SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452056|ref|YP_005239416.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452056|ref|YP_005239416.1|
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily RmlC-like cupins 4.85e-44
Family Pirin-like 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378452056|ref|YP_005239416.1|
Sequence length 233
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MITTRTAKQCGQADYGWLQARYTFSFGHYFDPTLLGYASLRVLNQEVLAPGASFQPRTYP
KVDILNLILDGEAEYRDSDGNHVQAKAGEALLLAAQPGISYSEHNISKVKPLTRMQLWLD
ACPERENTLVQKIPLLAAQQQLLASPDGEQNSLQLRQQVWVHHITLEKGESLNFQLHGPR
AYLQSIHGTFHAMTHNEEREALTCGDGAFIRDEPNITLVADTPLRALLVDLPV
Download sequence
Identical sequences A0A0D6IC70 A0A0F6B723 A0A0F7JA73 A0A0H3NM51 A0A0M0PYK0 A0A0U1IBR0 A0A249UTX1 A0A265B3J0 A0A2D1Y104 A0A2D3AGN7 A0A2H9YJ84 E8XBG4 G5NIE8 Q8ZLW6
gi|549725796|ref|YP_008645986.1| NP_462150.1.58477 WP_000633547.1.100010 WP_000633547.1.100234 WP_000633547.1.100258 WP_000633547.1.100376 WP_000633547.1.100424 WP_000633547.1.100436 WP_000633547.1.100438 WP_000633547.1.100484 WP_000633547.1.100488 WP_000633547.1.100597 WP_000633547.1.100730 WP_000633547.1.10076 WP_000633547.1.100781 WP_000633547.1.100793 WP_000633547.1.100869 WP_000633547.1.100871 WP_000633547.1.100882 WP_000633547.1.101007 WP_000633547.1.101020 WP_000633547.1.101074 WP_000633547.1.101078 WP_000633547.1.101180 WP_000633547.1.101185 WP_000633547.1.101259 WP_000633547.1.101284 WP_000633547.1.101291 WP_000633547.1.1013 WP_000633547.1.101320 WP_000633547.1.101353 WP_000633547.1.101386 WP_000633547.1.101404 WP_000633547.1.101420 WP_000633547.1.101589 WP_000633547.1.101707 WP_000633547.1.101724 WP_000633547.1.101734 WP_000633547.1.101815 WP_000633547.1.101878 WP_000633547.1.101953 WP_000633547.1.10220 WP_000633547.1.10231 WP_000633547.1.10266 WP_000633547.1.10429 WP_000633547.1.10439 WP_000633547.1.10465 WP_000633547.1.10566 WP_000633547.1.10678 WP_000633547.1.10753 WP_000633547.1.10992 WP_000633547.1.11000 WP_000633547.1.11024 WP_000633547.1.11031 WP_000633547.1.11098 WP_000633547.1.1110 WP_000633547.1.11156 WP_000633547.1.11168 WP_000633547.1.11190 WP_000633547.1.11295 WP_000633547.1.1137 WP_000633547.1.11455 WP_000633547.1.11458 WP_000633547.1.11518 WP_000633547.1.11532 WP_000633547.1.11543 WP_000633547.1.11588 WP_000633547.1.11677 WP_000633547.1.11687 WP_000633547.1.11735 WP_000633547.1.11763 WP_000633547.1.11772 WP_000633547.1.11834 WP_000633547.1.11897 WP_000633547.1.11936 WP_000633547.1.12017 WP_000633547.1.12025 WP_000633547.1.12114 WP_000633547.1.12351 WP_000633547.1.12370 WP_000633547.1.12484 WP_000633547.1.12546 WP_000633547.1.1264 WP_000633547.1.12718 WP_000633547.1.12728 WP_000633547.1.12879 WP_000633547.1.12936 WP_000633547.1.13027 WP_000633547.1.13106 WP_000633547.1.13130 WP_000633547.1.13207 WP_000633547.1.13334 WP_000633547.1.13414 WP_000633547.1.13488 WP_000633547.1.13509 WP_000633547.1.13661 WP_000633547.1.13669 WP_000633547.1.13741 WP_000633547.1.1387 WP_000633547.1.13908 WP_000633547.1.13932 WP_000633547.1.13968 WP_000633547.1.14001 WP_000633547.1.14111 WP_000633547.1.14151 WP_000633547.1.14212 WP_000633547.1.14239 WP_000633547.1.14320 WP_000633547.1.14379 WP_000633547.1.14406 WP_000633547.1.14410 WP_000633547.1.14436 WP_000633547.1.14458 WP_000633547.1.14466 WP_000633547.1.14524 WP_000633547.1.14554 WP_000633547.1.14618 WP_000633547.1.14725 WP_000633547.1.14852 WP_000633547.1.1489 WP_000633547.1.14932 WP_000633547.1.15046 WP_000633547.1.15055 WP_000633547.1.15100 WP_000633547.1.15124 WP_000633547.1.15223 WP_000633547.1.15226 WP_000633547.1.15316 WP_000633547.1.15369 WP_000633547.1.1540 WP_000633547.1.15508 WP_000633547.1.15586 WP_000633547.1.15784 WP_000633547.1.15830 WP_000633547.1.15862 WP_000633547.1.15910 WP_000633547.1.1592 WP_000633547.1.15922 WP_000633547.1.15986 WP_000633547.1.16004 WP_000633547.1.1601 WP_000633547.1.16047 WP_000633547.1.16062 WP_000633547.1.16063 WP_000633547.1.16103 WP_000633547.1.16226 WP_000633547.1.16233 WP_000633547.1.16273 WP_000633547.1.16284 WP_000633547.1.16328 WP_000633547.1.1635 WP_000633547.1.16361 WP_000633547.1.16468 WP_000633547.1.16525 WP_000633547.1.16581 WP_000633547.1.16614 WP_000633547.1.16650 WP_000633547.1.1668 WP_000633547.1.16686 WP_000633547.1.16691 WP_000633547.1.167 WP_000633547.1.16732 WP_000633547.1.16735 WP_000633547.1.16786 WP_000633547.1.16858 WP_000633547.1.16873 WP_000633547.1.16896 WP_000633547.1.16903 