SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452391|ref|YP_005239751.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452391|ref|YP_005239751.1|
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.75e-79
Family Pirin-like 0.00000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378452391|ref|YP_005239751.1|
Sequence length 231
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MIYLRKANDRGHANHGWLDSWHTFSFADYYDPNFMGFSALRVINDDVIDAGQGFGTHPHK
DMEILTYVLEGAVEHQDSMGNKEQVPAGEFQIMSAGTGVRHSEYNPSKTDRLRLYQIWII
PQETGITPRYEQRRFDAAQGKQLVLSPDARDGSLKVHQDMELYRWALLKDEQSVHQIAAE
RRVWIQVVKGNVTINGTKATTSDGLAIWDEQAISIHADSDSEVLLFDLPPV
Download sequence
Identical sequences A0A0F6B807 A0A0F7JBC5 A0A0H3BPQ3 A0A0H3NIR5 A0A0K6PSA8 A0A0L9F3Y0 A0A0M0PQB3 A0A0R9NJP6 A0A0U1FWM7 A0A1C2ZSS2 A0A1R2LCL6 A0A1S0ZTF4 A0A1S1AR57 A0A1X2UY66 A0A1X2Y663 A0A1Z3Q864 A0A221YR76 A0A265BAA5 A0A267SKN8 A0A2C6EXV3 A0A2D1X946 A0A2D1XLE9 A0A2H9YLF7 A0A2I6MGF5 A0A2I6MU63 A0A2I6N8B4 A0A2I6NL02 A0A2I6NZ18 A0A2K2ZGR2 E8XEP6 G5LFC5 G5LUV8 G5NJB0 G5PTZ0 G5QQZ7 G5R6W6 G5S259 G5S8Z0 Q7CPK2 Q8XFI4 S5HQL1 V1WVS1 V7V0X9
gi|383498181|ref|YP_005398870.1| gi|525828720|ref|YP_008251671.1| gi|194443245|ref|YP_002042788.1| gi|452122655|ref|YP_007472903.1| gi|16762758|ref|NP_458375.1| gi|207858782|ref|YP_002245433.1| gi|386593217|ref|YP_006089617.1| NP_458375.1.84458 NP_462445.1.58477 WP_000639789.1.100008 WP_000639789.1.100010 WP_000639789.1.100017 WP_000639789.1.100031 WP_000639789.1.100036 WP_000639789.1.100077 WP_000639789.1.100079 WP_000639789.1.100129 WP_000639789.1.100137 WP_000639789.1.100149 WP_000639789.1.100165 WP_000639789.1.100191 WP_000639789.1.100196 WP_000639789.1.1002 WP_000639789.1.100234 WP_000639789.1.100258 WP_000639789.1.100284 WP_000639789.1.100288 WP_000639789.1.100313 WP_000639789.1.100314 WP_000639789.1.100321 WP_000639789.1.100354 WP_000639789.1.100376 WP_000639789.1.100392 WP_000639789.1.100412 WP_000639789.1.100413 WP_000639789.1.100421 WP_000639789.1.100424 WP_000639789.1.100432 WP_000639789.1.100436 WP_000639789.1.100438 WP_000639789.1.100446 WP_000639789.1.100450 WP_000639789.1.100457 WP_000639789.1.100484 WP_000639789.1.100488 WP_000639789.1.100502 WP_000639789.1.100519 WP_000639789.1.100521 WP_000639789.1.100557 WP_000639789.1.100589 WP_000639789.1.100592 WP_000639789.1.100597 WP_000639789.1.100605 WP_000639789.1.100610 WP_000639789.1.100642 WP_000639789.1.100650 WP_000639789.1.100707 WP_000639789.1.100711 WP_000639789.1.100714 WP_000639789.1.100730 WP_000639789.1.100732 WP_000639789.1.100733 WP_000639789.1.100739 WP_000639789.1.10074 WP_000639789.1.10076 WP_000639789.1.100764 WP_000639789.1.100773 WP_000639789.1.100776 WP_000639789.1.100781 WP_000639789.1.100793 WP_000639789.1.100799 WP_000639789.1.10081 WP_000639789.1.100814 WP_000639789.1.100857 WP_000639789.1.100865 WP_000639789.1.100869 WP_000639789.1.100870 WP_000639789.1.100871 WP_000639789.1.100882 WP_000639789.1.100886 WP_000639789.1.100895 WP_000639789.1.100941 WP_000639789.1.100944 WP_000639789.1.100953 WP_000639789.1.101007 WP_000639789.1.101011 WP_000639789.1.101020 WP_000639789.1.101074 WP_000639789.1.101078 WP_000639789.1.10108 WP_000639789.1.101091 WP_000639789.1.101094 WP_000639789.1.101112 WP_000639789.1.101123 WP_000639789.1.101126 WP_000639789.1.101180 