879 WP_000195318.1.44887 WP_000195318.1.449 WP_000195318.1.44917 WP_000195318.1.44927 WP_000195318.1.44933 WP_000195318.1.44943 WP_000195318.1.44950 WP_000195318.1.44966 WP_000195318.1.44971 WP_000195318.1.44978 WP_000195318.1.44985 WP_000195318.1.44996 WP_000195318.1.44997 WP_000195318.1.44998 WP_000195318.1.4500 WP_000195318.1.4501 WP_000195318.1.45027 WP_000195318.1.45038 WP_000195318.1.4505 WP_000195318.1.45067 WP_000195318.1.45072 WP_000195318.1.45074 WP_000195318.1.45079 WP_000195318.1.45098 WP_000195318.1.45123 WP_000195318.1.45134 WP_000195318.1.45136 WP_000195318.1.45138 WP_000195318.1.45145 WP_000195318.1.45154 WP_000195318.1.45173 WP_000195318.1.45177 WP_000195318.1.45184 WP_000195318.1.45229 WP_000195318.1.45241 WP_000195318.1.45251 WP_000195318.1.45259 WP_000195318.1.45268 WP_000195318.1.45302 WP_000195318.1.4531 WP_000195318.1.45322 WP_000195318.1.45344 WP_000195318.1.45349 WP_000195318.1.45351 WP_000195318.1.45365 WP_000195318.1.4540 WP_000195318.1.45402 WP_000195318.1.45432 WP_000195318.1.45434 WP_000195318.1.45435 WP_000195318.1.45462 WP_000195318.1.45522 WP_000195318.1.45535 WP_000195318.1.45544 WP_000195318.1.45549 WP_000195318.1.45550 WP_000195318.1.45569 WP_000195318.1.45571 WP_000195318.1.45582 WP_000195318.1.45583 WP_000195318.1.45585 WP_000195318.1.45596 WP_000195318.1.45622 WP_000195318.1.45648 WP_000195318.1.45660 WP_000195318.1.45690 WP_000195318.1.45706 WP_000195318.1.45781 WP_000195318.1.45797 WP_000195318.1.458 WP_000195318.1.45829 WP_000195318.1.45844 WP_000195318.1.45848 WP_000195318.1.45871 WP_000195318.1.45906 WP_000195318.1.45918 WP_000195318.1.4592 WP_000195318.1.45973 WP_000195318.1.46011 WP_000195318.1.46030 WP_000195318.1.46069 WP_000195318.1.46077 WP_000195318.1.46091 WP_000195318.1.46112 WP_000195318.1.46124 WP_000195318.1.46169 WP_000195318.1.46173 WP_000195318.1.46174 WP_000195318.1.46187 WP_000195318.1.46203 WP_000195318.1.46205 WP_000195318.1.46215 WP_000195318.1.46225 WP_000195318.1.46232 WP_000195318.1.46243 WP_000195318.1.46250 WP_000195318.1.46278 WP_000195318.1.46299 WP_000195318.1.46303 WP_000195318.1.46307 WP_000195318.1.46323 WP_000195318.1.46345 WP_000195318.1.46358 WP_000195318.1.464 WP_000195318.1.46406 WP_000195318.1.46434 WP_000195318.1.46444 WP_000195318.1.46454 WP_000195318.1.46461 WP_000195318.1.46499 WP_000195318.1.46504 WP_000195318.1.46505 WP_000195318.1.46551 WP_000195318.1.46559 WP_000195318.1.46572 WP_000195318.1.46578 WP_000195318.1.46595 WP_000195318.1.46620 WP_000195318.1.46637 WP_000195318.1.46675 WP_000195318.1.46689 WP_000195318.1.46693 WP_000195318.1.46701 WP_000195318.1.4671 WP_000195318.1.46726 WP_000195318.1.46730 WP_000195318.1.46732 WP_000195318.1.4674 WP_000195318.1.46749 WP_000195318.1.46781 WP_000195318.1.46803 WP_000195318.1.46804 WP_000195318.1.46816 WP_000195318.1.46842 WP_000195318.1.4686 WP_000195318.1.4690 WP_000195318.1.46920 WP_000195318.1.46930 WP_000195318.1.46945 WP_000195318.1.46961 WP_000195318.1.46967 WP_000195318.1.46976 WP_000195318.1.47005 WP_000195318.1.47008 WP_000195318.1.47014 WP_000195318.1.47023 WP_000195318.1.47036 WP_000195318.1.47037 WP_000195318.1.47057 WP_000195318.1.47058 WP_000195318.1.47059 WP_000195318.1.47061 WP_000195318.1.47067 WP_000195318.1.47085 WP_000195318.1.47110 WP_000195318.1.47123 WP_000195318.1.47214 WP_000195318.1.47215 WP_000195318.1.47243 WP_000195318.1.47245 WP_000195318.1.47257 WP_000195318.1.47389 WP_000195318.1.47429 WP_000195318.1.47448 WP_000195318.1.47460 WP_000195318.1.4747 WP_000195318.1.47472 WP_000195318.1.47478 WP_000195318.1.47482 WP_000195318.1.47492 WP_000195318.1.47506 WP_000195318.1.47507 WP_000195318.1.47531 WP_000195318.1.47532 WP_000195318.1.47542 WP_000195318.1.47567 WP_000195318.1.47576 WP_000195318.1.47579 WP_000195318.1.4758 WP_000195318.1.47587 WP_000195318.1.47605 WP_000195318.1.47614 WP_000195318.1.47621 WP_000195318.1.47630 WP_000195318.1.47660 WP_000195318.1.4769 WP_000195318.1.4770 WP_000195318.1.47714 WP_000195318.1.4774 WP_000195318.1.4775 WP_000195318.1.47756 WP_000195318.1.47767 WP_000195318.1.47799 WP_000195318.1.47817 WP_000195318.1.47829 WP_000195318.1.47849 WP_000195318.1.47850 WP_000195318.1.47875 WP_000195318.1.47886 WP_000195318.1.47902 WP_000195318.1.47911 WP_000195318.1.4795 WP_000195318.1.47988 WP_000195318.1.47992 WP_000195318.1.48019 WP_000195318.1.48100 WP_000195318.1.48124 WP_000195318.1.48132 WP_000195318.1.48134 WP_000195318.1.48139 WP_000195318.1.48190 WP_000195318.1.48215 WP_000195318.1.48218 WP_000195318.1.48242 WP_000195318.1.48244 WP_000195318.1.48247 WP_000195318.1.48253 WP_000195318.1.48268 WP_000195318.1.48292 WP_000195318.1.483 WP_000195318.1.48324 WP_000195318.1.48367 WP_000195318.1.48377 WP_000195318.1.4839 WP_000195318.1.48399 WP_000195318.1.48430 WP_000195318.1.48436 WP_000195318.1.48455 WP_000195318.1.48493 WP_000195318.1.48510 WP_000195318.1.48524 WP_000195318.1.4853 WP_000195318.1.48586 WP_000195318.1.4859 WP_000195318.1.48591 WP_000195318.1.48610 WP_000195318.1.48631 WP_000195318.1.48647 WP_000195318.1.48651 WP_000195318.1.48663 WP_000195318.1.48690 WP_000195318.1.48734 WP_000195318.1.48751 WP_000195318.1.48755 WP_000195318.1.48756 WP_000195318.1.48768 WP_000195318.1.48778 WP_000195318.1.48788 WP_000195318.1.48797 WP_000195318.1.48841 WP_000195318.1.48849 WP_000195318.1.4885 WP_000195318.1.48855 WP_000195318.1.48876 WP_000195318.1.48894 WP_000195318.1.48896 WP_000195318.1.48918 WP_000195318.1.48919 WP_000195318.1.48931 WP_000195318.1.48963 WP_000195318.1.48973 WP_000195318.1.49004 WP_000195318.1.49005 WP_000195318.1.49012 WP_000195318.1.49084 WP_000195318.1.49090 WP_000195318.1.49102 WP_000195318.1.49106 WP_000195318.1.49113 WP_000195318.1.4914 WP_000195318.1.49140 WP_000195318.1.49153 WP_000195318.1.49155 WP_000195318.1.49162 WP_000195318.1.49166 WP_000195318.1.49175 WP_000195318.1.49204 WP_000195318.1.49214 WP_000195318.1.49226 WP_000195318.1.49239 WP_000195318.1.49256 WP_000195318.1.49262 WP_000195318.1.49276 WP_000195318.1.49290 WP_000195318.1.49309 WP_000195318.1.49311 WP_000195318.1.49334 WP_000195318.1.49340 WP_000195318.1.49355 WP_000195318.1.49358 WP_000195318.1.49366 WP_000195318.1.49375 WP_000195318.1.49429 WP_000195318.1.49430 WP_000195318.1.49434 WP_000195318.1.49443 WP_000195318.1.49450 WP_000195318.1.49490 WP_000195318.1.49494 WP_000195318.1.495 WP_000195318.1.49515 WP_000195318.1.49545 WP_000195318.1.49550 WP_000195318.1.49572 WP_000195318.1.49590 WP_000195318.1.49595 WP_000195318.1.49602 WP_000195318.1.49626 WP_000195318.1.49630 WP_000195318.1.49647 WP_000195318.1.49650 WP_000195318.1.49686 WP_000195318.1.49703 WP_000195318.1.49769 WP_000195318.1.49770 WP_000195318.1.49778 WP_000195318.1.49780 WP_000195318.1.4979 WP_000195318.1.49790 WP_000195318.1.49803 WP_000195318.1.49805 WP_000195318.1.49827 WP_000195318.1.49846 WP_000195318.1.49848 WP_000195318.1.4991 WP_000195318.1.49929 WP_000195318.1.49931 WP_000195318.1.49947 WP_000195318.1.49959 WP_000195318.1.49997 WP_000195318.1.50 WP_000195318.1.50003 WP_000195318.1.50007 WP_000195318.1.50030 WP_000195318.1.50043 WP_000195318.1.50080 WP_000195318.1.5009 WP_000195318.1.50128 WP_000195318.1.50153 WP_000195318.1.50161 WP_000195318.1.50198 WP_000195318.1.50211 WP_000195318.1.50238 WP_000195318.1.50239 WP_000195318.1.50247 WP_000195318.1.50251 WP_000195318.1.50285 WP_000195318.1.50308 WP_000195318.1.50309 WP_000195318.1.50332 WP_000195318.1.50349 WP_000195318.1.50374 WP_000195318.1.50376 WP_000195318.1.50386 WP_000195318.1.50387 WP_000195318.1.50389 WP_000195318.1.50404 WP_000195318.1.50413 WP_000195318.1.50449 WP_000195318.1.50468 WP_000195318.1.50478 WP_000195318.1.50480 WP_000195318.1.50497 WP_000195318.1.5051 WP_000195318.1.50517 WP_000195318.1.50529 WP_000195318.1.50566 WP_000195318.1.50570 WP_000195318.1.50576 WP_000195318.1.5058 WP_000195318.1.50593 WP_000195318.1.50626 WP_000195318.1.50652 WP_000195318.1.50676 WP_000195318.1.50684 WP_000195318.1.50726 WP_000195318.1.50750 WP_000195318.1.50769 WP_000195318.1.50774 WP_000195318.1.50777 WP_000195318.1.50800 WP_000195318.1.50804 WP_000195318.1.50808 WP_000195318.1.50811 WP_000195318.1.50875 WP_000195318.1.5088 WP_000195318.1.50882 WP_000195318.1.50885 WP_000195318.1.50893 WP_000195318.1.509 WP_000195318.1.50905 WP_000195318.1.50908 WP_000195318.1.50918 WP_000195318.1.50929 WP_000195318.1.50941 WP_000195318.1.50954 WP_000195318.1.50960 WP_000195318.1.50999 WP_000195318.1.51014 WP_000195318.1.51022 WP_000195318.1.51025 WP_000195318.1.51040 WP_000195318.1.51048 WP_000195318.1.51066 WP_000195318.1.51100 WP_000195318.1.51117 WP_000195318.1.51131 WP_000195318.1.51134 WP_000195318.1.5114 WP_000195318.1.51162 WP_000195318.1.51179 WP_000195318.1.51182 WP_000195318.1.51186 WP_000195318.1.51224 WP_000195318.1.51227 WP_000195318.1.5125 WP_000195318.1.5127 WP_000195318.1.51285 WP_000195318.1.51305 WP_000195318.1.51308 WP_000195318.1.51315 WP_000195318.1.51331 WP_000195318.1.51338 WP_000195318.1.51356 WP_000195318.1.5138 WP_000195318.1.51394 WP_000195318.1.51412 WP_000195318.1.51414 WP_000195318.1.51419 WP_000195318.1.51451 WP_000195318.1.51464 WP_000195318.1.51474 WP_000195318.1.51487 WP_000195318.1.51488 WP_000195318.1.51502 WP_000195318.1.51506 WP_000195318.1.51514 WP_000195318.1.51518 WP_000195318.1.51555 WP_000195318.1.51594 WP_000195318.1.51598 WP_000195318.1.51611 WP_000195318.1.51613 WP_000195318.1.51615 WP_000195318.1.51634 WP_000195318.1.51642 WP_000195318.1.51644 WP_000195318.1.51649 WP_000195318.1.51686 WP_000195318.1.51700 WP_000195318.1.51704 WP_000195318.1.51724 WP_000195318.1.51734 WP_000195318.1.51756 WP_000195318.1.51764 WP_000195318.1.51810 WP_000195318.1.51831 WP_000195318.1.51841 WP_000195318.1.5185 WP_000195318.1.51863 WP_000195318.1.51868 WP_000195318.1.51888 WP_000195318.1.51910 WP_000195318.1.51911 WP_000195318.1.51914 WP_000195318.1.51930 WP_000195318.1.51932 WP_000195318.1.51935 WP_000195318.1.51989 WP_000195318.1.51994 WP_000195318.1.520 WP_000195318.1.52047 WP_000195318.1.52057 WP_000195318.1.52101 WP_000195318.1.5211 