WP_000633547.1.16916 WP_000633547.1.16942 WP_000633547.1.16965 WP_000633547.1.1700 WP_000633547.1.17093 WP_000633547.1.17307 WP_000633547.1.174 WP_000633547.1.17439 WP_000633547.1.17480 WP_000633547.1.17546 WP_000633547.1.17560 WP_000633547.1.17702 WP_000633547.1.17703 WP_000633547.1.17705 WP_000633547.1.17743 WP_000633547.1.17747 WP_000633547.1.17891 WP_000633547.1.17901 WP_000633547.1.1798 WP_000633547.1.18019 WP_000633547.1.18111 WP_000633547.1.18122 WP_000633547.1.18163 WP_000633547.1.1818 WP_000633547.1.18192 WP_000633547.1.18254 WP_000633547.1.18265 WP_000633547.1.18267 WP_000633547.1.18282 WP_000633547.1.18468 WP_000633547.1.18607 WP_000633547.1.18705 WP_000633547.1.18715 WP_000633547.1.18776 WP_000633547.1.18822 WP_000633547.1.18881 WP_000633547.1.18940 WP_000633547.1.18949 WP_000633547.1.19030 WP_000633547.1.19053 WP_000633547.1.19273 WP_000633547.1.19320 WP_000633547.1.19357 WP_000633547.1.19458 WP_000633547.1.19460 WP_000633547.1.19461 WP_000633547.1.19588 WP_000633547.1.19614 WP_000633547.1.19616 WP_000633547.1.19642 WP_000633547.1.19702 WP_000633547.1.19706 WP_000633547.1.19723 WP_000633547.1.19724 WP_000633547.1.19749 WP_000633547.1.19784 WP_000633547.1.19793 WP_000633547.1.19802 WP_000633547.1.19809 WP_000633547.1.19867 WP_000633547.1.1990 WP_000633547.1.19975 WP_000633547.1.1998 WP_000633547.1.20 WP_000633547.1.2010 WP_000633547.1.20212 WP_000633547.1.20266 WP_000633547.1.20271 WP_000633547.1.20330 WP_000633547.1.20362 WP_000633547.1.20418 WP_000633547.1.20443 WP_000633547.1.20446 WP_000633547.1.20525 WP_000633547.1.2054 WP_000633547.1.20553 WP_000633547.1.20614 WP_000633547.1.20626 WP_000633547.1.20631 WP_000633547.1.20646 WP_000633547.1.20839 WP_000633547.1.20886 WP_000633547.1.20908 WP_000633547.1.21049 WP_000633547.1.21089 WP_000633547.1.21136 WP_000633547.1.21146 WP_000633547.1.21245 WP_000633547.1.21246 WP_000633547.1.21269 WP_000633547.1.21309 WP_000633547.1.21326 WP_000633547.1.21351 WP_000633547.1.21400 WP_000633547.1.21497 WP_000633547.1.21499 WP_000633547.1.21548 WP_000633547.1.21603 WP_000633547.1.21692 WP_000633547.1.21751 WP_000633547.1.21757 WP_000633547.1.21981 WP_000633547.1.21991 WP_000633547.1.22024 WP_000633547.1.2205 WP_000633547.1.22062 WP_000633547.1.22067 WP_000633547.1.22169 WP_000633547.1.2221 WP_000633547.1.22235 WP_000633547.1.2235 WP_000633547.1.22379 WP_000633547.1.22427 WP_000633547.1.2246 WP_000633547.1.22485 WP_000633547.1.22537 WP_000633547.1.22620 WP_000633547.1.22676 WP_000633547.1.22692 WP_000633547.1.22758 WP_000633547.1.22845 WP_000633547.1.22864 WP_000633547.1.22870 WP_000633547.1.22979 WP_000633547.1.23102 WP_000633547.1.23114 WP_000633547.1.2314 WP_000633547.1.23192 WP_000633547.1.23246 WP_000633547.1.23259 WP_000633547.1.23379 WP_000633547.1.2342 WP_000633547.1.23460 WP_000633547.1.23472 WP_000633547.1.23482 WP_000633547.1.23509 WP_000633547.1.23634 WP_000633547.1.2376 WP_000633547.1.23932 WP_000633547.1.23959 WP_000633547.1.24017 WP_000633547.1.24082 WP_000633547.1.24206 WP_000633547.1.24259 WP_000633547.1.24308 WP_000633547.1.24376 WP_000633547.1.24392 WP_000633547.1.24555 WP_000633547.1.24578 WP_000633547.1.2467 WP_000633547.1.24737 WP_000633547.1.24779 WP_000633547.1.25008 WP_000633547.1.25015 WP_000633547.1.25119 WP_000633547.1.25206 WP_000633547.1.25405 WP_000633547.1.25454 WP_000633547.1.25493 WP_000633547.1.25668 WP_000633547.1.25690 WP_000633547.1.2570 WP_000633547.1.25740 WP_000633547.1.25793 WP_000633547.1.25814 WP_000633547.1.25988 WP_000633547.1.26282 WP_000633547.1.26311 WP_000633547.1.26319 WP_000633547.1.26429 WP_000633547.1.26440 WP_000633547.1.26493 WP_000633547.1.26551 WP_000633547.1.26567 WP_000633547.1.26741 WP_000633547.1.26919 WP_000633547.1.26924 WP_000633547.1.27084 WP_000633547.1.27173 WP_000633547.1.27206 WP_000633547.1.27223 WP_000633547.1.27342 WP_000633547.1.27423 WP_000633547.1.27513 WP_000633547.1.27544 WP_000633547.1.27561 WP_000633547.1.27616 WP_000633547.1.2763 WP_000633547.1.27665 WP_000633547.1.27679 WP_000633547.1.27707 WP_000633547.1.27761 WP_000633547.1.2777 WP_000633547.1.27776 WP_000633547.1.27857 WP_000633547.1.27977 WP_000633547.1.28032 WP_000633547.1.28094 WP_000633547.1.28126 WP_000633547.1.28170 WP_000633547.1.2825 WP_000633547.1.28302 WP_000633547.1.2835 WP_000633547.1.28370 WP_000633547.1.28393 WP_000633547.1.28538 WP_000633547.1.28575 WP_000633547.1.28625 WP_000633547.1.28655 WP_000633547.1.28694 