WP_000639789.1.101185 WP_000639789.1.101199 WP_000639789.1.101223 WP_000639789.1.101226 WP_000639789.1.10124 WP_000639789.1.101259 WP_000639789.1.101271 WP_000639789.1.101284 WP_000639789.1.101291 WP_000639789.1.1013 WP_000639789.1.101312 WP_000639789.1.101320 WP_000639789.1.101322 WP_000639789.1.101353 WP_000639789.1.101374 WP_000639789.1.101386 WP_000639789.1.101404 WP_000639789.1.101420 WP_000639789.1.101425 WP_000639789.1.101454 WP_000639789.1.101473 WP_000639789.1.101519 WP_000639789.1.101541 WP_000639789.1.101589 WP_000639789.1.101612 WP_000639789.1.101616 WP_000639789.1.101634 WP_000639789.1.101636 WP_000639789.1.101639 WP_000639789.1.101666 WP_000639789.1.101674 WP_000639789.1.101707 WP_000639789.1.101734 WP_000639789.1.101740 WP_000639789.1.101741 WP_000639789.1.101744 WP_000639789.1.101759 WP_000639789.1.10177 WP_000639789.1.101776 WP_000639789.1.101815 WP_000639789.1.101832 WP_000639789.1.101839 WP_000639789.1.101868 WP_000639789.1.101878 WP_000639789.1.101890 WP_000639789.1.101917 WP_000639789.1.101927 WP_000639789.1.101941 WP_000639789.1.101949 WP_000639789.1.101953 WP_000639789.1.101975 WP_000639789.1.102050 WP_000639789.1.102087 WP_000639789.1.102103 WP_000639789.1.102111 WP_000639789.1.10220 WP_000639789.1.10231 WP_000639789.1.10237 WP_000639789.1.10266 WP_000639789.1.10300 WP_000639789.1.10310 WP_000639789.1.10338 WP_000639789.1.1038 WP_000639789.1.10394 WP_000639789.1.104 WP_000639789.1.10401 WP_000639789.1.10428 WP_000639789.1.10429 WP_000639789.1.10439 WP_000639789.1.10459 WP_000639789.1.10463 WP_000639789.1.10465 WP_000639789.1.10475 WP_000639789.1.10498 WP_000639789.1.10511 WP_000639789.1.10514 WP_000639789.1.10530 WP_000639789.1.10532 WP_000639789.1.10547 WP_000639789.1.10562 WP_000639789.1.10566 WP_000639789.1.10568 WP_000639789.1.10595 WP_000639789.1.106 WP_000639789.1.10631 WP_000639789.1.10642 WP_000639789.1.10654 WP_000639789.1.10675 WP_000639789.1.10677 WP_000639789.1.10678 WP_000639789.1.10711 WP_000639789.1.10720 WP_000639789.1.10753 WP_000639789.1.10755 WP_000639789.1.10857 WP_000639789.1.10868 WP_000639789.1.10873 WP_000639789.1.10898 WP_000639789.1.10926 WP_000639789.1.10936 WP_000639789.1.10992 WP_000639789.1.11000 WP_000639789.1.11012 WP_000639789.1.11024 WP_000639789.1.11031 WP_000639789.1.11041 WP_000639789.1.11055 WP_000639789.1.11098 WP_000639789.1.1110 WP_000639789.1.11119 WP_000639789.1.11126 WP_000639789.1.11142 WP_000639789.1.11156 WP_000639789.1.11168 WP_000639789.1.11190 WP_000639789.1.11213 WP_000639789.1.11216 WP_000639789.1.11239 WP_000639789.1.11253 WP_000639789.1.11254 WP_000639789.1.11295 WP_000639789.1.113 WP_000639789.1.11314 WP_000639789.1.11362 WP_000639789.1.1137 WP_000639789.1.11385 WP_000639789.1.11405 WP_000639789.1.1142 WP_000639789.1.11426 WP_000639789.1.11429 WP_000639789.1.11444 WP_000639789.1.11455 WP_000639789.1.11458 WP_000639789.1.11479 WP_000639789.1.1150 WP_000639789.1.11511 WP_000639789.1.11518 WP_000639789.1.11526 WP_000639789.1.11528 WP_000639789.1.11532 WP_000639789.1.11543 WP_000639789.1.11544 WP_000639789.1.11557 WP_000639789.1.1156 WP_000639789.1.11565 WP_000639789.1.11567 WP_000639789.1.11588 WP_000639789.1.11603 WP_000639789.1.11638 WP_000639789.1.11677 WP_000639789.1.11681 WP_000639789.1.11687 WP_000639789.1.1169 