WP_000195318.1.52114 WP_000195318.1.52121 WP_000195318.1.52123 WP_000195318.1.52129 WP_000195318.1.52148 WP_000195318.1.52156 WP_000195318.1.5216 WP_000195318.1.52161 WP_000195318.1.52170 WP_000195318.1.52191 WP_000195318.1.52202 WP_000195318.1.52255 WP_000195318.1.52301 WP_000195318.1.52321 WP_000195318.1.52336 WP_000195318.1.52339 WP_000195318.1.52346 WP_000195318.1.52353 WP_000195318.1.52356 WP_000195318.1.52361 WP_000195318.1.52446 WP_000195318.1.52456 WP_000195318.1.52469 WP_000195318.1.52527 WP_000195318.1.52528 WP_000195318.1.52571 WP_000195318.1.52582 WP_000195318.1.52586 WP_000195318.1.526 WP_000195318.1.52608 WP_000195318.1.52637 WP_000195318.1.52653 WP_000195318.1.52656 WP_000195318.1.52692 WP_000195318.1.5273 WP_000195318.1.52738 WP_000195318.1.52742 WP_000195318.1.52743 WP_000195318.1.52744 WP_000195318.1.52748 WP_000195318.1.52807 WP_000195318.1.52824 WP_000195318.1.52833 WP_000195318.1.52857 WP_000195318.1.52858 WP_000195318.1.52866 WP_000195318.1.52887 WP_000195318.1.52898 WP_000195318.1.52915 WP_000195318.1.52924 WP_000195318.1.52949 WP_000195318.1.52985 WP_000195318.1.53092 WP_000195318.1.53107 WP_000195318.1.53119 WP_000195318.1.5313 WP_000195318.1.53141 WP_000195318.1.53151 WP_000195318.1.53154 WP_000195318.1.53158 WP_000195318.1.53159 WP_000195318.1.5316 WP_000195318.1.53179 WP_000195318.1.53190 WP_000195318.1.53198 WP_000195318.1.53210 WP_000195318.1.53233 WP_000195318.1.53234 WP_000195318.1.53272 WP_000195318.1.53307 WP_000195318.1.53315 WP_000195318.1.53316 WP_000195318.1.53321 WP_000195318.1.5333 WP_000195318.1.53362 WP_000195318.1.53375 WP_000195318.1.53385 WP_000195318.1.53406 WP_000195318.1.53436 WP_000195318.1.53450 WP_000195318.1.53454 WP_000195318.1.53466 WP_000195318.1.5349 WP_000195318.1.53529 WP_000195318.1.53534 WP_000195318.1.53540 WP_000195318.1.53543 WP_000195318.1.53555 WP_000195318.1.53559 WP_000195318.1.53567 WP_000195318.1.53571 WP_000195318.1.53664 WP_000195318.1.53675 WP_000195318.1.53688 WP_000195318.1.53692 WP_000195318.1.53694 WP_000195318.1.53696 WP_000195318.1.53723 WP_000195318.1.5374 WP_000195318.1.53750 WP_000195318.1.53757 WP_000195318.1.53772 WP_000195318.1.53778 WP_000195318.1.53781 WP_000195318.1.53790 WP_000195318.1.53800 WP_000195318.1.53812 WP_000195318.1.53814 WP_000195318.1.53892 WP_000195318.1.53896 WP_000195318.1.53898 WP_000195318.1.53902 WP_000195318.1.53905 WP_000195318.1.5392 WP_000195318.1.53961 WP_000195318.1.53981 WP_000195318.1.53984 WP_000195318.1.54033 WP_000195318.1.54061 WP_000195318.1.54068 WP_000195318.1.54075 WP_000195318.1.54082 WP_000195318.1.54085 WP_000195318.1.54132 WP_000195318.1.5415 WP_000195318.1.54159 WP_000195318.1.54170 WP_000195318.1.54175 WP_000195318.1.542 WP_000195318.1.54203 WP_000195318.1.54209 WP_000195318.1.54259 WP_000195318.1.54271 WP_000195318.1.54273 WP_000195318.1.54274 WP_000195318.1.54283 WP_000195318.1.5430 WP_000195318.1.54319 WP_000195318.1.54324 WP_000195318.1.54340 WP_000195318.1.54364 WP_000195318.1.54366 WP_000195318.1.54371 WP_000195318.1.54400 WP_000195318.1.54431 WP_000195318.1.54442 WP_000195318.1.54469 WP_000195318.1.54482 WP_000195318.1.54500 WP_000195318.1.54522 WP_000195318.1.54526 WP_000195318.1.54558 WP_000195318.1.5456 WP_000195318.1.54589 WP_000195318.1.5459 WP_000195318.1.54607 WP_000195318.1.54615 WP_000195318.1.5462 WP_000195318.1.54644 WP_000195318.1.54662 WP_000195318.1.54678 WP_000195318.1.54694 WP_000195318.1.54722 WP_000195318.1.54748 WP_000195318.1.54749 WP_000195318.1.54764 WP_000195318.1.5481 WP_000195318.1.54814 WP_000195318.1.54822 WP_000195318.1.54833 WP_000195318.1.54845 WP_000195318.1.54865 WP_000195318.1.54877 WP_000195318.1.5493 WP_000195318.1.54935 WP_000195318.1.54936 WP_000195318.1.54979 WP_000195318.1.54984 WP_000195318.1.54992 WP_000195318.1.55008 WP_000195318.1.55010 WP_000195318.1.55034 WP_000195318.1.55073 WP_000195318.1.55152 WP_000195318.1.55156 WP_000195318.1.55163 WP_000195318.1.55165 WP_000195318.1.55166 WP_000195318.1.5517 WP_000195318.1.55178 WP_000195318.1.55200 WP_000195318.1.55215 WP_000195318.1.55223 WP_000195318.1.55224 WP_000195318.1.5523 WP_000195318.1.5525 WP_000195318.1.5527 WP_000195318.1.55285 WP_000195318.1.55290 WP_000195318.1.55294 WP_000195318.1.55325 WP_000195318.1.55361 WP_000195318.1.55379 WP_000195318.1.5539 WP_000195318.1.55418 WP_000195318.1.55430 WP_000195318.1.55461 WP_000195318.1.55468 WP_000195318.1.55475 WP_000195318.1.55477 WP_000195318.1.55496 WP_000195318.1.55506 WP_000195318.1.5552 WP_000195318.1.55528 WP_000195318.1.55545 WP_000195318.1.5555 WP_000195318.1.55554 WP_000195318.1.55557 WP_000195318.1.55559 WP_000195318.1.5560 WP_000195318.1.55604 WP_000195318.1.55623 WP_000195318.1.55639 WP_000195318.1.55640 WP_000195318.1.55647 WP_000195318.1.55672 WP_000195318.1.55680 WP_000195318.1.55699 WP_000195318.1.55706 WP_000195318.1.55718 WP_000195318.1.5572 WP_000195318.1.55725 WP_000195318.1.55743 WP_000195318.1.55768 WP_000195318.1.5577 WP_000195318.1.55780 WP_000195318.1.55782 WP_000195318.1.55796 WP_000195318.1.55803 WP_000195318.1.55853 WP_000195318.1.55923 WP_000195318.1.55948 WP_000195318.1.55967 WP_000195318.1.55973 WP_000195318.1.55993 WP_000195318.1.55995 WP_000195318.1.56002 WP_000195318.1.56004 WP_000195318.1.56012 WP_000195318.1.56026 WP_000195318.1.56059 WP_000195318.1.56069 WP_000195318.1.56070 WP_000195318.1.56082 WP_000195318.1.56097 WP_000195318.1.56105 WP_000195318.1.56130 WP_000195318.1.56152 WP_000195318.1.5621 WP_000195318.1.56222 WP_000195318.1.56235 WP_000195318.1.56238 WP_000195318.1.56244 WP_000195318.1.56247 WP_000195318.1.56261 WP_000195318.1.56263 WP_000195318.1.56286 WP_000195318.1.56303 WP_000195318.1.56304 WP_000195318.1.56305 WP_000195318.1.56311 WP_000195318.1.5633 WP_000195318.1.56354 WP_000195318.1.56368 WP_000195318.1.56370 WP_000195318.1.56374 WP_000195318.1.56385 WP_000195318.1.56389 WP_000195318.1.56393 WP_000195318.1.56396 WP_000195318.1.56413 WP_000195318.1.56414 WP_000195318.1.56420 WP_000195318.1.56423 WP_000195318.1.56438 WP_000195318.1.56468 WP_000195318.1.56512 WP_000195318.1.56514 WP_000195318.1.56535 WP_000195318.1.56559 WP_000195318.1.56560 WP_000195318.1.56585 WP_000195318.1.56597 WP_000195318.1.56601 WP_000195318.1.56614 WP_000195318.1.56615 WP_000195318.1.56640 WP_000195318.1.56642 WP_000195318.1.56647 WP_000195318.1.56651 WP_000195318.1.56660 WP_000195318.1.56671 WP_000195318.1.5668 WP_000195318.1.56682 WP_000195318.1.56724 WP_000195318.1.56791 WP_000195318.1.56824 WP_000195318.1.56851 WP_000195318.1.56861 WP_000195318.1.56877 WP_000195318.1.56887 WP_000195318.1.56889 WP_000195318.1.56898 WP_000195318.1.56905 WP_000195318.1.56942 WP_000195318.1.56950 WP_000195318.1.56981 WP_000195318.1.57000 WP_000195318.1.57026 WP_000195318.1.57039 WP_000195318.1.57056 WP_000195318.1.57076 WP_000195318.1.5711 WP_000195318.1.57125 WP_000195318.1.57137 WP_000195318.1.57143 WP_000195318.1.57147 WP_000195318.1.57149 WP_000195318.1.57168 WP_000195318.1.57186 WP_000195318.1.57187 WP_000195318.1.57232 WP_000195318.1.57233 WP_000195318.1.57244 WP_000195318.1.57246 WP_000195318.1.57296 WP_000195318.1.57342 WP_000195318.1.57344 WP_000195318.1.57356 WP_000195318.1.57357 WP_000195318.1.57362 WP_000195318.1.57377 WP_000195318.1.57433 WP_000195318.1.57494 WP_000195318.1.57495 WP_000195318.1.57510 WP_000195318.1.57515 WP_000195318.1.57521 WP_000195318.1.57529 WP_000195318.1.5753 WP_000195318.1.57555 WP_000195318.1.57559 WP_000195318.1.57576 WP_000195318.1.57601 WP_000195318.1.57607 WP_000195318.1.5761 WP_000195318.1.57631 WP_000195318.1.57684 WP_000195318.1.57699 WP_000195318.1.57709 WP_000195318.1.57710 WP_000195318.1.57735 WP_000195318.1.5774 WP_000195318.1.57763 WP_000195318.1.57778 WP_000195318.1.57781 WP_000195318.1.57785 WP_000195318.1.57797 WP_000195318.1.57800 WP_000195318.1.5781 WP_000195318.1.57835 WP_000195318.1.57857 WP_000195318.1.57862 WP_000195318.1.57873 WP_000195318.1.57890 WP_000195318.1.57891 WP_000195318.1.57893 WP_000195318.1.57902 WP_000195318.1.57965 WP_000195318.1.57972 WP_000195318.1.57978 WP_000195318.1.5801 WP_000195318.1.58041 WP_000195318.1.58081 WP_000195318.1.58090 WP_000195318.1.58131 WP_000195318.1.58132 WP_000195318.1.58144 WP_000195318.1.58153 WP_000195318.1.58157 WP_000195318.1.58173 WP_000195318.1.58191 WP_000195318.1.58239 WP_000195318.1.58249 WP_000195318.1.58261 WP_000195318.1.58274 WP_000195318.1.5828 WP_000195318.1.58282 WP_000195318.1.58290 WP_000195318.1.58301 WP_000195318.1.58324 WP_000195318.1.58326 WP_000195318.1.58334 WP_000195318.1.58357 WP_000195318.1.58358 WP_000195318.1.5836 WP_000195318.1.58372 WP_000195318.1.58407 WP_000195318.1.58416 WP_000195318.1.58418 WP_000195318.1.58442 WP_000195318.1.58443 WP_000195318.1.58451 WP_000195318.1.5846 WP_000195318.1.58467 WP_000195318.1.58485 WP_000195318.1.58486 WP_000195318.1.58489 WP_000195318.1.58537 WP_000195318.1.5854 WP_000195318.1.58548 WP_000195318.1.58564 WP_000195318.1.58568 WP_000195318.1.5858 WP_000195318.1.58583 WP_000195318.1.58604 WP_000195318.1.58633 WP_000195318.1.58652 WP_000195318.1.58662 WP_000195318.1.58669 WP_000195318.1.58675 WP_000195318.1.58698 WP_000195318.1.587 WP_000195318.1.58729 WP_000195318.1.58744 WP_000195318.1.58745 WP_000195318.1.58749 WP_000195318.1.5875 WP_000195318.1.58796 WP_000195318.1.58803 WP_000195318.1.58807 WP_000195318.1.58831 WP_000195318.1.58834 WP_000195318.1.58836 WP_000195318.1.58847 WP_000195318.1.5886 WP_000195318.1.58861 WP_000195318.1.58883 WP_000195318.1.58884 WP_000195318.1.58898 WP_000195318.1.58926 WP_000195318.1.58949 WP_000195318.1.58963 WP_000195318.1.58970 WP_000195318.1.58974 WP_000195318.1.59006 WP_000195318.1.59012 WP_000195318.1.59020 WP_000195318.1.59043 WP_000195318.1.59056 WP_000195318.1.59061 WP_000195318.1.59068 WP_000195318.1.59094 WP_000195318.1.59097 WP_000195318.1.59125 WP_000195318.1.59136 WP_000195318.1.59142 WP_000195318.1.59163 WP_000195318.1.59224 WP_000195318.1.59236 WP_000195318.1.59276 WP_000195318.1.59282 WP_000195318.1.5929 WP_000195318.1.59294 WP_000195318.1.59295 WP_000195318.1.59299 