WP_000633547.1.28775 WP_000633547.1.2879 WP_000633547.1.2890 WP_000633547.1.28938 WP_000633547.1.28946 WP_000633547.1.29010 WP_000633547.1.2910 WP_000633547.1.29113 WP_000633547.1.29509 WP_000633547.1.29530 WP_000633547.1.29588 WP_000633547.1.29601 WP_000633547.1.29606 WP_000633547.1.29615 WP_000633547.1.29682 WP_000633547.1.29704 WP_000633547.1.29768 WP_000633547.1.29827 WP_000633547.1.29923 WP_000633547.1.29969 WP_000633547.1.29990 WP_000633547.1.30006 WP_000633547.1.30018 WP_000633547.1.30022 WP_000633547.1.30027 WP_000633547.1.30180 WP_000633547.1.30202 WP_000633547.1.30469 WP_000633547.1.30505 WP_000633547.1.30507 WP_000633547.1.30535 WP_000633547.1.30547 WP_000633547.1.3076 WP_000633547.1.30794 WP_000633547.1.30833 WP_000633547.1.30835 WP_000633547.1.30972 WP_000633547.1.31 WP_000633547.1.31092 WP_000633547.1.31122 WP_000633547.1.3113 WP_000633547.1.31185 WP_000633547.1.3119 WP_000633547.1.31190 WP_000633547.1.31196 WP_000633547.1.31219 WP_000633547.1.31281 WP_000633547.1.31362 WP_000633547.1.31451 WP_000633547.1.31504 WP_000633547.1.31515 WP_000633547.1.31578 WP_000633547.1.31658 WP_000633547.1.31845 WP_000633547.1.31854 WP_000633547.1.31927 WP_000633547.1.31940 WP_000633547.1.31967 WP_000633547.1.31972 WP_000633547.1.32192 WP_000633547.1.32206 WP_000633547.1.32260 WP_000633547.1.32408 WP_000633547.1.32424 WP_000633547.1.32438 WP_000633547.1.32515 WP_000633547.1.32527 WP_000633547.1.32629 WP_000633547.1.32660 WP_000633547.1.32702 WP_000633547.1.32714 WP_000633547.1.32786 WP_000633547.1.32804 WP_000633547.1.32860 WP_000633547.1.32902 WP_000633547.1.32907 WP_000633547.1.33030 WP_000633547.1.33127 WP_000633547.1.33143 WP_000633547.1.33248 WP_000633547.1.33261 WP_000633547.1.333 WP_000633547.1.33492 WP_000633547.1.33553 WP_000633547.1.33580 WP_000633547.1.33592 WP_000633547.1.33659 WP_000633547.1.33894 WP_000633547.1.3394 WP_000633547.1.34043 WP_000633547.1.34075 WP_000633547.1.34257 WP_000633547.1.34279 WP_000633547.1.34319 WP_000633547.1.34417 WP_000633547.1.34453 WP_000633547.1.34610 WP_000633547.1.34856 WP_000633547.1.34975 WP_000633547.1.34977 WP_000633547.1.35045 WP_000633547.1.35129 WP_000633547.1.35184 WP_000633547.1.35193 WP_000633547.1.35404 WP_000633547.1.35408 WP_000633547.1.35425 WP_000633547.1.35429 WP_000633547.1.35446 WP_000633547.1.35503 WP_000633547.1.35509 WP_000633547.1.3556 WP_000633547.1.35590 WP_000633547.1.35892 WP_000633547.1.35940 WP_000633547.1.36003 WP_000633547.1.3601 WP_000633547.1.36017 WP_000633547.1.36547 WP_000633547.1.36609 WP_000633547.1.36690 WP_000633547.1.3670 WP_000633547.1.36705 WP_000633547.1.36899 WP_000633547.1.36918 WP_000633547.1.36931 WP_000633547.1.36978 WP_000633547.1.37073 WP_000633547.1.37111 WP_000633547.1.37112 WP_000633547.1.37256 WP_000633547.1.37293 WP_000633547.1.37370 WP_000633547.1.37376 WP_000633547.1.3744 WP_000633547.1.37498 WP_000633547.1.37504 WP_000633547.1.37610 WP_000633547.1.37618 WP_000633547.1.37687 WP_000633547.1.37968 WP_000633547.1.37978 WP_000633547.1.38125 WP_000633547.1.38145 WP_000633547.1.383 WP_000633547.1.38393 WP_000633547.1.3848 WP_000633547.1.38569 WP_000633547.1.38613 WP_000633547.1.38673 WP_000633547.1.3869 WP_000633547.1.38693 WP_000633547.1.38773 WP_000633547.1.38781 WP_000633547.1.38881 WP_000633547.1.38882 WP_000633547.1.38895 WP_000633547.1.38913 WP_000633547.1.39003 WP_000633547.1.39136 WP_000633547.1.39197 WP_000633547.1.39229 WP_000633547.1.39265 WP_000633547.1.39405 WP_000633547.1.39420 WP_000633547.1.39449 WP_000633547.1.39512 WP_000633547.1.39553 WP_000633547.1.39556 WP_000633547.1.39584 WP_000633547.1.39629 WP_000633547.1.39724 WP_000633547.1.39763 WP_000633547.1.39862 WP_000633547.1.39923 WP_000633547.1.40017 WP_000633547.1.40072 WP_000633547.1.40073 WP_000633547.1.4011 WP_000633547.1.40208 WP_000633547.1.40240 WP_000633547.1.40254 WP_000633547.1.40257 WP_000633547.1.40292 WP_000633547.1.40305 WP_000633547.1.40311 WP_000633547.1.40341 WP_000633547.1.40374 WP_000633547.1.40380 WP_000633547.1.40395 WP_000633547.1.40465 WP_000633547.1.40710 WP_000633547.1.4075 WP_000633547.1.4087 WP_000633547.1.40877 WP_000633547.1.40996 WP_000633547.1.41017 WP_000633547.1.41018 WP_000633547.1.41048 WP_000633547.1.41050 WP_000633547.1.41086 WP_000633547.1.41091 WP_000633547.1.41226 WP_000633547.1.41279 WP_000633547.1.41345 WP_000633547.1.41516 WP_000633547.1.41554 WP_000633547.1.41572 WP_000633547.1.41591 WP_000633547.1.41662 