WP_000639789.1.11735 WP_000639789.1.1174 WP_000639789.1.11763 WP_000639789.1.11772 WP_000639789.1.11824 WP_000639789.1.11834 WP_000639789.1.11841 WP_000639789.1.11868 WP_000639789.1.11875 WP_000639789.1.11883 WP_000639789.1.11897 WP_000639789.1.11900 WP_000639789.1.11908 WP_000639789.1.11914 WP_000639789.1.11936 WP_000639789.1.11938 WP_000639789.1.11964 WP_000639789.1.11978 WP_000639789.1.12007 WP_000639789.1.12017 WP_000639789.1.12025 WP_000639789.1.12027 WP_000639789.1.12040 WP_000639789.1.12061 WP_000639789.1.1207 WP_000639789.1.12106 WP_000639789.1.12114 WP_000639789.1.12141 WP_000639789.1.12144 WP_000639789.1.1215 WP_000639789.1.12159 WP_000639789.1.12160 WP_000639789.1.12168 WP_000639789.1.12172 WP_000639789.1.12192 WP_000639789.1.1224 WP_000639789.1.12282 WP_000639789.1.12340 WP_000639789.1.12351 WP_000639789.1.12364 WP_000639789.1.12370 WP_000639789.1.12374 WP_000639789.1.1239 WP_000639789.1.12396 WP_000639789.1.12397 WP_000639789.1.12398 WP_000639789.1.12441 WP_000639789.1.12456 WP_000639789.1.1246 WP_000639789.1.12472 WP_000639789.1.12484 WP_000639789.1.12485 WP_000639789.1.12546 WP_000639789.1.12568 WP_000639789.1.12569 WP_000639789.1.12581 WP_000639789.1.12585 WP_000639789.1.12620 WP_000639789.1.1264 WP_000639789.1.12648 WP_000639789.1.12683 WP_000639789.1.12696 WP_000639789.1.12701 WP_000639789.1.12718 WP_000639789.1.12726 WP_000639789.1.12727 WP_000639789.1.12728 WP_000639789.1.12741 WP_000639789.1.12834 WP_000639789.1.12877 WP_000639789.1.12879 WP_000639789.1.12936 WP_000639789.1.1299 WP_000639789.1.12995 WP_000639789.1.1300 WP_000639789.1.13027 WP_000639789.1.13076 WP_000639789.1.13101 WP_000639789.1.13102 WP_000639789.1.13106 WP_000639789.1.13108 WP_000639789.1.13130 WP_000639789.1.13161 WP_000639789.1.13207 WP_000639789.1.1321 WP_000639789.1.13247 WP_000639789.1.1326 WP_000639789.1.13268 WP_000639789.1.13274 WP_000639789.1.13291 WP_000639789.1.133 WP_000639789.1.13314 WP_000639789.1.13334 WP_000639789.1.13338 WP_000639789.1.13342 WP_000639789.1.13352 WP_000639789.1.13367 WP_000639789.1.13391 WP_000639789.1.13406 WP_000639789.1.13414 WP_000639789.1.13429 WP_000639789.1.13440 WP_000639789.1.13443 WP_000639789.1.13446 WP_000639789.1.1346 WP_000639789.1.13476 WP_000639789.1.13488 WP_000639789.1.13509 WP_000639789.1.13573 WP_000639789.1.13599 WP_000639789.1.13625 WP_000639789.1.13661 WP_000639789.1.13669 WP_000639789.1.13677 WP_000639789.1.13686 WP_000639789.1.13691 WP_000639789.1.1372 WP_000639789.1.13732 WP_000639789.1.13741 WP_000639789.1.13764 WP_000639789.1.13819 WP_000639789.1.1382 WP_000639789.1.13857 WP_000639789.1.1387 WP_000639789.1.13908 WP_000639789.1.13932 WP_000639789.1.13968 WP_000639789.1.1397 WP_000639789.1.13972 WP_000639789.1.140 WP_000639789.1.14001 WP_000639789.1.1401 WP_000639789.1.14050 WP_000639789.1.14056 WP_000639789.1.1408 WP_000639789.1.14089 WP_000639789.1.14099 WP_000639789.1.14111 WP_000639789.1.1412 WP_000639789.1.14120 WP_000639789.1.14123 WP_000639789.1.14150 WP_000639789.1.14151 WP_000639789.1.14191 WP_000639789.1.14197 WP_000639789.1.14212 WP_000639789.1.14239 WP_000639789.1.14280 WP_000639789.1.14320 WP_000639789.1.14333 WP_000639789.1.14369 WP_000639789.1.14379 WP_000639789.1.14399 WP_000639789.1.1440 WP_000639789.1.14406 WP_000639789.1.14410 WP_000639789.1.14436 