WP_000195318.1.59313 WP_000195318.1.59335 WP_000195318.1.59375 WP_000195318.1.59412 WP_000195318.1.59420 WP_000195318.1.59427 WP_000195318.1.59439 WP_000195318.1.59458 WP_000195318.1.59486 WP_000195318.1.5949 WP_000195318.1.59490 WP_000195318.1.59501 WP_000195318.1.59508 WP_000195318.1.59510 WP_000195318.1.59512 WP_000195318.1.59521 WP_000195318.1.5953 WP_000195318.1.59538 WP_000195318.1.59548 WP_000195318.1.59587 WP_000195318.1.59604 WP_000195318.1.59636 WP_000195318.1.59646 WP_000195318.1.59684 WP_000195318.1.5969 WP_000195318.1.59694 WP_000195318.1.59709 WP_000195318.1.59755 WP_000195318.1.59771 WP_000195318.1.5979 WP_000195318.1.59827 WP_000195318.1.59829 WP_000195318.1.59847 WP_000195318.1.59848 WP_000195318.1.59863 WP_000195318.1.59928 WP_000195318.1.59953 WP_000195318.1.59969 WP_000195318.1.59979 WP_000195318.1.59994 WP_000195318.1.60008 WP_000195318.1.60015 WP_000195318.1.60021 WP_000195318.1.60045 WP_000195318.1.60076 WP_000195318.1.60114 WP_000195318.1.60126 WP_000195318.1.60137 WP_000195318.1.60140 WP_000195318.1.60154 WP_000195318.1.60155 WP_000195318.1.60168 WP_000195318.1.60199 WP_000195318.1.60209 WP_000195318.1.60212 WP_000195318.1.60213 WP_000195318.1.60226 WP_000195318.1.60231 WP_000195318.1.60285 WP_000195318.1.60320 WP_000195318.1.60322 WP_000195318.1.60324 WP_000195318.1.6033 WP_000195318.1.60330 WP_000195318.1.60356 WP_000195318.1.60370 WP_000195318.1.60379 WP_000195318.1.6038 WP_000195318.1.60380 WP_000195318.1.6041 WP_000195318.1.60424 WP_000195318.1.60425 WP_000195318.1.60464 WP_000195318.1.60469 WP_000195318.1.60486 WP_000195318.1.60503 WP_000195318.1.6052 WP_000195318.1.60545 WP_000195318.1.60560 WP_000195318.1.60561 WP_000195318.1.6058 WP_000195318.1.60584 WP_000195318.1.60597 WP_000195318.1.6060 WP_000195318.1.60608 WP_000195318.1.60622 WP_000195318.1.60643 WP_000195318.1.60676 WP_000195318.1.60708 WP_000195318.1.60713 WP_000195318.1.60760 WP_000195318.1.60772 WP_000195318.1.60783 WP_000195318.1.60794 WP_000195318.1.608 WP_000195318.1.60807 WP_000195318.1.60809 WP_000195318.1.60838 WP_000195318.1.60855 WP_000195318.1.60857 WP_000195318.1.6086 WP_000195318.1.60863 WP_000195318.1.60866 WP_000195318.1.60874 WP_000195318.1.60882 WP_000195318.1.60897 WP_000195318.1.6090 WP_000195318.1.60926 WP_000195318.1.60941 WP_000195318.1.60950 WP_000195318.1.60976 WP_000195318.1.60990 WP_000195318.1.6104 WP_000195318.1.61044 WP_000195318.1.61045 WP_000195318.1.61076 WP_000195318.1.6108 WP_000195318.1.61087 WP_000195318.1.61114 WP_000195318.1.61123 WP_000195318.1.6114 WP_000195318.1.61146 WP_000195318.1.61168 WP_000195318.1.61184 WP_000195318.1.61200 WP_000195318.1.61210 WP_000195318.1.61218 WP_000195318.1.61232 WP_000195318.1.61233 WP_000195318.1.6129 WP_000195318.1.61296 WP_000195318.1.61309 WP_000195318.1.61345 WP_000195318.1.61356 WP_000195318.1.61357 WP_000195318.1.61381 WP_000195318.1.61417 WP_000195318.1.61497 WP_000195318.1.61501 WP_000195318.1.61509 WP_000195318.1.61519 WP_000195318.1.61539 WP_000195318.1.61542 WP_000195318.1.61553 WP_000195318.1.61574 WP_000195318.1.61582 WP_000195318.1.61594 WP_000195318.1.61595 WP_000195318.1.61609 WP_000195318.1.61649 WP_000195318.1.61652 WP_000195318.1.61662 WP_000195318.1.61667 WP_000195318.1.61671 WP_000195318.1.61694 WP_000195318.1.61712 WP_000195318.1.61730 WP_000195318.1.61732 WP_000195318.1.61737 WP_000195318.1.61743 WP_000195318.1.61783 WP_000195318.1.61809 WP_000195318.1.61857 WP_000195318.1.61877 WP_000195318.1.6190 WP_000195318.1.61908 WP_000195318.1.61918 WP_000195318.1.61922 WP_000195318.1.61952 WP_000195318.1.61968 WP_000195318.1.62007 WP_000195318.1.62020 WP_000195318.1.62025 WP_000195318.1.62063 WP_000195318.1.62076 WP_000195318.1.6209 WP_000195318.1.6210 WP_000195318.1.62108 WP_000195318.1.62120 WP_000195318.1.62122 WP_000195318.1.62124 WP_000195318.1.62142 WP_000195318.1.62144 WP_000195318.1.62158 WP_000195318.1.62195 WP_000195318.1.62199 WP_000195318.1.62201 WP_000195318.1.62204 WP_000195318.1.62210 WP_000195318.1.62219 WP_000195318.1.62222 WP_000195318.1.62223 WP_000195318.1.62241 WP_000195318.1.62245 WP_000195318.1.62257 WP_000195318.1.62271 WP_000195318.1.62302 WP_000195318.1.62304 WP_000195318.1.62310 WP_000195318.1.62323 WP_000195318.1.62333 WP_000195318.1.62338 WP_000195318.1.62339 WP_000195318.1.62344 WP_000195318.1.62361 WP_000195318.1.62364 WP_000195318.1.62374 WP_000195318.1.62380 WP_000195318.1.62403 WP_000195318.1.62411 WP_000195318.1.62412 WP_000195318.1.62436 WP_000195318.1.62486 WP_000195318.1.62488 WP_000195318.1.62522 WP_000195318.1.6253 WP_000195318.1.62536 WP_000195318.1.62564 WP_000195318.1.62570 WP_000195318.1.62619 WP_000195318.1.62648 WP_000195318.1.62677 WP_000195318.1.62686 WP_000195318.1.62693 WP_000195318.1.627 WP_000195318.1.62725 WP_000195318.1.62745 WP_000195318.1.62751 WP_000195318.1.62757 WP_000195318.1.62798 WP_000195318.1.62825 WP_000195318.1.62828 WP_000195318.1.62853 WP_000195318.1.62903 WP_000195318.1.62910 WP_000195318.1.62913 WP_000195318.1.6292 WP_000195318.1.62932 WP_000195318.1.62955 WP_000195318.1.62960 WP_000195318.1.62976 WP_000195318.1.62983 WP_000195318.1.62988 WP_000195318.1.63016 WP_000195318.1.63025 WP_000195318.1.63043 WP_000195318.1.63045 WP_000195318.1.63063 WP_000195318.1.63069 WP_000195318.1.63087 WP_000195318.1.63102 WP_000195318.1.63118 WP_000195318.1.63129 WP_000195318.1.63135 WP_000195318.1.63169 WP_000195318.1.63181 WP_000195318.1.63186 WP_000195318.1.63203 WP_000195318.1.63229 WP_000195318.1.63234 WP_000195318.1.63243 WP_000195318.1.63250 WP_000195318.1.63256 WP_000195318.1.63290 WP_000195318.1.63297 WP_000195318.1.63358 WP_000195318.1.63382 WP_000195318.1.63432 WP_000195318.1.63448 WP_000195318.1.63455 WP_000195318.1.63461 WP_000195318.1.63479 WP_000195318.1.63497 WP_000195318.1.63499 WP_000195318.1.63509 WP_000195318.1.63513 WP_000195318.1.63514 WP_000195318.1.63525 WP_000195318.1.63529 WP_000195318.1.63532 WP_000195318.1.6357 WP_000195318.1.63577 WP_000195318.1.63583 WP_000195318.1.63585 WP_000195318.1.63592 WP_000195318.1.63603 WP_000195318.1.63663 WP_000195318.1.63664 WP_000195318.1.6367 WP_000195318.1.63677 WP_000195318.1.63690 WP_000195318.1.6370 WP_000195318.1.63718 WP_000195318.1.63731 WP_000195318.1.63736 WP_000195318.1.63748 WP_000195318.1.6375 WP_000195318.1.63757 WP_000195318.1.63766 WP_000195318.1.63781 WP_000195318.1.63782 WP_000195318.1.63797 WP_000195318.1.63816 WP_000195318.1.63824 WP_000195318.1.63831 WP_000195318.1.63834 WP_000195318.1.63851 WP_000195318.1.63860 WP_000195318.1.63863 WP_000195318.1.63864 WP_000195318.1.63866 WP_000195318.1.63876 WP_000195318.1.6389 WP_000195318.1.63901 WP_000195318.1.63903 WP_000195318.1.63912 WP_000195318.1.63955 WP_000195318.1.63958 WP_000195318.1.63977 WP_000195318.1.6399 WP_000195318.1.63992 WP_000195318.1.64010 WP_000195318.1.64018 WP_000195318.1.64034 WP_000195318.1.64046 WP_000195318.1.64072 WP_000195318.1.64085 WP_000195318.1.64087 WP_000195318.1.64109 WP_000195318.1.64121 WP_000195318.1.64157 WP_000195318.1.64208 WP_000195318.1.64217 WP_000195318.1.64229 WP_000195318.1.6423 WP_000195318.1.64242 WP_000195318.1.64244 WP_000195318.1.64266 WP_000195318.1.64293 WP_000195318.1.64294 WP_000195318.1.64332 WP_000195318.1.64350 WP_000195318.1.6437 WP_000195318.1.64374 WP_000195318.1.64385 WP_000195318.1.64387 WP_000195318.1.64389 WP_000195318.1.64403 WP_000195318.1.64462 WP_000195318.1.64471 WP_000195318.1.64500 WP_000195318.1.64501 WP_000195318.1.6451 WP_000195318.1.64538 WP_000195318.1.64569 WP_000195318.1.64597 WP_000195318.1.64632 WP_000195318.1.64645 WP_000195318.1.64648 WP_000195318.1.64649 WP_000195318.1.64654 WP_000195318.1.64662 WP_000195318.1.64663 WP_000195318.1.64667 WP_000195318.1.64674 WP_000195318.1.64690 WP_000195318.1.64702 WP_000195318.1.64709 WP_000195318.1.64710 WP_000195318.1.64711 WP_000195318.1.64757 WP_000195318.1.64758 WP_000195318.1.64763 WP_000195318.1.64771 WP_000195318.1.64781 WP_000195318.1.64798 WP_000195318.1.64817 WP_000195318.1.64831 WP_000195318.1.64847 WP_000195318.1.6487 WP_000195318.1.6489 WP_000195318.1.64891 WP_000195318.1.64894 WP_000195318.1.64919 WP_000195318.1.64920 WP_000195318.1.64944 WP_000195318.1.64977 WP_000195318.1.65011 WP_000195318.1.65018 WP_000195318.1.65022 WP_000195318.1.65028 WP_000195318.1.65052 WP_000195318.1.65075 WP_000195318.1.6514 WP_000195318.1.65163 WP_000195318.1.65168 WP_000195318.1.65171 WP_000195318.1.65172 WP_000195318.1.65185 WP_000195318.1.65191 WP_000195318.1.65200 WP_000195318.1.65211 WP_000195318.1.65218 WP_000195318.1.65226 WP_000195318.1.65238 WP_000195318.1.65248 WP_000195318.1.65249 WP_000195318.1.6525 WP_000195318.1.65269 WP_000195318.1.65295 WP_000195318.1.65348 WP_000195318.1.6535 WP_000195318.1.65357 WP_000195318.1.65363 WP_000195318.1.65394 WP_000195318.1.65437 WP_000195318.1.65459 WP_000195318.1.65463 WP_000195318.1.65474 WP_000195318.1.65475 WP_000195318.1.65487 WP_000195318.1.6549 WP_000195318.1.65499 WP_000195318.1.6550 WP_000195318.1.65508 WP_000195318.1.65538 WP_000195318.1.6554 WP_000195318.1.65558 WP_000195318.1.65572 WP_000195318.1.6560 WP_000195318.1.65601 WP_000195318.1.6561 WP_000195318.1.65633 WP_000195318.1.6565 WP_000195318.1.65650 WP_000195318.1.65687 WP_000195318.1.65696 WP_000195318.1.65697 WP_000195318.1.65698 WP_000195318.1.65699 WP_000195318.1.6572 WP_000195318.1.65737 WP_000195318.1.6575 WP_000195318.1.65755 WP_000195318.1.65771 WP_000195318.1.65782 WP_000195318.1.65790 WP_000195318.1.65795 WP_000195318.1.65818 WP_000195318.1.65838 WP_000195318.1.65846 WP_000195318.1.65849 WP_000195318.1.65863 WP_000195318.1.65876 WP_000195318.1.65881 WP_000195318.1.65883 WP_000195318.1.65901 WP_000195318.1.6594 WP_000195318.1.65940 WP_000195318.1.6595 WP_000195318.1.65956 WP_000195318.1.65968 WP_000195318.1.65985 WP_000195318.1.66021 WP_000195318.1.66049 WP_000195318.1.66052 WP_000195318.1.66074 WP_000195318.1.66082 WP_000195318.1.66109 WP_000195318.1.66122 WP_000195318.1.66129 WP_000195318.1.66167 WP_000195318.1.66171 WP_000195318.1.66183 WP_000195318.1.6620 