WP_000633547.1.41708 WP_000633547.1.41761 WP_000633547.1.41859 WP_000633547.1.41862 WP_000633547.1.41882 WP_000633547.1.41931 WP_000633547.1.41979 WP_000633547.1.41985 WP_000633547.1.42104 WP_000633547.1.42156 WP_000633547.1.4222 WP_000633547.1.42243 WP_000633547.1.42276 WP_000633547.1.42320 WP_000633547.1.42328 WP_000633547.1.42342 WP_000633547.1.42422 WP_000633547.1.42444 WP_000633547.1.42491 WP_000633547.1.42676 WP_000633547.1.4276 WP_000633547.1.42864 WP_000633547.1.4288 WP_000633547.1.43018 WP_000633547.1.43041 WP_000633547.1.43077 WP_000633547.1.43244 WP_000633547.1.43299 WP_000633547.1.43312 WP_000633547.1.43334 WP_000633547.1.43339 WP_000633547.1.43351 WP_000633547.1.43371 WP_000633547.1.43437 WP_000633547.1.43522 WP_000633547.1.43613 WP_000633547.1.43668 WP_000633547.1.43778 WP_000633547.1.43873 WP_000633547.1.43886 WP_000633547.1.43951 WP_000633547.1.44005 WP_000633547.1.44043 WP_000633547.1.44099 WP_000633547.1.44121 WP_000633547.1.44291 WP_000633547.1.44300 WP_000633547.1.44310 WP_000633547.1.44386 WP_000633547.1.44433 WP_000633547.1.44479 WP_000633547.1.44640 WP_000633547.1.4467 WP_000633547.1.44747 WP_000633547.1.4485 WP_000633547.1.44877 WP_000633547.1.44927 WP_000633547.1.44933 WP_000633547.1.45067 WP_000633547.1.45074 WP_000633547.1.45079 WP_000633547.1.45098 WP_000633547.1.45145 WP_000633547.1.45177 WP_000633547.1.45259 WP_000633547.1.45344 WP_000633547.1.45349 WP_000633547.1.45365 WP_000633547.1.45434 WP_000633547.1.45550 WP_000633547.1.45582 WP_000633547.1.45585 WP_000633547.1.45622 WP_000633547.1.45660 WP_000633547.1.45690 WP_000633547.1.45797 WP_000633547.1.458 WP_000633547.1.45848 WP_000633547.1.46011 WP_000633547.1.46069 WP_000633547.1.46173 WP_000633547.1.46174 WP_000633547.1.46187 WP_000633547.1.46243 WP_000633547.1.46278 WP_000633547.1.46303 WP_000633547.1.46345 WP_000633547.1.46434 WP_000633547.1.46595 WP_000633547.1.46620 WP_000633547.1.46675 WP_000633547.1.46689 WP_000633547.1.46803 WP_000633547.1.46930 WP_000633547.1.47008 WP_000633547.1.47057 WP_000633547.1.47214 WP_000633547.1.47429 WP_000633547.1.47448 WP_000633547.1.4747 WP_000633547.1.47472 WP_000633547.1.47478 WP_000633547.1.47579 WP_000633547.1.47587 WP_000633547.1.47621 WP_000633547.1.47799 WP_000633547.1.47817 WP_000633547.1.48132 WP_000633547.1.48242 WP_000633547.1.48253 WP_000633547.1.483 WP_000633547.1.48367 WP_000633547.1.48377 WP_000633547.1.4853 WP_000633547.1.48788 WP_000633547.1.4885 WP_000633547.1.48876 WP_000633547.1.48894 WP_000633547.1.48919 WP_000633547.1.49005 WP_000633547.1.49084 WP_000633547.1.49113 WP_000633547.1.49155 WP_000633547.1.49204 WP_000633547.1.49239 WP_000633547.1.49256 WP_000633547.1.49290 WP_000633547.1.49340 WP_000633547.1.49366 WP_000633547.1.49490 WP_000633547.1.49515 WP_000633547.1.49572 WP_000633547.1.49590 WP_000633547.1.49686 WP_000633547.1.4979 WP_000633547.1.49803 WP_000633547.1.49805 WP_000633547.1.49929 WP_000633547.1.50080 WP_000633547.1.50161 WP_000633547.1.50211 WP_000633547.1.50376 WP_000633547.1.50389 WP_000633547.1.50404 WP_000633547.1.50517 WP_000633547.1.50576 WP_000633547.1.50593 WP_000633547.1.50676 WP_000633547.1.50774 WP_000633547.1.50804 WP_000633547.1.50808 WP_000633547.1.50811 WP_000633547.1.5088 WP_000633547.1.50908 WP_000633547.1.50941 WP_000633547.1.50999 WP_000633547.1.51014 WP_000633547.1.51022 WP_000633547.1.51066 WP_000633547.1.51182 WP_000633547.1.51186 WP_000633547.1.51224 WP_000633547.1.51331 WP_000633547.1.51487 WP_000633547.1.51488 WP_000633547.1.51634 WP_000633547.1.51649 WP_000633547.1.51686 WP_000633547.1.51756 WP_000633547.1.51831 WP_000633547.1.51911 WP_000633547.1.51932 WP_000633547.1.51989 WP_000633547.1.52121 WP_000633547.1.52148 WP_000633547.1.52170 WP_000633547.1.52336 WP_000633547.1.52353 WP_000633547.1.52356 WP_000633547.1.52361 WP_000633547.1.52608 WP_000633547.1.52653 WP_000633547.1.52656 WP_000633547.1.52692 WP_000633547.1.52743 WP_000633547.1.52857 WP_000633547.1.52866 WP_000633547.1.52898 WP_000633547.1.52915 WP_000633547.1.52949 WP_000633547.1.52985 WP_000633547.1.53190 WP_000633547.1.53272 WP_000633547.1.53406 WP_000633547.1.53436 WP_000633547.1.53466 WP_000633547.1.53543 WP_000633547.1.53757 WP_000633547.1.53812 WP_000633547.1.53905 WP_000633547.1.54033 WP_000633547.1.54075 WP_000633547.1.54159 WP_000633547.1.54196 WP_000633547.1.542 WP_000633547.1.54209 WP_000633547.1.54271 WP_000633547.1.54273 WP_000633547.1.54274 WP_000633547.1.54319 