WP_000639789.1.14444 WP_000639789.1.14458 WP_000639789.1.14466 WP_000639789.1.14467 WP_000639789.1.14474 WP_000639789.1.14495 WP_000639789.1.14500 WP_000639789.1.14505 WP_000639789.1.14519 WP_000639789.1.14524 WP_000639789.1.14526 WP_000639789.1.14550 WP_000639789.1.14554 WP_000639789.1.14575 WP_000639789.1.146 WP_000639789.1.14618 WP_000639789.1.14688 WP_000639789.1.14701 WP_000639789.1.14703 WP_000639789.1.14706 WP_000639789.1.14708 WP_000639789.1.14719 WP_000639789.1.14725 WP_000639789.1.1473 WP_000639789.1.14765 WP_000639789.1.14789 WP_000639789.1.14793 WP_000639789.1.14808 WP_000639789.1.14810 WP_000639789.1.14819 WP_000639789.1.14852 WP_000639789.1.14876 WP_000639789.1.14877 WP_000639789.1.1489 WP_000639789.1.14894 WP_000639789.1.14913 WP_000639789.1.14927 WP_000639789.1.14930 WP_000639789.1.14932 WP_000639789.1.14936 WP_000639789.1.14947 WP_000639789.1.14948 WP_000639789.1.14964 WP_000639789.1.15046 WP_000639789.1.15055 WP_000639789.1.15067 WP_000639789.1.15079 WP_000639789.1.15100 WP_000639789.1.15102 WP_000639789.1.15124 WP_000639789.1.15184 WP_000639789.1.15214 WP_000639789.1.15223 WP_000639789.1.15226 WP_000639789.1.15244 WP_000639789.1.15265 WP_000639789.1.15276 WP_000639789.1.15316 WP_000639789.1.15318 WP_000639789.1.15353 WP_000639789.1.15362 WP_000639789.1.15369 WP_000639789.1.1540 WP_000639789.1.15415 WP_000639789.1.15423 WP_000639789.1.15433 WP_000639789.1.15439 WP_000639789.1.15483 WP_000639789.1.15487 WP_000639789.1.15508 WP_000639789.1.15535 WP_000639789.1.15581 WP_000639789.1.15585 WP_000639789.1.15586 WP_000639789.1.15597 WP_000639789.1.15616 WP_000639789.1.15625 WP_000639789.1.15627 WP_000639789.1.15644 WP_000639789.1.1568 WP_000639789.1.15708 WP_000639789.1.15710 WP_000639789.1.15717 WP_000639789.1.15775 WP_000639789.1.15777 WP_000639789.1.15784 WP_000639789.1.15795 WP_000639789.1.158 WP_000639789.1.15830 WP_000639789.1.15835 WP_000639789.1.15862 WP_000639789.1.15881 WP_000639789.1.15905 WP_000639789.1.15909 WP_000639789.1.15910 WP_000639789.1.15912 WP_000639789.1.1592 WP_000639789.1.15922 WP_000639789.1.15970 WP_000639789.1.15986 WP_000639789.1.15995 WP_000639789.1.16000 WP_000639789.1.16004 WP_000639789.1.16028 WP_000639789.1.16032 WP_000639789.1.16046 WP_000639789.1.16047 WP_000639789.1.16051 WP_000639789.1.16058 WP_000639789.1.16062 WP_000639789.1.16063 WP_000639789.1.16103 WP_000639789.1.1611 WP_000639789.1.16150 WP_000639789.1.16155 WP_000639789.1.16166 WP_000639789.1.16172 WP_000639789.1.16201 WP_000639789.1.16226 WP_000639789.1.16233 WP_000639789.1.1626 WP_000639789.1.16264 WP_000639789.1.16273 WP_000639789.1.16284 WP_000639789.1.16328 WP_000639789.1.16331 WP_000639789.1.16344 WP_000639789.1.1635 WP_000639789.1.16361 WP_000639789.1.16363 WP_000639789.1.16365 WP_000639789.1.16366 WP_000639789.1.16394 WP_000639789.1.16452 WP_000639789.1.16453 WP_000639789.1.16461 WP_000639789.1.16462 WP_000639789.1.16465 WP_000639789.1.16468 WP_000639789.1.16474 WP_000639789.1.16522 WP_000639789.1.16525 WP_000639789.1.16551 WP_000639789.1.16565 WP_000639789.1.16581 WP_000639789.1.16588 WP_000639789.1.16614 WP_000639789.1.16650 WP_000639789.1.16658 WP_000639789.1.16666 WP_000639789.1.16673 WP_000639789.1.1668 WP_000639789.1.16686 WP_000639789.1.16691 WP_000639789.1.167 