WP_000195318.1.66216 WP_000195318.1.66234 WP_000195318.1.66235 WP_000195318.1.66250 WP_000195318.1.66270 WP_000195318.1.66272 WP_000195318.1.66273 WP_000195318.1.66289 WP_000195318.1.6630 WP_000195318.1.66314 WP_000195318.1.66315 WP_000195318.1.66324 WP_000195318.1.66330 WP_000195318.1.6634 WP_000195318.1.66358 WP_000195318.1.66361 WP_000195318.1.66362 WP_000195318.1.66365 WP_000195318.1.66368 WP_000195318.1.6638 WP_000195318.1.66385 WP_000195318.1.6640 WP_000195318.1.66400 WP_000195318.1.66428 WP_000195318.1.66446 WP_000195318.1.66462 WP_000195318.1.66480 WP_000195318.1.66492 WP_000195318.1.66506 WP_000195318.1.66534 WP_000195318.1.66539 WP_000195318.1.66600 WP_000195318.1.66630 WP_000195318.1.66665 WP_000195318.1.66678 WP_000195318.1.66684 WP_000195318.1.66698 WP_000195318.1.66702 WP_000195318.1.66733 WP_000195318.1.66755 WP_000195318.1.66759 WP_000195318.1.66779 WP_000195318.1.6680 WP_000195318.1.66800 WP_000195318.1.66801 WP_000195318.1.66824 WP_000195318.1.66825 WP_000195318.1.66834 WP_000195318.1.66860 WP_000195318.1.66876 WP_000195318.1.66901 WP_000195318.1.66937 WP_000195318.1.66955 WP_000195318.1.66959 WP_000195318.1.66962 WP_000195318.1.66981 WP_000195318.1.67 WP_000195318.1.67024 WP_000195318.1.67037 WP_000195318.1.67042 WP_000195318.1.67045 WP_000195318.1.67075 WP_000195318.1.6710 WP_000195318.1.67100 WP_000195318.1.67143 WP_000195318.1.67173 WP_000195318.1.67175 WP_000195318.1.67181 WP_000195318.1.67184 WP_000195318.1.67201 WP_000195318.1.67228 WP_000195318.1.67235 WP_000195318.1.67237 WP_000195318.1.67268 WP_000195318.1.67279 WP_000195318.1.67336 WP_000195318.1.67339 WP_000195318.1.67347 WP_000195318.1.67374 WP_000195318.1.67387 WP_000195318.1.6739 WP_000195318.1.67394 WP_000195318.1.67403 WP_000195318.1.67405 WP_000195318.1.67424 WP_000195318.1.67430 WP_000195318.1.67442 WP_000195318.1.67465 WP_000195318.1.67539 WP_000195318.1.67552 WP_000195318.1.67556 WP_000195318.1.67576 WP_000195318.1.6760 WP_000195318.1.67603 WP_000195318.1.67604 WP_000195318.1.67617 WP_000195318.1.67619 WP_000195318.1.67627 WP_000195318.1.67633 WP_000195318.1.67637 WP_000195318.1.67657 WP_000195318.1.67673 WP_000195318.1.67682 WP_000195318.1.67705 WP_000195318.1.67707 WP_000195318.1.67718 WP_000195318.1.67731 WP_000195318.1.67772 WP_000195318.1.67776 WP_000195318.1.67803 WP_000195318.1.67814 WP_000195318.1.6782 WP_000195318.1.67820 WP_000195318.1.67825 WP_000195318.1.67827 WP_000195318.1.67829 WP_000195318.1.6785 WP_000195318.1.67887 WP_000195318.1.67905 WP_000195318.1.67910 WP_000195318.1.67924 WP_000195318.1.67932 WP_000195318.1.67942 WP_000195318.1.67969 WP_000195318.1.67970 WP_000195318.1.67977 WP_000195318.1.68036 WP_000195318.1.68043 WP_000195318.1.68073 WP_000195318.1.6809 WP_000195318.1.68105 WP_000195318.1.68113 WP_000195318.1.68115 WP_000195318.1.68131 WP_000195318.1.68140 WP_000195318.1.68147 WP_000195318.1.68159 WP_000195318.1.68167 WP_000195318.1.68182 WP_000195318.1.6819 WP_000195318.1.68201 WP_000195318.1.68206 WP_000195318.1.68210 WP_000195318.1.6827 WP_000195318.1.68275 WP_000195318.1.68285 WP_000195318.1.6833 WP_000195318.1.68359 WP_000195318.1.68401 WP_000195318.1.68420 WP_000195318.1.68477 WP_000195318.1.68478 WP_000195318.1.6849 WP_000195318.1.685 WP_000195318.1.68514 WP_000195318.1.68547 WP_000195318.1.68564 WP_000195318.1.6857 WP_000195318.1.68589 WP_000195318.1.68591 WP_000195318.1.68629 WP_000195318.1.68652 WP_000195318.1.68655 WP_000195318.1.68656 WP_000195318.1.68658 WP_000195318.1.68677 WP_000195318.1.68688 WP_000195318.1.6869 WP_000195318.1.68690 WP_000195318.1.6875 WP_000195318.1.68770 WP_000195318.1.68778 WP_000195318.1.68787 WP_000195318.1.6879 WP_000195318.1.68809 WP_000195318.1.68816 WP_000195318.1.68818 WP_000195318.1.6882 WP_000195318.1.6883 WP_000195318.1.68893 WP_000195318.1.68894 WP_000195318.1.68895 WP_000195318.1.68914 WP_000195318.1.68928 WP_000195318.1.68958 WP_000195318.1.68966 WP_000195318.1.68975 WP_000195318.1.68999 WP_000195318.1.69001 WP_000195318.1.69006 WP_000195318.1.69011 WP_000195318.1.69029 WP_000195318.1.6904 WP_000195318.1.6905 WP_000195318.1.69053 WP_000195318.1.69058 WP_000195318.1.6907 WP_000195318.1.69080 WP_000195318.1.69086 WP_000195318.1.6913 WP_000195318.1.69131 WP_000195318.1.69139 WP_000195318.1.69146 WP_000195318.1.69151 WP_000195318.1.69170 WP_000195318.1.69210 WP_000195318.1.69236 WP_000195318.1.69255 WP_000195318.1.69270 WP_000195318.1.69273 WP_000195318.1.69282 WP_000195318.1.69288 WP_000195318.1.69296 WP_000195318.1.69320 WP_000195318.1.69346 WP_000195318.1.69357 WP_000195318.1.69359 WP_000195318.1.69371 WP_000195318.1.69376 WP_000195318.1.69396 WP_000195318.1.69397 WP_000195318.1.69433 WP_000195318.1.69465 WP_000195318.1.69466 WP_000195318.1.69485 WP_000195318.1.69515 WP_000195318.1.6954 WP_000195318.1.69554 WP_000195318.1.69564 WP_000195318.1.69575 WP_000195318.1.69588 WP_000195318.1.69592 WP_000195318.1.69597 WP_000195318.1.69611 WP_000195318.1.69616 WP_000195318.1.69644 WP_000195318.1.69656 WP_000195318.1.69657 WP_000195318.1.69690 WP_000195318.1.69696 WP_000195318.1.69704 WP_000195318.1.69710 WP_000195318.1.69758 WP_000195318.1.69760 WP_000195318.1.69767 WP_000195318.1.69785 WP_000195318.1.69787 WP_000195318.1.69790 WP_000195318.1.69807 WP_000195318.1.69808 WP_000195318.1.69817 WP_000195318.1.69839 WP_000195318.1.69848 WP_000195318.1.69948 WP_000195318.1.69953 WP_000195318.1.69965 WP_000195318.1.69975 WP_000195318.1.69977 WP_000195318.1.69982 WP_000195318.1.70003 WP_000195318.1.70010 WP_000195318.1.70028 WP_000195318.1.70047 WP_000195318.1.70049 WP_000195318.1.70058 WP_000195318.1.70087 WP_000195318.1.70088 WP_000195318.1.7010 WP_000195318.1.7014 WP_000195318.1.7016 WP_000195318.1.70169 WP_000195318.1.70183 WP_000195318.1.70205 WP_000195318.1.7021 WP_000195318.1.70241 WP_000195318.1.70261 WP_000195318.1.70269 WP_000195318.1.70272 WP_000195318.1.70281 WP_000195318.1.70289 WP_000195318.1.70303 WP_000195318.1.70314 WP_000195318.1.70326 WP_000195318.1.70327 WP_000195318.1.7033 WP_000195318.1.70355 WP_000195318.1.70427 WP_000195318.1.7044 WP_000195318.1.70440 WP_000195318.1.70447 WP_000195318.1.70485 WP_000195318.1.70488 WP_000195318.1.70491 WP_000195318.1.70523 WP_000195318.1.70531 WP_000195318.1.70547 WP_000195318.1.7055 WP_000195318.1.70580 WP_000195318.1.70596 WP_000195318.1.7060 WP_000195318.1.70623 WP_000195318.1.70643 WP_000195318.1.70644 WP_000195318.1.70662 WP_000195318.1.70671 WP_000195318.1.70678 WP_000195318.1.70679 WP_000195318.1.70683 WP_000195318.1.70685 WP_000195318.1.70708 WP_000195318.1.70712 WP_000195318.1.70717 WP_000195318.1.70731 WP_000195318.1.70732 WP_000195318.1.70733 WP_000195318.1.70761 WP_000195318.1.70785 WP_000195318.1.70792 WP_000195318.1.70797 WP_000195318.1.70837 WP_000195318.1.70845 WP_000195318.1.70846 WP_000195318.1.70869 WP_000195318.1.70883 WP_000195318.1.70899 WP_000195318.1.70914 WP_000195318.1.70922 WP_000195318.1.70929 WP_000195318.1.7093 WP_000195318.1.70948 WP_000195318.1.70959 WP_000195318.1.70969 WP_000195318.1.70971 WP_000195318.1.70977 WP_000195318.1.70981 WP_000195318.1.70985 WP_000195318.1.70986 WP_000195318.1.70995 WP_000195318.1.71007 WP_000195318.1.71010 WP_000195318.1.71023 WP_000195318.1.71057 WP_000195318.1.71069 WP_000195318.1.71088 WP_000195318.1.71120 WP_000195318.1.71146 WP_000195318.1.71150 WP_000195318.1.71165 WP_000195318.1.71172 WP_000195318.1.71184 WP_000195318.1.71186 WP_000195318.1.71188 WP_000195318.1.71201 WP_000195318.1.71202 WP_000195318.1.71243 WP_000195318.1.71248 WP_000195318.1.71268 WP_000195318.1.71305 WP_000195318.1.71306 WP_000195318.1.71337 WP_000195318.1.7134 WP_000195318.1.71363 WP_000195318.1.71368 WP_000195318.1.71378 WP_000195318.1.714 WP_000195318.1.71401 WP_000195318.1.71407 WP_000195318.1.71418 WP_000195318.1.7142 WP_000195318.1.71450 WP_000195318.1.71452 WP_000195318.1.71455 WP_000195318.1.71456 WP_000195318.1.71481 WP_000195318.1.71523 WP_000195318.1.71542 WP_000195318.1.71566 WP_000195318.1.71583 WP_000195318.1.71600 WP_000195318.1.71626 WP_000195318.1.71636 WP_000195318.1.71649 WP_000195318.1.71656 WP_000195318.1.71667 WP_000195318.1.71691 WP_000195318.1.71702 WP_000195318.1.71746 WP_000195318.1.71750 WP_000195318.1.71798 WP_000195318.1.71845 WP_000195318.1.71848 WP_000195318.1.71872 WP_000195318.1.71881 WP_000195318.1.71908 WP_000195318.1.71923 WP_000195318.1.71929 WP_000195318.1.71941 WP_000195318.1.71950 WP_000195318.1.71952 WP_000195318.1.71954 WP_000195318.1.71973 WP_000195318.1.71979 WP_000195318.1.71984 WP_000195318.1.71985 WP_000195318.1.720 WP_000195318.1.72003 WP_000195318.1.72065 WP_000195318.1.72068 WP_000195318.1.72073 WP_000195318.1.72100 WP_000195318.1.72105 WP_000195318.1.72107 WP_000195318.1.72119 WP_000195318.1.72121 WP_000195318.1.72182 WP_000195318.1.72188 WP_000195318.1.72190 WP_000195318.1.72203 WP_000195318.1.72220 WP_000195318.1.72221 WP_000195318.1.72234 WP_000195318.1.72243 WP_000195318.1.72254 WP_000195318.1.72269 WP_000195318.1.72277 WP_000195318.1.72281 WP_000195318.1.72283 WP_000195318.1.72300 WP_000195318.1.72307 WP_000195318.1.72325 WP_000195318.1.72339 WP_000195318.1.72350 WP_000195318.1.72351 WP_000195318.1.72372 WP_000195318.1.72376 WP_000195318.1.72382 WP_000195318.1.72383 WP_000195318.1.72403 WP_000195318.1.72412 WP_000195318.1.7243 WP_000195318.1.72438 WP_000195318.1.72461 WP_000195318.1.72470 WP_000195318.1.72527 WP_000195318.1.72532 WP_000195318.1.7255 WP_000195318.1.72594 WP_000195318.1.72602 WP_000195318.1.72625 WP_000195318.1.72629 WP_000195318.1.72631 WP_000195318.1.72638 WP_000195318.1.72642 WP_000195318.1.72667 WP_000195318.1.72671 WP_000195318.1.72674 WP_000195318.1.72716 WP_000195318.1.72718 WP_000195318.1.72724 WP_000195318.1.72728 WP_000195318.1.72789 WP_000195318.1.72793 WP_000195318.1.72797 WP_000195318.1.72827 WP_000195318.1.72828 WP_000195318.1.72843 WP_000195318.1.72850 WP_000195318.1.72865 WP_000195318.1.72871 WP_000195318.1.72872 WP_000195318.1.72887 WP_000195318.1.72892 WP_000195318.1.72894 WP_000195318.1.72896 WP_000195318.1.72897 WP_000195318.1.72944 