WP_000633547.1.54364 WP_000633547.1.54400 WP_000633547.1.54526 WP_000633547.1.54607 WP_000633547.1.54644 WP_000633547.1.54662 WP_000633547.1.54722 WP_000633547.1.54749 WP_000633547.1.54764 WP_000633547.1.55008 WP_000633547.1.55152 WP_000633547.1.55156 WP_000633547.1.55285 WP_000633547.1.55325 WP_000633547.1.55418 WP_000633547.1.55430 WP_000633547.1.55475 WP_000633547.1.55554 WP_000633547.1.5560 WP_000633547.1.55614 WP_000633547.1.55647 WP_000633547.1.55743 WP_000633547.1.55768 WP_000633547.1.55782 WP_000633547.1.55796 WP_000633547.1.55973 WP_000633547.1.55993 WP_000633547.1.56002 WP_000633547.1.56012 WP_000633547.1.56105 WP_000633547.1.56238 WP_000633547.1.56244 WP_000633547.1.56286 WP_000633547.1.56304 WP_000633547.1.56368 WP_000633547.1.56414 WP_000633547.1.56438 WP_000633547.1.56559 WP_000633547.1.56560 WP_000633547.1.56597 WP_000633547.1.56601 WP_000633547.1.56614 WP_000633547.1.56660 WP_000633547.1.56671 WP_000633547.1.56682 WP_000633547.1.56875 WP_000633547.1.56877 WP_000633547.1.57168 WP_000633547.1.57187 WP_000633547.1.57232 WP_000633547.1.57356 WP_000633547.1.57377 WP_000633547.1.57418 WP_000633547.1.57433 WP_000633547.1.57515 WP_000633547.1.57529 WP_000633547.1.57576 WP_000633547.1.57601 WP_000633547.1.57607 WP_000633547.1.57735 WP_000633547.1.5774 WP_000633547.1.57763 WP_000633547.1.57781 WP_000633547.1.57862 WP_000633547.1.57890 WP_000633547.1.57891 WP_000633547.1.57978 WP_000633547.1.5801 WP_000633547.1.58041 WP_000633547.1.58157 WP_000633547.1.58358 WP_000633547.1.58372 WP_000633547.1.58407 WP_000633547.1.58418 WP_000633547.1.58451 WP_000633547.1.5854 WP_000633547.1.58548 WP_000633547.1.5858 WP_000633547.1.58662 WP_000633547.1.58669 WP_000633547.1.58745 WP_000633547.1.58803 WP_000633547.1.58834 WP_000633547.1.5886 WP_000633547.1.59094 WP_000633547.1.59097 WP_000633547.1.59125 WP_000633547.1.59224 WP_000633547.1.59236 WP_000633547.1.59321 WP_000633547.1.59375 WP_000633547.1.59420 WP_000633547.1.59439 WP_000633547.1.59458 WP_000633547.1.59490 WP_000633547.1.59508 WP_000633547.1.59512 WP_000633547.1.5953 WP_000633547.1.59684 WP_000633547.1.59694 WP_000633547.1.59771 WP_000633547.1.5979 WP_000633547.1.59953 WP_000633547.1.60008 WP_000633547.1.60021 WP_000633547.1.60069 WP_000633547.1.60140 WP_000633547.1.60155 WP_000633547.1.60213 WP_000633547.1.60285 WP_000633547.1.60379 WP_000633547.1.60464 WP_000633547.1.60507 WP_000633547.1.6052 WP_000633547.1.60545 WP_000633547.1.60561 WP_000633547.1.60608 WP_000633547.1.60772 WP_000633547.1.60874 WP_000633547.1.60941 WP_000633547.1.61078 WP_000633547.1.6108 WP_000633547.1.61087 WP_000633547.1.6114 WP_000633547.1.61201 WP_000633547.1.61232 WP_000633547.1.6129 WP_000633547.1.61417 WP_000633547.1.61509 WP_000633547.1.61574 WP_000633547.1.61609 WP_000633547.1.61712 WP_000633547.1.61714 WP_000633547.1.61730 WP_000633547.1.61857 WP_000633547.1.61918 WP_000633547.1.61952 WP_000633547.1.62007 WP_000633547.1.62020 WP_000633547.1.62025 WP_000633547.1.6209 WP_000633547.1.62204 WP_000633547.1.62222 WP_000633547.1.62257 WP_000633547.1.62304 WP_000633547.1.62361 WP_000633547.1.62364 WP_000633547.1.62374 WP_000633547.1.62403 WP_000633547.1.6253 WP_000633547.1.62570 WP_000633547.1.62677 WP_000633547.1.62853 WP_000633547.1.62903 WP_000633547.1.62955 WP_000633547.1.63063 WP_000633547.1.63181 WP_000633547.1.63203 WP_000633547.1.63256 WP_000633547.1.63290 WP_000633547.1.63382 WP_000633547.1.63432 WP_000633547.1.63461 WP_000633547.1.63479 WP_000633547.1.63577 WP_000633547.1.63664 WP_000633547.1.63718 WP_000633547.1.6375 WP_000633547.1.63757 WP_000633547.1.63797 WP_000633547.1.63834 WP_000633547.1.64018 WP_000633547.1.64046 WP_000633547.1.6423 WP_000633547.1.64244 WP_000633547.1.64387 WP_000633547.1.64403 WP_000633547.1.64649 WP_000633547.1.64674 WP_000633547.1.64702 WP_000633547.1.64757 WP_000633547.1.64781 WP_000633547.1.64831 WP_000633547.1.6489 WP_000633547.1.64894 WP_000633547.1.64920 WP_000633547.1.65018 WP_000633547.1.65022 WP_000633547.1.65028 WP_000633547.1.65171 WP_000633547.1.65248 WP_000633547.1.65269 WP_000633547.1.6535 WP_000633547.1.65474 WP_000633547.1.65558 WP_000633547.1.65572 WP_000633547.1.6560 WP_000633547.1.65633 WP_000633547.1.6565 WP_000633547.1.65696 WP_000633547.1.6575 WP_000633547.1.65782 WP_000633547.1.65940 WP_000633547.1.65956 WP_000633547.1.66049 WP_000633547.1.6630 WP_000633547.1.66314 WP_000633547.1.66330 WP_000633547.1.66358 WP_000633547.1.66362 