WP_000639789.1.16729 WP_000639789.1.16732 WP_000639789.1.16735 WP_000639789.1.16736 WP_000639789.1.1674 WP_000639789.1.16767 WP_000639789.1.16781 WP_000639789.1.16786 WP_000639789.1.16817 WP_000639789.1.16846 WP_000639789.1.16855 WP_000639789.1.16858 WP_000639789.1.16873 WP_000639789.1.16879 WP_000639789.1.1689 WP_000639789.1.16893 WP_000639789.1.16896 WP_000639789.1.16903 WP_000639789.1.16905 WP_000639789.1.16941 WP_000639789.1.16944 WP_000639789.1.16948 WP_000639789.1.16949 WP_000639789.1.16965 WP_000639789.1.16972 WP_000639789.1.1700 WP_000639789.1.17031 WP_000639789.1.17049 WP_000639789.1.17058 WP_000639789.1.17060 WP_000639789.1.17078 WP_000639789.1.17093 WP_000639789.1.17096 WP_000639789.1.17098 WP_000639789.1.17105 WP_000639789.1.17188 WP_000639789.1.17202 WP_000639789.1.17219 WP_000639789.1.1722 WP_000639789.1.17285 WP_000639789.1.17302 WP_000639789.1.17307 WP_000639789.1.17308 WP_000639789.1.1733 WP_000639789.1.17368 WP_000639789.1.1737 WP_000639789.1.17390 WP_000639789.1.174 WP_000639789.1.17405 WP_000639789.1.17406 WP_000639789.1.17439 WP_000639789.1.17447 WP_000639789.1.17480 WP_000639789.1.17482 WP_000639789.1.1749 WP_000639789.1.17504 WP_000639789.1.17513 WP_000639789.1.17525 WP_000639789.1.17543 WP_000639789.1.17546 WP_000639789.1.17560 WP_000639789.1.17563 WP_000639789.1.1757 WP_000639789.1.17578 WP_000639789.1.17583 WP_000639789.1.17622 WP_000639789.1.17629 WP_000639789.1.17659 WP_000639789.1.17667 WP_000639789.1.17686 WP_000639789.1.17693 WP_000639789.1.17702 WP_000639789.1.17703 WP_000639789.1.17705 WP_000639789.1.17732 WP_000639789.1.17741 WP_000639789.1.17743 WP_000639789.1.17747 WP_000639789.1.17755 WP_000639789.1.17840 WP_000639789.1.17865 WP_000639789.1.17886 WP_000639789.1.17891 WP_000639789.1.17901 WP_000639789.1.17914 WP_000639789.1.17919 WP_000639789.1.17936 WP_000639789.1.17956 WP_000639789.1.1798 WP_000639789.1.17991 WP_000639789.1.18005 WP_000639789.1.1801 WP_000639789.1.18019 WP_000639789.1.18021 WP_000639789.1.18056 WP_000639789.1.18061 WP_000639789.1.1807 WP_000639789.1.18092 WP_000639789.1.18099 WP_000639789.1.18103 WP_000639789.1.18109 WP_000639789.1.18111 WP_000639789.1.18122 WP_000639789.1.18124 WP_000639789.1.1814 WP_000639789.1.18144 WP_000639789.1.18149 WP_000639789.1.18163 WP_000639789.1.18173 WP_000639789.1.18177 WP_000639789.1.18178 WP_000639789.1.1818 WP_000639789.1.18192 WP_000639789.1.1825 WP_000639789.1.18254 WP_000639789.1.18265 WP_000639789.1.18267 WP_000639789.1.18270 WP_000639789.1.18280 WP_000639789.1.18281 WP_000639789.1.18282 WP_000639789.1.18328 WP_000639789.1.18358 WP_000639789.1.18370 WP_000639789.1.18384 WP_000639789.1.18406 WP_000639789.1.18426 WP_000639789.1.18441 WP_000639789.1.18468 WP_000639789.1.18474 WP_000639789.1.18485 WP_000639789.1.18489 WP_000639789.1.18513 WP_000639789.1.18607 WP_000639789.1.18610 WP_000639789.1.18641 WP_000639789.1.18678 WP_000639789.1.18686 WP_000639789.1.18692 WP_000639789.1.18705 WP_000639789.1.18715 WP_000639789.1.18722 WP_000639789.1.18737 WP_000639789.1.18766 WP_000639789.1.18776 WP_000639789.1.1880 WP_000639789.1.18822 WP_000639789.1.18847 WP_000639789.1.1885 WP_000639789.1.18860 WP_000639789.1.18881 WP_000639789.1.18886 WP_000639789.1.18895 WP_000639789.1.18922 WP_000639789.1.18940 WP_000639789.1.18949 