WP_000195318.1.72946 WP_000195318.1.7295 WP_000195318.1.72968 WP_000195318.1.72975 WP_000195318.1.72987 WP_000195318.1.7304 WP_000195318.1.73052 WP_000195318.1.73062 WP_000195318.1.73068 WP_000195318.1.73102 WP_000195318.1.7311 WP_000195318.1.73114 WP_000195318.1.73125 WP_000195318.1.73144 WP_000195318.1.7315 WP_000195318.1.73164 WP_000195318.1.73177 WP_000195318.1.73180 WP_000195318.1.73200 WP_000195318.1.73258 WP_000195318.1.73285 WP_000195318.1.7332 WP_000195318.1.73328 WP_000195318.1.7333 WP_000195318.1.7334 WP_000195318.1.73362 WP_000195318.1.73377 WP_000195318.1.73379 WP_000195318.1.73389 WP_000195318.1.7341 WP_000195318.1.73425 WP_000195318.1.73461 WP_000195318.1.73481 WP_000195318.1.73488 WP_000195318.1.73512 WP_000195318.1.73535 WP_000195318.1.73544 WP_000195318.1.7356 WP_000195318.1.73561 WP_000195318.1.73581 WP_000195318.1.73596 WP_000195318.1.73598 WP_000195318.1.7361 WP_000195318.1.73617 WP_000195318.1.73648 WP_000195318.1.73667 WP_000195318.1.73669 WP_000195318.1.73701 WP_000195318.1.73708 WP_000195318.1.7374 WP_000195318.1.73753 WP_000195318.1.73758 WP_000195318.1.73764 WP_000195318.1.73768 WP_000195318.1.73794 WP_000195318.1.73804 WP_000195318.1.73847 WP_000195318.1.7386 WP_000195318.1.7387 WP_000195318.1.73901 WP_000195318.1.73924 WP_000195318.1.73926 WP_000195318.1.7394 WP_000195318.1.73945 WP_000195318.1.73948 WP_000195318.1.73956 WP_000195318.1.73958 WP_000195318.1.73965 WP_000195318.1.73999 WP_000195318.1.74024 WP_000195318.1.74028 WP_000195318.1.74029 WP_000195318.1.74040 WP_000195318.1.74043 WP_000195318.1.7405 WP_000195318.1.74058 WP_000195318.1.74089 WP_000195318.1.74117 WP_000195318.1.74135 WP_000195318.1.74174 WP_000195318.1.74181 WP_000195318.1.74191 WP_000195318.1.74207 WP_000195318.1.74214 WP_000195318.1.74241 WP_000195318.1.74248 WP_000195318.1.74285 WP_000195318.1.743 WP_000195318.1.7430 WP_000195318.1.74300 WP_000195318.1.74317 WP_000195318.1.7433 WP_000195318.1.74379 WP_000195318.1.74410 WP_000195318.1.74414 WP_000195318.1.74415 WP_000195318.1.74418 WP_000195318.1.74422 WP_000195318.1.74428 WP_000195318.1.7444 WP_000195318.1.74454 WP_000195318.1.74466 WP_000195318.1.74469 WP_000195318.1.74481 WP_000195318.1.745 WP_000195318.1.74500 WP_000195318.1.74529 WP_000195318.1.74545 WP_000195318.1.74570 WP_000195318.1.74578 WP_000195318.1.7458 WP_000195318.1.74616 WP_000195318.1.74620 WP_000195318.1.74632 WP_000195318.1.74639 WP_000195318.1.74644 WP_000195318.1.74661 WP_000195318.1.74677 WP_000195318.1.74699 WP_000195318.1.74702 WP_000195318.1.74741 WP_000195318.1.74745 WP_000195318.1.74757 WP_000195318.1.74806 WP_000195318.1.74807 WP_000195318.1.74826 WP_000195318.1.74831 WP_000195318.1.74876 WP_000195318.1.74884 WP_000195318.1.7491 WP_000195318.1.74929 WP_000195318.1.74939 WP_000195318.1.74946 WP_000195318.1.74972 WP_000195318.1.74973 WP_000195318.1.74992 WP_000195318.1.74996 WP_000195318.1.75009 WP_000195318.1.75051 WP_000195318.1.75056 WP_000195318.1.75058 WP_000195318.1.75089 WP_000195318.1.75114 WP_000195318.1.75129 WP_000195318.1.75134 WP_000195318.1.75148 WP_000195318.1.75159 WP_000195318.1.75168 WP_000195318.1.75177 WP_000195318.1.75180 WP_000195318.1.75187 WP_000195318.1.75237 WP_000195318.1.75273 WP_000195318.1.75288 WP_000195318.1.75301 WP_000195318.1.7531 WP_000195318.1.75334 WP_000195318.1.75362 WP_000195318.1.75371 WP_000195318.1.75385 WP_000195318.1.75392 WP_000195318.1.75400 WP_000195318.1.75413 WP_000195318.1.75450 WP_000195318.1.75532 WP_000195318.1.7558 WP_000195318.1.75593 WP_000195318.1.75607 WP_000195318.1.75609 WP_000195318.1.75610 WP_000195318.1.75633 WP_000195318.1.75664 WP_000195318.1.75703 WP_000195318.1.75716 WP_000195318.1.75740 WP_000195318.1.75751 WP_000195318.1.75760 WP_000195318.1.75764 WP_000195318.1.75793 WP_000195318.1.75794 WP_000195318.1.75810 WP_000195318.1.75828 WP_000195318.1.75837 WP_000195318.1.75844 WP_000195318.1.75863 WP_000195318.1.75874 WP_000195318.1.75884 WP_000195318.1.75886 WP_000195318.1.75898 WP_000195318.1.75902 WP_000195318.1.75932 WP_000195318.1.75945 WP_000195318.1.75957 WP_000195318.1.76 WP_000195318.1.76020 WP_000195318.1.76024 WP_000195318.1.76055 WP_000195318.1.76081 WP_000195318.1.76102 WP_000195318.1.76108 WP_000195318.1.76115 WP_000195318.1.76122 WP_000195318.1.76137 WP_000195318.1.76156 WP_000195318.1.76162 WP_000195318.1.76164 WP_000195318.1.76170 WP_000195318.1.76186 WP_000195318.1.76197 WP_000195318.1.76208 WP_000195318.1.76252 WP_000195318.1.76256 WP_000195318.1.7629 WP_000195318.1.76301 WP_000195318.1.76327 WP_000195318.1.7633 WP_000195318.1.76339 WP_000195318.1.76345 WP_000195318.1.76366 WP_000195318.1.76417 WP_000195318.1.76434 WP_000195318.1.76445 WP_000195318.1.76451 WP_000195318.1.7646 WP_000195318.1.76471 WP_000195318.1.76495 WP_000195318.1.76510 WP_000195318.1.76532 WP_000195318.1.76548 WP_000195318.1.7655 WP_000195318.1.76558 WP_000195318.1.7657 WP_000195318.1.76572 WP_000195318.1.76576 WP_000195318.1.7660 WP_000195318.1.76611 WP_000195318.1.76641 WP_000195318.1.76651 WP_000195318.1.76653 WP_000195318.1.76673 WP_000195318.1.76706 WP_000195318.1.7672 WP_000195318.1.76721 WP_000195318.1.76724 WP_000195318.1.76738 WP_000195318.1.76756 WP_000195318.1.76760 WP_000195318.1.76776 WP_000195318.1.76799 WP_000195318.1.7684 WP_000195318.1.76854 WP_000195318.1.76866 WP_000195318.1.76875 WP_000195318.1.76880 WP_000195318.1.76899 WP_000195318.1.76913 WP_000195318.1.76916 WP_000195318.1.76968 WP_000195318.1.76973 WP_000195318.1.76988 WP_000195318.1.77017 WP_000195318.1.77033 WP_000195318.1.77038 WP_000195318.1.77047 WP_000195318.1.77067 WP_000195318.1.77080 WP_000195318.1.77087 WP_000195318.1.77111 WP_000195318.1.7712 WP_000195318.1.77177 WP_000195318.1.77180 WP_000195318.1.77184 WP_000195318.1.77193 WP_000195318.1.77241 WP_000195318.1.77244 WP_000195318.1.77267 WP_000195318.1.77271 WP_000195318.1.77292 WP_000195318.1.77299 WP_000195318.1.77306 WP_000195318.1.77349 WP_000195318.1.77356 WP_000195318.1.77384 WP_000195318.1.77390 WP_000195318.1.77414 WP_000195318.1.77431 WP_000195318.1.77436 WP_000195318.1.77440 WP_000195318.1.77475 WP_000195318.1.77496 WP_000195318.1.77501 WP_000195318.1.77512 WP_000195318.1.77514 WP_000195318.1.77529 WP_000195318.1.77543 WP_000195318.1.77549 WP_000195318.1.77555 WP_000195318.1.77575 WP_000195318.1.77596 WP_000195318.1.77629 WP_000195318.1.77653 WP_000195318.1.77692 WP_000195318.1.77702 WP_000195318.1.77710 WP_000195318.1.77713 WP_000195318.1.7772 WP_000195318.1.77729 WP_000195318.1.77754 WP_000195318.1.77761 WP_000195318.1.7782 WP_000195318.1.77825 WP_000195318.1.77837 WP_000195318.1.7784 WP_000195318.1.77846 WP_000195318.1.77851 WP_000195318.1.77871 WP_000195318.1.77898 WP_000195318.1.77918 WP_000195318.1.7792 WP_000195318.1.77923 WP_000195318.1.7793 WP_000195318.1.77951 WP_000195318.1.77960 WP_000195318.1.77971 WP_000195318.1.77983 WP_000195318.1.77989 WP_000195318.1.78 WP_000195318.1.78016 WP_000195318.1.7802 WP_000195318.1.78033 WP_000195318.1.78051 WP_000195318.1.78053 WP_000195318.1.78076 WP_000195318.1.78096 WP_000195318.1.78100 WP_000195318.1.78110 WP_000195318.1.78120 WP_000195318.1.7814 WP_000195318.1.78168 WP_000195318.1.78170 WP_000195318.1.78180 WP_000195318.1.78192 WP_000195318.1.78195 WP_000195318.1.78245 WP_000195318.1.78259 WP_000195318.1.78291 WP_000195318.1.78301 WP_000195318.1.78320 WP_000195318.1.78352 WP_000195318.1.78366 WP_000195318.1.78372 WP_000195318.1.78382 WP_000195318.1.78383 WP_000195318.1.78388 WP_000195318.1.78407 WP_000195318.1.78410 WP_000195318.1.78443 WP_000195318.1.78501 WP_000195318.1.78502 WP_000195318.1.78602 WP_000195318.1.78603 WP_000195318.1.7861 WP_000195318.1.78618 WP_000195318.1.7862 WP_000195318.1.78626 WP_000195318.1.78632 WP_000195318.1.78658 WP_000195318.1.78661 WP_000195318.1.78674 WP_000195318.1.78697 WP_000195318.1.78715 WP_000195318.1.78734 WP_000195318.1.78735 WP_000195318.1.78738 WP_000195318.1.78761 WP_000195318.1.7877 WP_000195318.1.78771 WP_000195318.1.78789 WP_000195318.1.78802 WP_000195318.1.78815 WP_000195318.1.78830 WP_000195318.1.78835 WP_000195318.1.78838 WP_000195318.1.78862 WP_000195318.1.78871 WP_000195318.1.78874 WP_000195318.1.78877 WP_000195318.1.78881 WP_000195318.1.78896 WP_000195318.1.789 WP_000195318.1.7891 WP_000195318.1.78918 WP_000195318.1.78928 WP_000195318.1.78930 WP_000195318.1.78951 WP_000195318.1.78959 WP_000195318.1.79011 WP_000195318.1.79032 WP_000195318.1.79069 WP_000195318.1.79074 WP_000195318.1.79081 WP_000195318.1.79098 WP_000195318.1.79099 WP_000195318.1.79140 WP_000195318.1.79151 WP_000195318.1.79155 WP_000195318.1.79164 WP_000195318.1.79167 WP_000195318.1.79189 WP_000195318.1.79203 WP_000195318.1.79204 WP_000195318.1.79235 WP_000195318.1.79280 WP_000195318.1.79289 WP_000195318.1.79297 WP_000195318.1.79302 WP_000195318.1.79335 WP_000195318.1.79370 WP_000195318.1.79397 WP_000195318.1.794 WP_000195318.1.79427 WP_000195318.1.79462 WP_000195318.1.79466 WP_000195318.1.79468 WP_000195318.1.79490 WP_000195318.1.79495 WP_000195318.1.79529 WP_000195318.1.79531 WP_000195318.1.79532 WP_000195318.1.79547 WP_000195318.1.79570 WP_000195318.1.79580 WP_000195318.1.79586 WP_000195318.1.7964 WP_000195318.1.79642 WP_000195318.1.79645 WP_000195318.1.79654 WP_000195318.1.79659 WP_000195318.1.79668 WP_000195318.1.7970 WP_000195318.1.79708 WP_000195318.1.7972 WP_000195318.1.79734 WP_000195318.1.79738 WP_000195318.1.79757 WP_000195318.1.79772 WP_000195318.1.79778 WP_000195318.1.7982 WP_000195318.1.79832 WP_000195318.1.79845 WP_000195318.1.79867 WP_000195318.1.79880 WP_000195318.1.79892 WP_000195318.1.7991 WP_000195318.1.79914 WP_000195318.1.79916 WP_000195318.1.79929 WP_000195318.1.79934 WP_000195318.1.7994 WP_000195318.1.79942 WP_000195318.1.79945 WP_000195318.1.79951 WP_000195318.1.79966 WP_000195318.1.79974 WP_000195318.1.79977 WP_000195318.1.79996 WP_000195318.1.80045 WP_000195318.1.80065 WP_000195318.1.80077 WP_000195318.1.80103 WP_000195318.1.80137 WP_000195318.1.80182 WP_000195318.1.80236 WP_000195318.1.8024 WP_000195318.1.80249 WP_000195318.1.80250 