WP_000633547.1.6638 WP_000633547.1.6640 WP_000633547.1.66462 WP_000633547.1.66678 WP_000633547.1.66698 WP_000633547.1.6680 WP_000633547.1.66834 WP_000633547.1.66901 WP_000633547.1.66962 WP_000633547.1.67037 WP_000633547.1.67045 WP_000633547.1.67100 WP_000633547.1.67181 WP_000633547.1.67235 WP_000633547.1.67268 WP_000633547.1.67347 WP_000633547.1.6739 WP_000633547.1.67465 WP_000633547.1.67552 WP_000633547.1.67682 WP_000633547.1.67829 WP_000633547.1.67887 WP_000633547.1.67942 WP_000633547.1.68201 WP_000633547.1.68206 WP_000633547.1.6827 WP_000633547.1.68275 WP_000633547.1.68401 WP_000633547.1.68477 WP_000633547.1.6849 WP_000633547.1.68547 WP_000633547.1.68589 WP_000633547.1.68655 WP_000633547.1.68656 WP_000633547.1.68690 WP_000633547.1.68778 WP_000633547.1.68787 WP_000633547.1.6879 WP_000633547.1.68894 WP_000633547.1.68928 WP_000633547.1.68958 WP_000633547.1.68975 WP_000633547.1.69001 WP_000633547.1.69006 WP_000633547.1.69011 WP_000633547.1.6904 WP_000633547.1.69146 WP_000633547.1.69151 WP_000633547.1.69255 WP_000633547.1.69346 WP_000633547.1.69359 WP_000633547.1.69397 WP_000633547.1.6954 WP_000633547.1.69564 WP_000633547.1.69588 WP_000633547.1.69644 WP_000633547.1.69704 WP_000633547.1.69758 WP_000633547.1.7021 WP_000633547.1.70241 WP_000633547.1.70269 WP_000633547.1.70289 WP_000633547.1.70447 WP_000633547.1.70485 WP_000633547.1.70488 WP_000633547.1.70580 WP_000633547.1.70643 WP_000633547.1.70683 WP_000633547.1.70869 WP_000633547.1.70883 WP_000633547.1.70922 WP_000633547.1.70948 WP_000633547.1.70959 WP_000633547.1.71007 WP_000633547.1.71010 WP_000633547.1.71023 WP_000633547.1.71069 WP_000633547.1.71116 WP_000633547.1.71120 WP_000633547.1.71146 WP_000633547.1.71165 WP_000633547.1.71188 WP_000633547.1.71202 WP_000633547.1.71243 WP_000633547.1.71306 WP_000633547.1.71363 WP_000633547.1.71378 WP_000633547.1.71401 WP_000633547.1.71636 WP_000633547.1.71691 WP_000633547.1.71702 WP_000633547.1.71750 WP_000633547.1.71798 WP_000633547.1.71881 WP_000633547.1.71908 WP_000633547.1.71952 WP_000633547.1.71973 WP_000633547.1.72105 WP_000633547.1.72107 WP_000633547.1.72203 WP_000633547.1.72351 WP_000633547.1.72372 WP_000633547.1.72376 WP_000633547.1.72403 WP_000633547.1.72412 WP_000633547.1.72594 WP_000633547.1.72728 WP_000633547.1.72871 WP_000633547.1.72872 WP_000633547.1.73062 WP_000633547.1.73125 WP_000633547.1.7315 WP_000633547.1.73200 WP_000633547.1.7334 WP_000633547.1.73362 WP_000633547.1.73377 WP_000633547.1.73379 WP_000633547.1.73461 WP_000633547.1.73481 WP_000633547.1.7356 WP_000633547.1.73561 WP_000633547.1.73581 WP_000633547.1.73617 WP_000633547.1.73667 WP_000633547.1.73753 WP_000633547.1.73758 WP_000633547.1.73794 WP_000633547.1.73847 WP_000633547.1.7387 WP_000633547.1.73926 WP_000633547.1.74181 WP_000633547.1.74191 WP_000633547.1.7433 WP_000633547.1.74379 WP_000633547.1.74410 WP_000633547.1.74466 WP_000633547.1.745 WP_000633547.1.74529 WP_000633547.1.74545 WP_000633547.1.7458 WP_000633547.1.74639 WP_000633547.1.74745 WP_000633547.1.7491 WP_000633547.1.75129 WP_000633547.1.75180 WP_000633547.1.75187 WP_000633547.1.75288 WP_000633547.1.75334 WP_000633547.1.75362 WP_000633547.1.75385 WP_000633547.1.75392 WP_000633547.1.75760 WP_000633547.1.75764 WP_000633547.1.75837 WP_000633547.1.75874 WP_000633547.1.76020 WP_000633547.1.76197 WP_000633547.1.76252 WP_000633547.1.76327 WP_000633547.1.76532 WP_000633547.1.7660 WP_000633547.1.76673 WP_000633547.1.76706 WP_000633547.1.7672 WP_000633547.1.76721 WP_000633547.1.76756 WP_000633547.1.76760 WP_000633547.1.76875 WP_000633547.1.76880 WP_000633547.1.76899 WP_000633547.1.77038 WP_000633547.1.77047 WP_000633547.1.77080 WP_000633547.1.7712 WP_000633547.1.77177 WP_000633547.1.77180 WP_000633547.1.77244 WP_000633547.1.77267 WP_000633547.1.77292 WP_000633547.1.77349 WP_000633547.1.77414 WP_000633547.1.77436 WP_000633547.1.77514 WP_000633547.1.77529 WP_000633547.1.77549 WP_000633547.1.77575 WP_000633547.1.77692 WP_000633547.1.77710 WP_000633547.1.77754 WP_000633547.1.7782 WP_000633547.1.77851 WP_000633547.1.77898 WP_000633547.1.77918 WP_000633547.1.77960 WP_000633547.1.78033 WP_000633547.1.78076 WP_000633547.1.78096 WP_000633547.1.78100 WP_000633547.1.78110 WP_000633547.1.78120 WP_000633547.1.78372 WP_000633547.1.78383 WP_000633547.1.78407 WP_000633547.1.7861 WP_000633547.1.78618 WP_000633547.1.78673 WP_000633547.1.78735 WP_000633547.1.78802 WP_000633547.1.78830 WP_000633547.1.78835 