WP_000639789.1.1895 WP_000639789.1.18959 WP_000639789.1.1897 WP_000639789.1.18972 WP_000639789.1.19001 WP_000639789.1.19006 WP_000639789.1.19030 WP_000639789.1.19044 WP_000639789.1.19053 WP_000639789.1.19055 WP_000639789.1.19064 WP_000639789.1.19084 WP_000639789.1.19093 WP_000639789.1.19163 WP_000639789.1.19187 WP_000639789.1.19228 WP_000639789.1.19273 WP_000639789.1.19288 WP_000639789.1.19291 WP_000639789.1.19300 WP_000639789.1.19320 WP_000639789.1.19340 WP_000639789.1.19357 WP_000639789.1.19373 WP_000639789.1.19422 WP_000639789.1.19433 WP_000639789.1.19454 WP_000639789.1.19456 WP_000639789.1.19458 WP_000639789.1.19460 WP_000639789.1.19461 WP_000639789.1.19496 WP_000639789.1.19535 WP_000639789.1.19538 WP_000639789.1.1954 WP_000639789.1.1955 WP_000639789.1.19588 WP_000639789.1.19589 WP_000639789.1.19614 WP_000639789.1.19616 WP_000639789.1.19642 WP_000639789.1.19656 WP_000639789.1.19663 WP_000639789.1.1968 WP_000639789.1.19686 WP_000639789.1.19702 WP_000639789.1.19706 WP_000639789.1.19723 WP_000639789.1.19724 WP_000639789.1.19731 WP_000639789.1.19740 WP_000639789.1.19749 WP_000639789.1.19784 WP_000639789.1.19793 WP_000639789.1.19794 WP_000639789.1.19802 WP_000639789.1.19809 WP_000639789.1.19823 WP_000639789.1.19834 WP_000639789.1.19851 WP_000639789.1.19863 WP_000639789.1.19867 WP_000639789.1.19884 WP_000639789.1.1992 WP_000639789.1.19970 WP_000639789.1.19975 WP_000639789.1.1998 WP_000639789.1.19987 WP_000639789.1.19999 WP_000639789.1.20 WP_000639789.1.20034 WP_000639789.1.20086 WP_000639789.1.20089 WP_000639789.1.20091 WP_000639789.1.2010 WP_000639789.1.20212 WP_000639789.1.20254 WP_000639789.1.20255 WP_000639789.1.2026 WP_000639789.1.20261 WP_000639789.1.20266 WP_000639789.1.20271 WP_000639789.1.20296 WP_000639789.1.20330 WP_000639789.1.20339 WP_000639789.1.20349 WP_000639789.1.20362 WP_000639789.1.20364 WP_000639789.1.20391 WP_000639789.1.2041 WP_000639789.1.20415 WP_000639789.1.20418 WP_000639789.1.20419 WP_000639789.1.20425 WP_000639789.1.20437 WP_000639789.1.20443 WP_000639789.1.20446 WP_000639789.1.20465 WP_000639789.1.20488 WP_000639789.1.20492 WP_000639789.1.20503 WP_000639789.1.20525 WP_000639789.1.2053 WP_000639789.1.2054 WP_000639789.1.20553 WP_000639789.1.20573 WP_000639789.1.20614 WP_000639789.1.20626 WP_000639789.1.20631 WP_000639789.1.20635 WP_000639789.1.20646 WP_000639789.1.20695 WP_000639789.1.20700 WP_000639789.1.20718 WP_000639789.1.2073 WP_000639789.1.20740 WP_000639789.1.20760 WP_000639789.1.20767 WP_000639789.1.20787 WP_000639789.1.20828 WP_000639789.1.20839 WP_000639789.1.20862 WP_000639789.1.2087 WP_000639789.1.20883 WP_000639789.1.20886 WP_000639789.1.20894 WP_000639789.1.20900 WP_000639789.1.20908 WP_000639789.1.2091 WP_000639789.1.20947 WP_000639789.1.20953 WP_000639789.1.2101 WP_000639789.1.21010 WP_000639789.1.21049 WP_000639789.1.2106 WP_000639789.1.21062 WP_000639789.1.2107 WP_000639789.1.21075 WP_000639789.1.21079 WP_000639789.1.21086 WP_000639789.1.21089 WP_000639789.1.21103 WP_000639789.1.21136 WP_000639789.1.21144 WP_000639789.1.21146 WP_000639789.1.2116 WP_000639789.1.21162 WP_000639789.1.21165 WP_000639789.1.21181 WP_000639789.1.21184 WP_000639789.1.21185 WP_000639789.1.21194 WP_000639789.1.21202 WP_000639789.1.21241 WP_000639789.1.21245 WP_000639789.1.21246 WP_000639789.1.21260 