SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452345|ref|YP_005239705.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452345|ref|YP_005239705.1|
Domain Number 1 Region: 3-321
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.48e-120
Family Tex N-terminal region-like 0.00000000821
Further Details:      
 
Domain Number 2 Region: 322-468
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.6e-49
Family Tex RuvX-like domain-like 0.0000021
Further Details:      
 
Domain Number 3 Region: 469-557
Classification Level Classification E-value
Superfamily RuvA domain 2-like 5e-28
Family Tex HhH-containing domain-like 0.00013
Further Details:      
 
Domain Number 4 Region: 637-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.07e-24
Family Cold shock DNA-binding domain-like 0.0000377
Further Details:      
 
Domain Number 5 Region: 559-631
Classification Level Classification E-value
Superfamily RuvA domain 2-like 8e-20
Family Tex HhH-containing domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378452345|ref|YP_005239705.1|
Sequence length 775
Comment putative RNase R [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNDSFCRIIAGEIQANAGQVEAAVRLLDEGNTVPFIARYRKEITGGLDDTQLRNLETRLG
YLRELEDRRQAILKSISEQGKLTDELAGAINATLSKTELEDLYLPYKPKRRTRGQIAIEA
GLEPLADLLWNEPSHDPDVEAAKYIDGDKGVADTKAALDGARYILMERFAEDAALLAKVR
DYLWKNAHLVATVVSGKEEEGAKFRDYFDHHEPIANVPSHRALAMFRGRNEGILQLSLNA
DPQFDEPPKESYCEQIIMDHLGLRLNNAPADSWRKGVVSWTWRIKVLMHLETELMGTVRE
RAEDEAINVFARNLHDLLMAAPAGLRATMGLDPGLRTGVKVAVVDGTGKLVATDTIYPHT
GQAAKAATVIAALCEKYHVELVAIGNGTASRETERFYLDVQKQFPNVTAQKVIVSEAGAS
VYSASELAAQEFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQTQLAR
KLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQNIVAWRDENGQFQNRQQLLKVSR
LGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVERILAATQQALKDLMGNSNELRHLK
AADFTDDKFGVPTVSDIIKELEKPGRDPRPEFKTAQFADGVETMNDLLPGMILEGAVTNV
TNFGAFVDIGVHQDGLVHISSLSTKFVDDPHTVVKAGDIVKVKVLEVDLQRKRIALTMRL
DEQPGETAARRGGGADRAQGNRPASKAAKPRGRDAQPAGNSAMMDALAAAMGKKR
Download sequence
Identical sequences A0A0F6B7W1 A0A0H3NGY2 Q8ZLJ1
gi|378446880|ref|YP_005234512.1| 99287.STM3504 NP_462407.3.58477 gi|378990809|ref|YP_005253973.1| gi|378452345|ref|YP_005239705.1| gi|550902848|ref|YP_008671940.1| AE006468|CDS_3661126-3663453 CP001363|CDS_3675024-3677351 FN424405|CDS_3684198-3686525 gi|378701398|ref|YP_005183356.1| gi|549726058|ref|YP_008646248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]