WP_000633547.1.78838 WP_000633547.1.78871 WP_000633547.1.78874 WP_000633547.1.78918 WP_000633547.1.78930 WP_000633547.1.79151 WP_000633547.1.79167 WP_000633547.1.79203 WP_000633547.1.79335 WP_000633547.1.79427 WP_000633547.1.79462 WP_000633547.1.79472 WP_000633547.1.79490 WP_000633547.1.79495 WP_000633547.1.79529 WP_000633547.1.79570 WP_000633547.1.7964 WP_000633547.1.79659 WP_000633547.1.79668 WP_000633547.1.79708 WP_000633547.1.79734 WP_000633547.1.79845 WP_000633547.1.79867 WP_000633547.1.79892 WP_000633547.1.79914 WP_000633547.1.79951 WP_000633547.1.80077 WP_000633547.1.80137 WP_000633547.1.80182 WP_000633547.1.80296 WP_000633547.1.80366 WP_000633547.1.80479 WP_000633547.1.80741 WP_000633547.1.80780 WP_000633547.1.80831 WP_000633547.1.80850 WP_000633547.1.80868 WP_000633547.1.80881 WP_000633547.1.80939 WP_000633547.1.8096 WP_000633547.1.81037 WP_000633547.1.81069 WP_000633547.1.81149 WP_000633547.1.81175 WP_000633547.1.8119 WP_000633547.1.81193 WP_000633547.1.81305 WP_000633547.1.81320 WP_000633547.1.81328 WP_000633547.1.81354 WP_000633547.1.81410 WP_000633547.1.81425 WP_000633547.1.81528 WP_000633547.1.81735 WP_000633547.1.81750 WP_000633547.1.81760 WP_000633547.1.81785 WP_000633547.1.81902 WP_000633547.1.81965 WP_000633547.1.81974 WP_000633547.1.82037 WP_000633547.1.82192 WP_000633547.1.82232 WP_000633547.1.82337 WP_000633547.1.82464 WP_000633547.1.82479 WP_000633547.1.82503 WP_000633547.1.82515 WP_000633547.1.82529 WP_000633547.1.82676 WP_000633547.1.82761 WP_000633547.1.8282 WP_000633547.1.82843 WP_000633547.1.82944 WP_000633547.1.82956 WP_000633547.1.83092 WP_000633547.1.83163 WP_000633547.1.83301 WP_000633547.1.83305 WP_000633547.1.83365 WP_000633547.1.83413 WP_000633547.1.83491 WP_000633547.1.83516 WP_000633547.1.83523 WP_000633547.1.8354 WP_000633547.1.83710 WP_000633547.1.83721 WP_000633547.1.83760 WP_000633547.1.83995 WP_000633547.1.84103 WP_000633547.1.84283 WP_000633547.1.84291 WP_000633547.1.84392 WP_000633547.1.84397 WP_000633547.1.8441 WP_000633547.1.84532 WP_000633547.1.84554 WP_000633547.1.84659 WP_000633547.1.84693 WP_000633547.1.84711 WP_000633547.1.84899 WP_000633547.1.8497 WP_000633547.1.85014 WP_000633547.1.85040 WP_000633547.1.85147 WP_000633547.1.85178 WP_000633547.1.85180 WP_000633547.1.85190 WP_000633547.1.8533 WP_000633547.1.8545 WP_000633547.1.85481 WP_000633547.1.85483 WP_000633547.1.85541 WP_000633547.1.8556 WP_000633547.1.85568 WP_000633547.1.85615 WP_000633547.1.85617 WP_000633547.1.85663 WP_000633547.1.85671 WP_000633547.1.85672 WP_000633547.1.85742 WP_000633547.1.85777 WP_000633547.1.85855 WP_000633547.1.85886 WP_000633547.1.85900 WP_000633547.1.85904 WP_000633547.1.85976 WP_000633547.1.86017 WP_000633547.1.86043 WP_000633547.1.86173 WP_000633547.1.86306 WP_000633547.1.86356 WP_000633547.1.86389 WP_000633547.1.86450 WP_000633547.1.86469 WP_000633547.1.86580 WP_000633547.1.86588 WP_000633547.1.86634 WP_000633547.1.86661 WP_000633547.1.8671 WP_000633547.1.8672 WP_000633547.1.8678 WP_000633547.1.86807 WP_000633547.1.86810 WP_000633547.1.8684 WP_000633547.1.86860 WP_000633547.1.86895 WP_000633547.1.86906 WP_000633547.1.87095 WP_000633547.1.8722 WP_000633547.1.87323 WP_000633547.1.8736 WP_000633547.1.87460 WP_000633547.1.87552 WP_000633547.1.87695 WP_000633547.1.87779 WP_000633547.1.87899 WP_000633547.1.8792 WP_000633547.1.87933 WP_000633547.1.87945 WP_000633547.1.88019 WP_000633547.1.88073 WP_000633547.1.8809 WP_000633547.1.88092 WP_000633547.1.88291 WP_000633547.1.88293 WP_000633547.1.8837 WP_000633547.1.88393 WP_000633547.1.88698 WP_000633547.1.88703 WP_000633547.1.88792 WP_000633547.1.88845 WP_000633547.1.88902 WP_000633547.1.8891 WP_000633547.1.88942 WP_000633547.1.88957 WP_000633547.1.88980 WP_000633547.1.88981 WP_000633547.1.89008 WP_000633547.1.89114 WP_000633547.1.89116 WP_000633547.1.89119 WP_000633547.1.89138 WP_000633547.1.89354 WP_000633547.1.89512 WP_000633547.1.89527 WP_000633547.1.89570 WP_000633547.1.89604 WP_000633547.1.89622 WP_000633547.1.89632 WP_000633547.1.89657 WP_000633547.1.89659 WP_000633547.1.89765 WP_000633547.1.89817 WP_000633547.1.89902 WP_000633547.1.8996 WP_000633547.1.9002 WP_000633547.1.90084 WP_000633547.1.90097 WP_000633547.1.90211 WP_000633547.1.90220 WP_000633547.1.90252 WP_000633547.1.90417 WP_000633547.1.90453 WP_000633547.1.90458 WP_000633547.1.90557 WP_000633547.1.90585 WP_000633547.1.90641 WP_000633547.1.90734 WP_000633547.1.91003 