WP_000639789.1.21269 WP_000639789.1.21286 WP_000639789.1.2130 WP_000639789.1.21309 WP_000639789.1.21326 WP_000639789.1.21332 WP_000639789.1.21351 WP_000639789.1.21362 WP_000639789.1.21366 WP_000639789.1.21399 WP_000639789.1.21400 WP_000639789.1.21404 WP_000639789.1.21423 WP_000639789.1.21443 WP_000639789.1.21453 WP_000639789.1.2146 WP_000639789.1.21492 WP_000639789.1.21497 WP_000639789.1.21499 WP_000639789.1.21548 WP_000639789.1.21603 WP_000639789.1.2166 WP_000639789.1.21674 WP_000639789.1.21681 WP_000639789.1.21692 WP_000639789.1.21715 WP_000639789.1.21730 WP_000639789.1.21750 WP_000639789.1.21751 WP_000639789.1.21757 WP_000639789.1.21792 WP_000639789.1.21825 WP_000639789.1.21845 WP_000639789.1.21877 WP_000639789.1.21909 WP_000639789.1.21910 WP_000639789.1.21946 WP_000639789.1.21950 WP_000639789.1.21966 WP_000639789.1.21981 WP_000639789.1.21991 WP_000639789.1.22019 WP_000639789.1.22024 WP_000639789.1.22030 WP_000639789.1.2205 WP_000639789.1.22051 WP_000639789.1.22062 WP_000639789.1.22064 WP_000639789.1.22067 WP_000639789.1.22096 WP_000639789.1.22117 WP_000639789.1.22118 WP_000639789.1.22126 WP_000639789.1.22136 WP_000639789.1.22158 WP_000639789.1.2216 WP_000639789.1.22162 WP_000639789.1.22169 WP_000639789.1.22205 WP_000639789.1.22208 WP_000639789.1.2221 WP_000639789.1.22235 WP_000639789.1.2224 WP_000639789.1.2227 WP_000639789.1.22296 WP_000639789.1.22315 WP_000639789.1.22323 WP_000639789.1.22337 WP_000639789.1.22346 WP_000639789.1.2235 WP_000639789.1.22373 WP_000639789.1.22379 WP_000639789.1.22388 WP_000639789.1.22427 WP_000639789.1.22449 WP_000639789.1.22453 WP_000639789.1.22454 WP_000639789.1.2246 WP_000639789.1.22460 WP_000639789.1.22476 WP_000639789.1.22485 WP_000639789.1.22514 WP_000639789.1.22537 WP_000639789.1.22565 WP_000639789.1.22575 WP_000639789.1.22582 WP_000639789.1.22590 WP_000639789.1.22595 WP_000639789.1.22604 WP_000639789.1.22605 WP_000639789.1.22614 WP_000639789.1.22620 WP_000639789.1.22676 WP_000639789.1.22683 WP_000639789.1.22758 WP_000639789.1.22760 WP_000639789.1.2283 WP_000639789.1.2284 WP_000639789.1.22855 WP_000639789.1.22857 WP_000639789.1.22864 WP_000639789.1.22870 WP_000639789.1.22880 WP_000639789.1.22895 WP_000639789.1.22902 WP_000639789.1.22926 WP_000639789.1.22943 WP_000639789.1.22947 WP_000639789.1.22967 WP_000639789.1.22979 WP_000639789.1.23010 WP_000639789.1.23040 WP_000639789.1.23058 WP_000639789.1.23102 WP_000639789.1.23114 WP_000639789.1.2314 WP_000639789.1.23155 WP_000639789.1.23175 WP_000639789.1.23192 WP_000639789.1.23201 WP_000639789.1.23218 WP_000639789.1.2324 WP_000639789.1.23246 WP_000639789.1.23259 WP_000639789.1.2331 WP_000639789.1.23311 WP_000639789.1.2332 WP_000639789.1.23329 WP_000639789.1.23340 WP_000639789.1.23343 WP_000639789.1.2336 WP_000639789.1.23365 WP_000639789.1.23379 WP_000639789.1.23409 WP_000639789.1.23412 WP_000639789.1.2342 WP_000639789.1.23426 WP_000639789.1.23442 WP_000639789.1.23444 WP_000639789.1.23460 WP_000639789.1.23466 WP_000639789.1.23472 WP_000639789.1.23482 WP_000639789.1.23485 WP_000639789.1.23492 WP_000639789.1.235 WP_000639789.1.23500 WP_000639789.1.23503 WP_000639789.1.23509 WP_000639789.1.23513 WP_000639789.1.23515 WP_000639789.1.23529 WP_000639789.1.23548 WP_000639789.1.23571 WP_000639789.1.2358 WP_000639789.1.23587 