WP_000195318.1.80254 WP_000195318.1.80273 WP_000195318.1.80282 WP_000195318.1.80293 WP_000195318.1.80296 WP_000195318.1.80307 WP_000195318.1.80333 WP_000195318.1.80366 WP_000195318.1.80368 WP_000195318.1.80380 WP_000195318.1.80386 WP_000195318.1.80400 WP_000195318.1.80441 WP_000195318.1.80443 WP_000195318.1.80448 WP_000195318.1.80462 WP_000195318.1.80473 WP_000195318.1.80479 WP_000195318.1.8049 WP_000195318.1.80492 WP_000195318.1.80496 WP_000195318.1.80542 WP_000195318.1.80569 WP_000195318.1.80609 WP_000195318.1.80638 WP_000195318.1.80651 WP_000195318.1.80667 WP_000195318.1.80674 WP_000195318.1.80696 WP_000195318.1.80707 WP_000195318.1.80723 WP_000195318.1.80725 WP_000195318.1.80741 WP_000195318.1.80750 WP_000195318.1.80757 WP_000195318.1.80760 WP_000195318.1.80780 WP_000195318.1.80803 WP_000195318.1.80819 WP_000195318.1.80827 WP_000195318.1.80831 WP_000195318.1.80840 WP_000195318.1.80850 WP_000195318.1.80857 WP_000195318.1.80868 WP_000195318.1.80874 WP_000195318.1.80876 WP_000195318.1.80881 WP_000195318.1.80913 WP_000195318.1.80927 WP_000195318.1.80939 WP_000195318.1.8096 WP_000195318.1.80973 WP_000195318.1.80984 WP_000195318.1.81037 WP_000195318.1.81041 WP_000195318.1.8106 WP_000195318.1.81062 WP_000195318.1.81067 WP_000195318.1.81069 WP_000195318.1.81084 WP_000195318.1.81109 WP_000195318.1.81110 WP_000195318.1.81118 WP_000195318.1.81149 WP_000195318.1.81175 WP_000195318.1.81187 WP_000195318.1.8119 WP_000195318.1.81193 WP_000195318.1.81197 WP_000195318.1.81225 WP_000195318.1.81231 WP_000195318.1.81262 WP_000195318.1.81268 WP_000195318.1.81269 WP_000195318.1.8127 WP_000195318.1.81271 WP_000195318.1.81275 WP_000195318.1.8130 WP_000195318.1.81302 WP_000195318.1.81305 WP_000195318.1.8131 WP_000195318.1.81320 WP_000195318.1.81321 WP_000195318.1.81328 WP_000195318.1.8134 WP_000195318.1.81342 WP_000195318.1.81354 WP_000195318.1.81364 WP_000195318.1.81388 WP_000195318.1.81404 WP_000195318.1.81409 WP_000195318.1.81410 WP_000195318.1.81425 WP_000195318.1.81455 WP_000195318.1.81472 WP_000195318.1.81494 WP_000195318.1.81504 WP_000195318.1.81528 WP_000195318.1.81548 WP_000195318.1.81557 WP_000195318.1.81568 WP_000195318.1.81667 WP_000195318.1.81668 WP_000195318.1.81676 WP_000195318.1.8168 WP_000195318.1.81681 WP_000195318.1.8170 WP_000195318.1.81727 WP_000195318.1.81735 WP_000195318.1.81736 WP_000195318.1.81743 WP_000195318.1.81746 WP_000195318.1.81750 WP_000195318.1.81760 WP_000195318.1.81763 WP_000195318.1.81768 WP_000195318.1.81785 WP_000195318.1.81795 WP_000195318.1.81798 WP_000195318.1.81855 WP_000195318.1.81902 WP_000195318.1.81921 WP_000195318.1.81936 WP_000195318.1.81941 WP_000195318.1.81949 WP_000195318.1.8196 WP_000195318.1.81965 WP_000195318.1.81974 WP_000195318.1.81977 WP_000195318.1.81995 WP_000195318.1.82037 WP_000195318.1.82070 WP_000195318.1.82099 WP_000195318.1.82131 WP_000195318.1.82141 WP_000195318.1.82149 WP_000195318.1.82156 WP_000195318.1.8218 WP_000195318.1.82180 WP_000195318.1.82192 WP_000195318.1.82201 WP_000195318.1.82214 WP_000195318.1.82225 WP_000195318.1.82232 WP_000195318.1.82258 WP_000195318.1.82269 WP_000195318.1.82337 WP_000195318.1.82347 WP_000195318.1.82352 WP_000195318.1.8236 WP_000195318.1.82369 WP_000195318.1.82395 WP_000195318.1.82401 WP_000195318.1.82408 WP_000195318.1.82416 WP_000195318.1.82420 WP_000195318.1.82434 WP_000195318.1.82456 WP_000195318.1.82464 WP_000195318.1.82465 WP_000195318.1.8247 WP_000195318.1.82473 WP_000195318.1.82474 WP_000195318.1.82479 WP_000195318.1.82503 WP_000195318.1.82515 WP_000195318.1.82530 WP_000195318.1.82562 WP_000195318.1.82569 WP_000195318.1.82570 WP_000195318.1.82636 WP_000195318.1.82637 WP_000195318.1.82646 WP_000195318.1.82648 WP_000195318.1.82670 WP_000195318.1.82676 WP_000195318.1.82692 WP_000195318.1.82761 WP_000195318.1.82763 WP_000195318.1.82812 WP_000195318.1.8282 WP_000195318.1.82843 WP_000195318.1.82850 WP_000195318.1.82867 WP_000195318.1.82872 WP_000195318.1.82886 WP_000195318.1.82895 WP_000195318.1.82899 WP_000195318.1.82908 WP_000195318.1.82937 WP_000195318.1.8294 WP_000195318.1.82944 WP_000195318.1.82946 WP_000195318.1.82956 WP_000195318.1.82959 WP_000195318.1.82964 WP_000195318.1.82992 WP_000195318.1.83005 WP_000195318.1.83006 WP_000195318.1.83007 WP_000195318.1.8304 WP_000195318.1.83061 WP_000195318.1.83092 WP_000195318.1.83119 WP_000195318.1.83128 WP_000195318.1.83163 WP_000195318.1.83180 WP_000195318.1.83204 WP_000195318.1.8322 WP_000195318.1.83221 WP_000195318.1.83229 WP_000195318.1.83235 WP_000195318.1.83247 WP_000195318.1.83252 WP_000195318.1.83258 WP_000195318.1.83280 WP_000195318.1.83290 WP_000195318.1.83301 WP_000195318.1.83305 WP_000195318.1.83331 WP_000195318.1.83333 WP_000195318.1.83354 WP_000195318.1.83356 WP_000195318.1.83360 WP_000195318.1.83365 WP_000195318.1.83378 WP_000195318.1.83382 WP_000195318.1.83388 WP_000195318.1.83407 WP_000195318.1.83413 WP_000195318.1.83491 WP_000195318.1.83510 WP_000195318.1.83516 WP_000195318.1.83523 WP_000195318.1.8354 WP_000195318.1.83558 WP_000195318.1.83651 WP_000195318.1.83657 WP_000195318.1.83677 WP_000195318.1.83710 WP_000195318.1.83721 WP_000195318.1.83739 WP_000195318.1.8375 WP_000195318.1.83760 WP_000195318.1.83806 WP_000195318.1.83897 WP_000195318.1.8399 WP_000195318.1.83994 WP_000195318.1.83995 WP_000195318.1.84 WP_000195318.1.84000 WP_000195318.1.84001 WP_000195318.1.84011 WP_000195318.1.84075 WP_000195318.1.84076 WP_000195318.1.84077 WP_000195318.1.84083 WP_000195318.1.84086 WP_000195318.1.84100 WP_000195318.1.84103 WP_000195318.1.84106 WP_000195318.1.84110 WP_000195318.1.84115 WP_000195318.1.84127 WP_000195318.1.84150 WP_000195318.1.84154 WP_000195318.1.84168 WP_000195318.1.84198 WP_000195318.1.84205 WP_000195318.1.84209 WP_000195318.1.84229 WP_000195318.1.84230 WP_000195318.1.8425 WP_000195318.1.84252 WP_000195318.1.84283 WP_000195318.1.84291 WP_000195318.1.84300 WP_000195318.1.84325 WP_000195318.1.84345 WP_000195318.1.84359 WP_000195318.1.84369 WP_000195318.1.84373 WP_000195318.1.84392 WP_000195318.1.84397 WP_000195318.1.84403 WP_000195318.1.8441 WP_000195318.1.84459 WP_000195318.1.84461 WP_000195318.1.84475 WP_000195318.1.84497 WP_000195318.1.84515 WP_000195318.1.84523 WP_000195318.1.84532 WP_000195318.1.84551 WP_000195318.1.84554 WP_000195318.1.84572 WP_000195318.1.84598 WP_000195318.1.84631 WP_000195318.1.84644 WP_000195318.1.84659 WP_000195318.1.84683 WP_000195318.1.84693 WP_000195318.1.84711 WP_000195318.1.84721 WP_000195318.1.84727 WP_000195318.1.84744 WP_000195318.1.84745 WP_000195318.1.84814 WP_000195318.1.84872 WP_000195318.1.84876 WP_000195318.1.84879 WP_000195318.1.84899 WP_000195318.1.849 WP_000195318.1.84967 WP_000195318.1.8497 WP_000195318.1.84983 WP_000195318.1.850 WP_000195318.1.85004 WP_000195318.1.85014 WP_000195318.1.8502 WP_000195318.1.85031 WP_000195318.1.85039 WP_000195318.1.85040 WP_000195318.1.85079 WP_000195318.1.85094 WP_000195318.1.85120 WP_000195318.1.85134 WP_000195318.1.85147 WP_000195318.1.85153 WP_000195318.1.85178 WP_000195318.1.85180 WP_000195318.1.85190 WP_000195318.1.85217 WP_000195318.1.8526 WP_000195318.1.85271 WP_000195318.1.85273 WP_000195318.1.85301 WP_000195318.1.8533 WP_000195318.1.85338 WP_000195318.1.85339 WP_000195318.1.8537 WP_000195318.1.85408 WP_000195318.1.85433 WP_000195318.1.8545 WP_000195318.1.85456 WP_000195318.1.85469 WP_000195318.1.85481 WP_000195318.1.85483 WP_000195318.1.85511 WP_000195318.1.85512 WP_000195318.1.8552 WP_000195318.1.85541 WP_000195318.1.8556 WP_000195318.1.85568 WP_000195318.1.8557 WP_000195318.1.85615 WP_000195318.1.85617 WP_000195318.1.85635 WP_000195318.1.85663 WP_000195318.1.85665 WP_000195318.1.85669 WP_000195318.1.85671 WP_000195318.1.85675 WP_000195318.1.85688 WP_000195318.1.85703 WP_000195318.1.85723 WP_000195318.1.85728 WP_000195318.1.85742 WP_000195318.1.85746 WP_000195318.1.85759 WP_000195318.1.85777 WP_000195318.1.85780 WP_000195318.1.85797 WP_000195318.1.85811 WP_000195318.1.85854 WP_000195318.1.85855 WP_000195318.1.85864 WP_000195318.1.85886 WP_000195318.1.859 WP_000195318.1.85900 WP_000195318.1.85904 WP_000195318.1.8591 WP_000195318.1.85917 WP_000195318.1.8594 WP_000195318.1.85943 WP_000195318.1.85976 WP_000195318.1.85977 WP_000195318.1.85982 WP_000195318.1.860 WP_000195318.1.86007 WP_000195318.1.86010 WP_000195318.1.86017 WP_000195318.1.86043 WP_000195318.1.86084 WP_000195318.1.86092 WP_000195318.1.8610 WP_000195318.1.86120 WP_000195318.1.86138 WP_000195318.1.8614 WP_000195318.1.86156 WP_000195318.1.86157 WP_000195318.1.86159 WP_000195318.1.8616 WP_000195318.1.86173 WP_000195318.1.86224 WP_000195318.1.86240 WP_000195318.1.86259 WP_000195318.1.86284 WP_000195318.1.86285 WP_000195318.1.86306 WP_000195318.1.86310 WP_000195318.1.86323 WP_000195318.1.86335 WP_000195318.1.86347 WP_000195318.1.86356 WP_000195318.1.86380 WP_000195318.1.86389 WP_000195318.1.8640 WP_000195318.1.8642 WP_000195318.1.86426 WP_000195318.1.86442 WP_000195318.1.86450 WP_000195318.1.86466 WP_000195318.1.86469 WP_000195318.1.8647 WP_000195318.1.86514 WP_000195318.1.86530 WP_000195318.1.86580 WP_000195318.1.86588 WP_000195318.1.86593 WP_000195318.1.86601 WP_000195318.1.86610 WP_000195318.1.86634 WP_000195318.1.86656 WP_000195318.1.86658 WP_000195318.1.86661 WP_000195318.1.86663 WP_000195318.1.86676 WP_000195318.1.86699 WP_000195318.1.8671 WP_000195318.1.8672 WP_000195318.1.86744 WP_000195318.1.86770 WP_000195318.1.8678 WP_000195318.1.86800 WP_000195318.1.86807 WP_000195318.1.86810 WP_000195318.1.86811 WP_000195318.1.86815 WP_000195318.1.8684 WP_000195318.1.86859 WP_000195318.1.86860 WP_000195318.1.86895 WP_000195318.1.86902 WP_000195318.1.86906 WP_000195318.1.8691 WP_000195318.1.86915 WP_000195318.1.86921 WP_000195318.1.86945 WP_000195318.1.86982 WP_000195318.1.86989 WP_000195318.1.87023 WP_000195318.1.87034 WP_000195318.1.87038 WP_000195318.1.87041 WP_000195318.1.87051 WP_000195318.1.87095 WP_000195318.1.87136 WP_000195318.1.87143 WP_000195318.1.87148 WP_000195318.1.87155 WP_000195318.1.87187 WP_000195318.1.87219 WP_000195318.1.8722 WP_000195318.1.87220 