WP_000633547.1.91049 WP_000633547.1.91056 WP_000633547.1.91069 WP_000633547.1.91107 WP_000633547.1.91179 WP_000633547.1.91278 WP_000633547.1.9131 WP_000633547.1.91512 WP_000633547.1.91564 WP_000633547.1.91621 WP_000633547.1.91628 WP_000633547.1.91655 WP_000633547.1.91724 WP_000633547.1.91732 WP_000633547.1.91788 WP_000633547.1.92013 WP_000633547.1.92044 WP_000633547.1.92060 WP_000633547.1.92093 WP_000633547.1.92108 WP_000633547.1.92165 WP_000633547.1.92171 WP_000633547.1.92183 WP_000633547.1.92208 WP_000633547.1.92310 WP_000633547.1.92318 WP_000633547.1.92375 WP_000633547.1.92443 WP_000633547.1.92482 WP_000633547.1.92531 WP_000633547.1.92669 WP_000633547.1.92671 WP_000633547.1.92738 WP_000633547.1.92758 WP_000633547.1.92893 WP_000633547.1.92988 WP_000633547.1.93059 WP_000633547.1.93086 WP_000633547.1.93101 WP_000633547.1.93136 WP_000633547.1.93155 WP_000633547.1.93275 WP_000633547.1.93339 WP_000633547.1.93365 WP_000633547.1.93376 WP_000633547.1.93543 WP_000633547.1.93650 WP_000633547.1.93656 WP_000633547.1.93662 WP_000633547.1.93691 WP_000633547.1.937 WP_000633547.1.93705 WP_000633547.1.93804 WP_000633547.1.9389 WP_000633547.1.93937 WP_000633547.1.93956 WP_000633547.1.93994 WP_000633547.1.94039 WP_000633547.1.94072 WP_000633547.1.94162 WP_000633547.1.94167 WP_000633547.1.94168 WP_000633547.1.94198 WP_000633547.1.9432 WP_000633547.1.94354 WP_000633547.1.94379 WP_000633547.1.94380 WP_000633547.1.94458 WP_000633547.1.94562 WP_000633547.1.94565 WP_000633547.1.94584 WP_000633547.1.94655 WP_000633547.1.94674 WP_000633547.1.94722 WP_000633547.1.94796 WP_000633547.1.94959 WP_000633547.1.94982 WP_000633547.1.95051 WP_000633547.1.95085 WP_000633547.1.95121 WP_000633547.1.95248 WP_000633547.1.95277 WP_000633547.1.95282 WP_000633547.1.9530 WP_000633547.1.95388 WP_000633547.1.95546 WP_000633547.1.95630 WP_000633547.1.95670 WP_000633547.1.95691 WP_000633547.1.95911 WP_000633547.1.95939 WP_000633547.1.96004 WP_000633547.1.96139 WP_000633547.1.96162 WP_000633547.1.96206 WP_000633547.1.96317 WP_000633547.1.96343 WP_000633547.1.9644 WP_000633547.1.96469 WP_000633547.1.96497 WP_000633547.1.96500 WP_000633547.1.96555 WP_000633547.1.96563 WP_000633547.1.96590 WP_000633547.1.96732 WP_000633547.1.9674 WP_000633547.1.96758 WP_000633547.1.96771 WP_000633547.1.96917 WP_000633547.1.97015 WP_000633547.1.97047 WP_000633547.1.97143 WP_000633547.1.97145 WP_000633547.1.97190 WP_000633547.1.97297 WP_000633547.1.97318 WP_000633547.1.97369 WP_000633547.1.97477 WP_000633547.1.97480 WP_000633547.1.97487 WP_000633547.1.97534 WP_000633547.1.97594 WP_000633547.1.97597 WP_000633547.1.97613 WP_000633547.1.97620 WP_000633547.1.97631 WP_000633547.1.97727 WP_000633547.1.97732 WP_000633547.1.97736 WP_000633547.1.9775 WP_000633547.1.97846 WP_000633547.1.97983 WP_000633547.1.9799 WP_000633547.1.98006 WP_000633547.1.98019 WP_000633547.1.98022 WP_000633547.1.98110 WP_000633547.1.98146 WP_000633547.1.98170 WP_000633547.1.98219 WP_000633547.1.9826 WP_000633547.1.98314 WP_000633547.1.9841 WP_000633547.1.98495 WP_000633547.1.98531 WP_000633547.1.98577 WP_000633547.1.98627 WP_000633547.1.98676 WP_000633547.1.98677 WP_000633547.1.98760 WP_000633547.1.98843 WP_000633547.1.9898 WP_000633547.1.99071 WP_000633547.1.99098 WP_000633547.1.99184 WP_000633547.1.99267 WP_000633547.1.99276 WP_000633547.1.99626 WP_000633547.1.99646 WP_000633547.1.99657 WP_000633547.1.99660 WP_000633547.1.99712 WP_000633547.1.99813 WP_000633547.1.99858 WP_000633547.1.99889 WP_000633547.1.99958 gi|379702497|ref|YP_005244225.1| gi|378701139|ref|YP_005183096.1| gi|378446623|ref|YP_005234255.1| gi|549480612|ref|YP_008614884.1| gi|526221589|ref|YP_008267440.1| gi|525828965|ref|YP_008251958.1| gi|194448343|ref|YP_002047273.1| gi|482905805|ref|YP_007904365.1| gi|386592931|ref|YP_006089331.1| gi|16766535|ref|NP_462150.1| gi|550902594|ref|YP_008671686.1| gi|378452056|ref|YP_005239416.1| gi|378990554|ref|YP_005253718.1| APC23973 gi|525836918|ref|YP_008253581.1| ABAM02000001|CDS_3774708-3775409 ABAO01000002|CDS_61069-60368 ABEL01000006|CDS_128029-128730 ABFH02000001|CDS_1760753-1760052 AE006468|CDS_3401013-3401714 CP001120|CDS_3423371-3424072 CP001363|CDS_3419266-3419967 FN424405|CDS_3423437-3424138 NZ_ACBF01000001|CDS_560244-560945 gi|383497893|ref|YP_005398582.1| gi|525814520|ref|YP_008244538.1| 454169.SeHA_C3531 99287.STM3236 gi|378985834|ref|YP_005248990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]