WP_000195318.1.87258 WP_000195318.1.87265 WP_000195318.1.87276 WP_000195318.1.87282 WP_000195318.1.87283 WP_000195318.1.87293 WP_000195318.1.87323 WP_000195318.1.8736 WP_000195318.1.87365 WP_000195318.1.87376 WP_000195318.1.87420 WP_000195318.1.87460 WP_000195318.1.87484 WP_000195318.1.87493 WP_000195318.1.87500 WP_000195318.1.87528 WP_000195318.1.87552 WP_000195318.1.87560 WP_000195318.1.87583 WP_000195318.1.87584 WP_000195318.1.8760 WP_000195318.1.87600 WP_000195318.1.87609 WP_000195318.1.87612 WP_000195318.1.87618 WP_000195318.1.87626 WP_000195318.1.87651 WP_000195318.1.87659 WP_000195318.1.8767 WP_000195318.1.87687 WP_000195318.1.87695 WP_000195318.1.87698 WP_000195318.1.87706 WP_000195318.1.87712 WP_000195318.1.87739 WP_000195318.1.87741 WP_000195318.1.87760 WP_000195318.1.87779 WP_000195318.1.87813 WP_000195318.1.87852 WP_000195318.1.87891 WP_000195318.1.87899 WP_000195318.1.87905 WP_000195318.1.8792 WP_000195318.1.87936 WP_000195318.1.87945 WP_000195318.1.87949 WP_000195318.1.87999 WP_000195318.1.88014 WP_000195318.1.88019 WP_000195318.1.88025 WP_000195318.1.88026 WP_000195318.1.8805 WP_000195318.1.88052 WP_000195318.1.8806 WP_000195318.1.88073 WP_000195318.1.8809 WP_000195318.1.88092 WP_000195318.1.88145 WP_000195318.1.88165 WP_000195318.1.88174 WP_000195318.1.88185 WP_000195318.1.88214 WP_000195318.1.88222 WP_000195318.1.88275 WP_000195318.1.88291 WP_000195318.1.88293 WP_000195318.1.88313 WP_000195318.1.88356 WP_000195318.1.88359 WP_000195318.1.8837 WP_000195318.1.88393 WP_000195318.1.88407 WP_000195318.1.88414 WP_000195318.1.88423 WP_000195318.1.88444 WP_000195318.1.88446 WP_000195318.1.88474 WP_000195318.1.88483 WP_000195318.1.8849 WP_000195318.1.88501 WP_000195318.1.88508 WP_000195318.1.88538 WP_000195318.1.88547 WP_000195318.1.88597 WP_000195318.1.886 WP_000195318.1.88609 WP_000195318.1.88620 WP_000195318.1.88624 WP_000195318.1.88647 WP_000195318.1.88648 WP_000195318.1.88651 WP_000195318.1.88675 WP_000195318.1.88683 WP_000195318.1.88692 WP_000195318.1.88698 WP_000195318.1.88703 WP_000195318.1.88707 WP_000195318.1.88727 WP_000195318.1.88731 WP_000195318.1.88772 WP_000195318.1.88792 WP_000195318.1.88817 WP_000195318.1.88845 WP_000195318.1.88850 WP_000195318.1.88854 WP_000195318.1.8889 WP_000195318.1.88892 WP_000195318.1.88902 WP_000195318.1.8891 WP_000195318.1.88942 WP_000195318.1.88957 WP_000195318.1.88966 WP_000195318.1.88967 WP_000195318.1.88968 WP_000195318.1.88970 WP_000195318.1.88980 WP_000195318.1.88981 WP_000195318.1.88982 WP_000195318.1.88995 WP_000195318.1.88998 WP_000195318.1.89008 WP_000195318.1.89054 WP_000195318.1.89114 WP_000195318.1.89116 WP_000195318.1.89119 WP_000195318.1.89120 WP_000195318.1.89138 WP_000195318.1.89174 WP_000195318.1.89177 WP_000195318.1.89182 WP_000195318.1.89188 WP_000195318.1.89215 WP_000195318.1.89221 WP_000195318.1.89291 WP_000195318.1.89304 WP_000195318.1.89308 WP_000195318.1.89311 WP_000195318.1.89314 WP_000195318.1.89328 WP_000195318.1.89332 WP_000195318.1.89343 WP_000195318.1.89355 WP_000195318.1.89362 WP_000195318.1.89395 WP_000195318.1.8940 WP_000195318.1.89408 WP_000195318.1.89425 WP_000195318.1.89449 WP_000195318.1.89452 WP_000195318.1.89462 WP_000195318.1.8947 WP_000195318.1.89503 WP_000195318.1.89512 WP_000195318.1.89527 WP_000195318.1.89570 WP_000195318.1.8958 WP_000195318.1.89580 WP_000195318.1.89591 WP_000195318.1.89604 WP_000195318.1.89606 WP_000195318.1.8961 WP_000195318.1.89612 WP_000195318.1.89622 WP_000195318.1.89632 WP_000195318.1.89634 WP_000195318.1.89647 WP_000195318.1.89657 WP_000195318.1.89659 WP_000195318.1.89668 WP_000195318.1.89680 WP_000195318.1.89706 WP_000195318.1.89713 WP_000195318.1.89746 WP_000195318.1.89764 WP_000195318.1.89765 WP_000195318.1.89777 WP_000195318.1.89789 WP_000195318.1.89796 WP_000195318.1.89804 WP_000195318.1.89815 WP_000195318.1.89817 WP_000195318.1.89832 WP_000195318.1.89845 WP_000195318.1.89870 WP_000195318.1.89888 WP_000195318.1.89902 WP_000195318.1.89914 WP_000195318.1.89940 WP_000195318.1.8995 WP_000195318.1.89952 WP_000195318.1.8996 WP_000195318.1.89965 WP_000195318.1.90007 WP_000195318.1.9002 WP_000195318.1.9003 WP_000195318.1.90033 WP_000195318.1.90084 WP_000195318.1.90097 WP_000195318.1.90108 WP_000195318.1.9011 WP_000195318.1.90193 WP_000195318.1.90196 WP_000195318.1.90211 WP_000195318.1.90220 WP_000195318.1.90240 WP_000195318.1.90248 WP_000195318.1.90252 WP_000195318.1.90274 WP_000195318.1.90280 WP_000195318.1.90293 WP_000195318.1.90311 WP_000195318.1.90330 WP_000195318.1.90338 WP_000195318.1.90363 WP_000195318.1.90365 WP_000195318.1.90409 WP_000195318.1.90417 WP_000195318.1.90421 WP_000195318.1.90428 WP_000195318.1.90440 WP_000195318.1.90453 WP_000195318.1.90458 WP_000195318.1.90472 WP_000195318.1.90489 WP_000195318.1.90513 WP_000195318.1.90521 WP_000195318.1.90522 WP_000195318.1.90540 WP_000195318.1.90557 WP_000195318.1.90563 WP_000195318.1.90566 WP_000195318.1.90582 WP_000195318.1.90585 WP_000195318.1.90620 WP_000195318.1.9064 WP_000195318.1.90641 WP_000195318.1.90713 WP_000195318.1.90734 WP_000195318.1.90748 WP_000195318.1.90759 WP_000195318.1.90792 WP_000195318.1.90794 WP_000195318.1.90796 WP_000195318.1.90811 WP_000195318.1.90814 WP_000195318.1.90859 WP_000195318.1.90866 WP_000195318.1.90876 WP_000195318.1.9089 WP_000195318.1.9093 WP_000195318.1.90959 WP_000195318.1.90973 WP_000195318.1.90983 WP_000195318.1.90984 WP_000195318.1.90991 WP_000195318.1.91003 WP_000195318.1.91023 WP_000195318.1.91042 WP_000195318.1.91049 WP_000195318.1.91056 WP_000195318.1.91067 WP_000195318.1.91069 WP_000195318.1.91107 WP_000195318.1.91156 WP_000195318.1.91164 WP_000195318.1.91179 WP_000195318.1.91189 WP_000195318.1.91205 WP_000195318.1.91215 WP_000195318.1.91278 WP_000195318.1.91282 WP_000195318.1.91291 WP_000195318.1.9131 WP_000195318.1.91312 WP_000195318.1.91313 WP_000195318.1.91331 WP_000195318.1.91334 WP_000195318.1.9135 WP_000195318.1.9137 WP_000195318.1.91372 WP_000195318.1.91381 WP_000195318.1.91405 WP_000195318.1.91424 WP_000195318.1.91459 WP_000195318.1.91473 WP_000195318.1.91474 WP_000195318.1.91493 WP_000195318.1.91505 WP_000195318.1.91506 WP_000195318.1.91512 WP_000195318.1.91524 WP_000195318.1.91528 WP_000195318.1.91536 WP_000195318.1.91564 WP_000195318.1.91580 WP_000195318.1.91597 WP_000195318.1.91621 WP_000195318.1.91625 WP_000195318.1.91628 WP_000195318.1.91655 WP_000195318.1.9166 WP_000195318.1.91702 WP_000195318.1.91715 WP_000195318.1.91724 WP_000195318.1.91732 WP_000195318.1.91736 WP_000195318.1.91742 WP_000195318.1.91772 WP_000195318.1.91776 WP_000195318.1.91788 WP_000195318.1.91795 WP_000195318.1.91864 WP_000195318.1.9187 WP_000195318.1.91870 WP_000195318.1.91880 WP_000195318.1.91898 WP_000195318.1.91904 WP_000195318.1.91974 WP_000195318.1.91984 WP_000195318.1.92013 WP_000195318.1.92018 WP_000195318.1.92039 WP_000195318.1.92044 WP_000195318.1.92047 WP_000195318.1.92060 WP_000195318.1.92067 WP_000195318.1.92068 WP_000195318.1.92082 WP_000195318.1.92087 WP_000195318.1.92093 WP_000195318.1.92098 WP_000195318.1.92099 WP_000195318.1.92108 WP_000195318.1.92122 WP_000195318.1.92129 WP_000195318.1.92149 WP_000195318.1.92156 WP_000195318.1.92165 WP_000195318.1.92171 WP_000195318.1.92172 WP_000195318.1.92183 WP_000195318.1.92208 WP_000195318.1.92213 WP_000195318.1.9222 WP_000195318.1.92240 WP_000195318.1.92243 WP_000195318.1.92268 WP_000195318.1.92270 WP_000195318.1.92299 WP_000195318.1.92310 WP_000195318.1.92318 WP_000195318.1.92375 WP_000195318.1.92394 WP_000195318.1.92399 WP_000195318.1.92408 WP_000195318.1.92411 WP_000195318.1.92439 WP_000195318.1.92443 WP_000195318.1.92452 WP_000195318.1.92482 WP_000195318.1.92529 WP_000195318.1.92531 WP_000195318.1.92545 WP_000195318.1.92557 WP_000195318.1.92562 WP_000195318.1.92570 WP_000195318.1.92575 WP_000195318.1.92588 WP_000195318.1.926 WP_000195318.1.92628 WP_000195318.1.92646 WP_000195318.1.92659 WP_000195318.1.92669 WP_000195318.1.92671 WP_000195318.1.92676 WP_000195318.1.92705 WP_000195318.1.9271 WP_000195318.1.92734 WP_000195318.1.92738 WP_000195318.1.92754 WP_000195318.1.92758 WP_000195318.1.92786 WP_000195318.1.92806 WP_000195318.1.92810 WP_000195318.1.92823 WP_000195318.1.92827 WP_000195318.1.92832 WP_000195318.1.92836 WP_000195318.1.92842 WP_000195318.1.92843 WP_000195318.1.92875 WP_000195318.1.92879 WP_000195318.1.92890 WP_000195318.1.92893 WP_000195318.1.92895 WP_000195318.1.92926 WP_000195318.1.92929 WP_000195318.1.92936 WP_000195318.1.92939 WP_000195318.1.92947 WP_000195318.1.92987 WP_000195318.1.92988 WP_000195318.1.93059 WP_000195318.1.93061 WP_000195318.1.93076 WP_000195318.1.93086 WP_000195318.1.93101 WP_000195318.1.93103 WP_000195318.1.93105 WP_000195318.1.93111 WP_000195318.1.93118 WP_000195318.1.93136 WP_000195318.1.93155 WP_000195318.1.93168 WP_000195318.1.93184 WP_000195318.1.93213 WP_000195318.1.93215 WP_000195318.1.93221 WP_000195318.1.93239 WP_000195318.1.93275 WP_000195318.1.93302 WP_000195318.1.93322 WP_000195318.1.93339 WP_000195318.1.93350 WP_000195318.1.9336 WP_000195318.1.93365 WP_000195318.1.93376 WP_000195318.1.93387 WP_000195318.1.93410 WP_000195318.1.93469 WP_000195318.1.93511 WP_000195318.1.93512 WP_000195318.1.93524 WP_000195318.1.93543 WP_000195318.1.93577 WP_000195318.1.93596 WP_000195318.1.93604 WP_000195318.1.93635 WP_000195318.1.93648 WP_000195318.1.93650 WP_000195318.1.93656 WP_000195318.1.93662 WP_000195318.1.93691 WP_000195318.1.937 WP_000195318.1.93705 WP_000195318.1.9374 WP_000195318.1.93741 WP_000195318.1.9375 WP_000195318.1.93754 WP_000195318.1.93761 WP_000195318.1.93767 WP_000195318.1.93780 WP_000195318.1.9380 WP_000195318.1.93803 WP_000195318.1.93804 WP_000195318.1.93809 WP_000195318.1.93828 WP_000195318.1.93837 WP_000195318.1.93875 WP_000195318.1.9389 WP_000195318.1.93909 WP_000195318.1.93919 WP_000195318.1.93937 WP_000195318.1.93938 WP_000195318.1.93956 WP_000195318.1.93984 WP_000195318.1.93986 WP_000195318.1.9399 WP_000195318.1.93994 WP_000195318.1.94017 WP_000195318.1.94039 WP_000195318.1.94056 WP_000195318.1.94064 WP_000195318.1.94070 WP_000195318.1.94071 WP_000195318.1.94072 WP_000195318.1.94079 WP_000195318.1.94097 WP_000195318.1.94107 WP_000195318.1.94142 WP_000195318.1.94162 WP_000195318.1.94167 WP_000195318.1.94168 WP_000195318.1.94181 WP_000195318.1.94198 WP_000195318.1.94215 WP_000195318.1.94303 WP_000195318.1.9432 WP_000195318.1.94352 WP_000195318.1.94354 WP_000195318.1.94365 WP_000195318.1.94379 WP_000195318.1.94380 WP_000195318.1.94383 WP_000195318.1.94390 WP_000195318.1.9440 WP_000195318.1.94412 WP_000195318.1.94458 WP_000195318.1.94473 WP_000195318.1.94492 WP_000195318.1.94510 WP_000195318.1.94527 WP_000195318.1.94562 WP_000195318.1.94565 WP_000195318.1.94573 WP_000195318.1.94584 WP_000195318.1.94586 WP_000195318.1.94593 WP_000195318.1.94598 WP_000195318.1.94622 WP_000195318.1.9463 WP_000195318.1.94649 WP_000195318.1.94650 WP_000195318.1.94655 WP_000195318.1.94659 WP_000195318.1.94669 WP_000195318.1.94670 WP_000195318.1.94674 WP_000195318.1.94700 WP_000195318.1.94717 WP_000195318.1.94722 WP_000195318.1.94745 WP_000195318.1.94782 WP_000195318.1.94785 WP_000195318.1.94796 WP_000195318.1.9481 WP_000195318.1.94815 WP_000195318.1.94820 WP_000195318.1.94835 WP_000195318.1.94849 WP_000195318.1.94850 WP_000195318.1.94851 WP_000195318.1.94864 WP_000195318.1.94947 WP_000195318.1.94952 WP_000195318.1.94959 WP_000195318.1.94967 WP_000195318.1.94971 WP_000195318.1.94982 WP_000195318.1.94983 WP_000195318.1.94986 WP_000195318.1.94987 WP_000195318.1.9503 WP_000195318.1.95051 WP_000195318.1.95055 WP_000195318.1.95076 WP_000195318.1.95085 WP_000195318.1.95094 WP_000195318.1.95099 WP_000195318.1.95121 WP_000195318.1.95133 WP_000195318.1.95136 WP_000195318.1.95152 WP_000195318.1.9516 WP_000195318.1.95171 WP_000195318.1.95235 WP_000195318.1.95239 WP_000195318.1.95246 WP_000195318.1.95248 WP_000195318.1.95249 WP_000195318.1.9525 WP_000195318.1.95255 WP_000195318.1.95265 WP_000195318.1.9527 WP_000195318.1.95277 WP_000195318.1.95282 WP_000195318.1.95289 WP_000195318.1.95298 WP_000195318.1.95320 WP_000195318.1.95338 WP_000195318.1.95388 WP_000195318.1.95404 WP_000195318.1.95412 WP_000195318.1.95434 WP_000195318.1.95447 WP_000195318.1.95456 WP_000195318.1.95465 WP_000195318.1.95530 WP_000195318.1.95547 WP_000195318.1.95558 WP_000195318.1.95579 WP_000195318.1.95590 WP_000195318.1.95607 WP_000195318.1.95623 WP_000195318.1.95625 WP_000195318.1.95630 WP_000195318.1.95656 WP_000195318.1.95670 WP_000195318.1.95675 WP_000195318.1.95691 WP_000195318.1.95701 WP_000195318.1.95703 WP_000195318.1.95729 WP_000195318.1.9574 WP_000195318.1.95744 WP_000195318.1.95757 WP_000195318.1.95776 WP_000195318.1.95803 WP_000195318.1.95805 WP_000195318.1.95826 WP_000195318.1.95840 WP_000195318.1.9586 WP_000195318.1.95866 WP_000195318.1.95890 WP_000195318.1.95901 WP_000195318.1.95906 WP_000195318.1.95911 WP_000195318.1.95939 WP_000195318.1.95963 WP_000195318.1.96004 WP_000195318.1.96025 WP_000195318.1.96042 WP_000195318.1.96044 WP_000195318.1.96045 WP_000195318.1.96054 WP_000195318.1.9609 WP_000195318.1.96094 WP_000195318.1.96107 WP_000195318.1.96127 WP_000195318.1.96139 WP_000195318.1.96144 WP_000195318.1.96162 WP_000195318.1.96172 WP_000195318.1.96188 WP_000195318.1.96206 WP_000195318.1.96211 WP_000195318.1.96212 WP_000195318.1.9624 WP_000195318.1.96260 WP_000195318.1.9628 WP_000195318.1.96317 WP_000195318.1.96319 WP_000195318.1.96340 WP_000195318.1.96343 WP_000195318.1.96348 WP_000195318.1.96349 WP_000195318.1.96359 WP_000195318.1.96380 WP_000195318.1.96404 WP_000195318.1.96429 WP_000195318.1.9644 WP_000195318.1.96469 WP_000195318.1.96490 WP_000195318.1.96497 WP_000195318.1.96500 WP_000195318.1.96521 WP_000195318.1.96533 WP_000195318.1.96537 WP_000195318.1.96539 WP_000195318.1.96552 WP_000195318.1.96555 WP_000195318.1.96563 WP_000195318.1.96584 WP_000195318.1.96588 WP_000195318.1.96590 WP_000195318.1.96610 WP_000195318.1.96625 WP_000195318.1.96635 WP_000195318.1.9664 WP_000195318.1.96640 WP_000195318.1.96642 WP_000195318.1.96662 WP_000195318.1.96675 WP_000195318.1.9670 WP_000195318.1.96731 WP_000195318.1.96732 WP_000195318.1.96735 WP_000195318.1.9674 WP_000195318.1.96750 WP_000195318.1.96758 WP_000195318.1.96761 WP_000195318.1.96771 WP_000195318.1.96792 WP_000195318.1.96798 WP_000195318.1.96801 WP_000195318.1.96803 WP_000195318.1.96810 WP_000195318.1.9686 WP_000195318.1.96876 WP_000195318.1.96890 WP_000195318.1.96902 WP_000195318.1.96917 WP_000195318.1.96925 WP_000195318.1.96938 WP_000195318.1.96946 WP_000195318.1.96957 WP_000195318.1.96978 WP_000195318.1.96993 WP_000195318.1.97005 WP_000195318.1.97015 WP_000195318.1.97026 WP_000195318.1.97043 WP_000195318.1.97047 WP_000195318.1.97079 WP_000195318.1.97089 WP_000195318.1.97103 WP_000195318.1.97109 WP_000195318.1.97143 WP_000195318.1.97145 WP_000195318.1.97154 WP_000195318.1.97190 WP_000195318.1.97287 WP_000195318.1.97291 WP_000195318.1.97297 WP_000195318.1.97318 WP_000195318.1.97322 WP_000195318.1.97328 WP_000195318.1.97368 WP_000195318.1.97369 WP_000195318.1.97386 WP_000195318.1.97413 WP_000195318.1.97422 WP_000195318.1.97441 WP_000195318.1.97477 WP_000195318.1.97480 WP_000195318.1.97487 WP_000195318.1.97496 WP_000195318.1.97497 WP_000195318.1.97505 WP_000195318.1.97547 WP_000195318.1.97594 WP_000195318.1.97597 WP_000195318.1.97599 WP_000195318.1.97606 WP_000195318.1.97613 WP_000195318.1.97615 WP_000195318.1.97620 WP_000195318.1.97626 WP_000195318.1.97628 WP_000195318.1.97631 WP_000195318.1.97640 WP_000195318.1.97648 WP_000195318.1.97656 WP_000195318.1.97690 WP_000195318.1.97691 WP_000195318.1.97693 WP_000195318.1.97704 WP_000195318.1.97725 WP_000195318.1.97726 WP_000195318.1.97727 WP_000195318.1.97732 WP_000195318.1.97736 WP_000195318.1.9774 WP_000195318.1.9775 WP_000195318.1.97768 WP_000195318.1.97840 WP_000195318.1.97846 WP_000195318.1.97873 WP_000195318.1.9793 WP_000195318.1.97938 WP_000195318.1.97981 WP_000195318.1.97983 WP_000195318.1.97986 WP_000195318.1.9799 WP_000195318.1.97991 WP_000195318.1.98006 WP_000195318.1.98019 WP_000195318.1.98022 WP_000195318.1.98036 WP_000195318.1.9805 WP_000195318.1.98080 WP_000195318.1.98107 WP_000195318.1.9811 WP_000195318.1.98110 WP_000195318.1.98119 WP_000195318.1.98124 WP_000195318.1.98146 WP_000195318.1.98158 WP_000195318.1.98201 WP_000195318.1.98219 WP_000195318.1.98236 WP_000195318.1.98250 WP_000195318.1.98263 WP_000195318.1.98314 WP_000195318.1.98338 WP_000195318.1.98392 WP_000195318.1.98402 WP_000195318.1.98403 WP_000195318.1.9841 WP_000195318.1.98418 WP_000195318.1.98438 WP_000195318.1.98440 WP_000195318.1.98446 WP_000195318.1.98457 WP_000195318.1.98472 WP_000195318.1.98483 WP_000195318.1.98495 WP_000195318.1.9850 WP_000195318.1.98502 WP_000195318.1.98513 WP_000195318.1.98531 WP_000195318.1.98551 WP_000195318.1.98570 WP_000195318.1.98577 WP_000195318.1.98607 WP_000195318.1.98608 WP_000195318.1.98627 WP_000195318.1.9863 WP_000195318.1.98634 WP_000195318.1.98676 WP_000195318.1.98677 WP_000195318.1.98726 WP_000195318.1.98731 WP_000195318.1.98751 WP_000195318.1.98760 WP_000195318.1.98762 WP_000195318.1.98763 WP_000195318.1.98801 WP_000195318.1.98843 WP_000195318.1.9887 WP_000195318.1.98947 WP_000195318.1.9898 WP_000195318.1.9899 WP_000195318.1.99040 WP_000195318.1.99057 WP_000195318.1.99071 WP_000195318.1.99072 WP_000195318.1.99073 WP_000195318.1.99083 WP_000195318.1.99097 WP_000195318.1.99098 WP_000195318.1.99107 WP_000195318.1.99164 WP_000195318.1.99184 WP_000195318.1.99197 WP_000195318.1.99215 WP_000195318.1.99219 WP_000195318.1.99255 WP_000195318.1.99267 WP_000195318.1.99276 WP_000195318.1.99278 WP_000195318.1.99327 WP_000195318.1.99335 WP_000195318.1.99339 WP_000195318.1.99350 WP_000195318.1.99360 WP_000195318.1.99363 WP_000195318.1.99369 WP_000195318.1.99388 WP_000195318.1.99397 WP_000195318.1.99426 WP_000195318.1.99456 WP_000195318.1.99463 WP_000195318.1.99483 WP_000195318.1.99490 WP_000195318.1.99493 WP_000195318.1.99531 WP_000195318.1.99546 WP_000195318.1.99561 WP_000195318.1.99577 WP_000195318.1.99579 WP_000195318.1.99595 WP_000195318.1.99613 WP_000195318.1.99626 WP_000195318.1.99630 WP_000195318.1.99637 WP_000195318.1.99646 WP_000195318.1.99657 WP_000195318.1.99660 WP_000195318.1.99671 WP_000195318.1.99676 WP_000195318.1.99712 WP_000195318.1.99725 WP_000195318.1.99747 WP_000195318.1.99764 WP_000195318.1.99783 WP_000195318.1.99813 WP_000195318.1.99824 WP_000195318.1.99829 WP_000195318.1.99841 WP_000195318.1.99858 WP_000195318.1.99889 WP_000195318.1.9992 WP_000195318.1.99924 WP_000195318.1.99958 WP_000195318.1.99961 WP_000195318.1.99996 gi|197250406|ref|YP_002148108.1| gi|563654540|ref|YP_008862625.1| gi|482905749|ref|YP_007904309.1| gi|205354097|ref|YP_002227898.1| gi|549725744|ref|YP_008645934.1| gi|525829014|ref|YP_008252013.1| ABAK02000001|CDS_2661408-2659516 ABAM02000001|CDS_3719561-3717669 ABAN01000013|CDS_40781-42673 ABAO01000002|CDS_116230-118122 ABEH02000003|CDS_366535-364643 ABEI01000008|CDS_72526-70634 ABEL01000006|CDS_72876-70984 ABEW01000002|CDS_219154-221046 ABFF01000005|CDS_158399-160291 ABFG01000007|CDS_254461-256353 ABFH02000001|CDS_1815911-1817803 AE006468|CDS_3345854-3343962 AE014613|CDS_3188851-3186959 AE017220|CDS_3306616-3304724 AL513382|CDS_3203356-3201464 AM933172|CDS_3233811-3231919 AM933173|CDS_3211189-3209297 CP000026|CDS_3156434-3154542 CP000857|CDS_3284833-3282941 CP000886|CDS_3306212-3304320 CP001113|CDS_3335184-3333292 CP001120|CDS_3338014-3336122 CP001138|CDS_3267466-3265574 CP001144|CDS_3392906-3391014 CP001363|CDS_3364106-3362214 FM200053|CDS_3152108-3150216 FN424405|CDS_3337096-3335204 NZ_ACBF01000001|CDS_505096-503204 gi|16761956|ref|NP_457573.1| 209261.t3102 220341.STY3359 272994.SPAB_03972 295319.SPA3050 321314.SC3125 423368.SNSL254_A3439 439851.SeD_A3534 454166.SeAg_B3362 454169.SeHA_C3432 476213.SPC_3255 550537.SEN3024 550538.SG3078 554290.SSPA2846 99287.STM3181 gi|526221540|ref|YP_008267385.1| gi|56415122|ref|YP_152197.1| gi|378956801|ref|YP_005214288.1| gi|409246899|ref|YP_006887601.1| gi|194443762|ref|YP_002042448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]