WP_000639789.1.23604 WP_000639789.1.23621 WP_000639789.1.23629 WP_000639789.1.23631 WP_000639789.1.23634 WP_000639789.1.2364 WP_000639789.1.23646 WP_000639789.1.23679 WP_000639789.1.237 WP_000639789.1.23707 WP_000639789.1.23720 WP_000639789.1.23728 WP_000639789.1.23736 WP_000639789.1.23746 WP_000639789.1.2375 WP_000639789.1.23755 WP_000639789.1.23783 WP_000639789.1.23786 WP_000639789.1.23787 WP_000639789.1.2380 WP_000639789.1.23801 WP_000639789.1.23819 WP_000639789.1.23932 WP_000639789.1.23959 WP_000639789.1.24017 WP_000639789.1.24028 WP_000639789.1.24061 WP_000639789.1.24082 WP_000639789.1.24083 WP_000639789.1.24117 WP_000639789.1.24125 WP_000639789.1.24138 WP_000639789.1.24145 WP_000639789.1.2415 WP_000639789.1.24153 WP_000639789.1.24158 WP_000639789.1.24163 WP_000639789.1.24206 WP_000639789.1.24214 WP_000639789.1.24250 WP_000639789.1.24259 WP_000639789.1.24291 WP_000639789.1.24297 WP_000639789.1.24303 WP_000639789.1.24308 WP_000639789.1.24322 WP_000639789.1.24325 WP_000639789.1.24355 WP_000639789.1.24361 WP_000639789.1.24375 WP_000639789.1.24376 WP_000639789.1.24400 WP_000639789.1.24408 WP_000639789.1.24409 WP_000639789.1.24419 WP_000639789.1.24420 WP_000639789.1.24433 WP_000639789.1.24450 WP_000639789.1.24476 WP_000639789.1.24494 WP_000639789.1.24555 WP_000639789.1.24578 WP_000639789.1.24619 WP_000639789.1.24643 WP_000639789.1.2467 WP_000639789.1.24673 WP_000639789.1.24686 WP_000639789.1.24688 WP_000639789.1.24716 WP_000639789.1.24723 WP_000639789.1.24727 WP_000639789.1.24737 WP_000639789.1.24779 WP_000639789.1.24803 WP_000639789.1.2481 WP_000639789.1.24832 WP_000639789.1.24839 WP_000639789.1.24873 WP_000639789.1.24901 WP_000639789.1.24944 WP_000639789.1.24964 WP_000639789.1.24995 WP_000639789.1.25008 WP_000639789.1.25015 WP_000639789.1.25017 WP_000639789.1.25032 WP_000639789.1.25041 WP_000639789.1.25053 WP_000639789.1.25064 WP_000639789.1.25119 WP_000639789.1.25140 WP_000639789.1.25159 WP_000639789.1.25175 WP_000639789.1.25185 WP_000639789.1.25196 WP_000639789.1.25206 WP_000639789.1.25210 WP_000639789.1.25217 WP_000639789.1.25219 WP_000639789.1.25229 WP_000639789.1.2525 WP_000639789.1.25297 WP_000639789.1.25304 WP_000639789.1.25354 WP_000639789.1.25374 WP_000639789.1.25405 WP_000639789.1.25421 WP_000639789.1.25426 WP_000639789.1.25454 WP_000639789.1.25475 WP_000639789.1.25490 WP_000639789.1.25493 WP_000639789.1.25498 WP_000639789.1.25508 WP_000639789.1.25512 WP_000639789.1.2554 WP_000639789.1.25546 WP_000639789.1.25564 WP_000639789.1.25596 WP_000639789.1.25603 WP_000639789.1.25618 WP_000639789.1.2562 WP_000639789.1.25666 WP_000639789.1.25668 WP_000639789.1.25690 WP_000639789.1.2570 WP_000639789.1.25703 WP_000639789.1.25708 WP_000639789.1.25709 WP_000639789.1.25722 WP_000639789.1.25740 WP_000639789.1.25780 WP_000639789.1.25793 WP_000639789.1.25807 WP_000639789.1.25809 WP_000639789.1.2581 WP_000639789.1.25814 WP_000639789.1.25821 WP_000639789.1.25825 WP_000639789.1.25833 WP_000639789.1.25835 WP_000639789.1.25882 WP_000639789.1.25911 WP_000639789.1.25928 WP_000639789.1.25932 WP_000639789.1.25951 WP_000639789.1.25962 WP_000639789.1.25963 WP_000639789.1.25988 WP_000639789.1.26001 WP_000639789.1.26027 WP_000639789.1.26034 WP_000639789.1.26075 WP_000639789.1.26083 WP_000639789.1.26093 WP_000639789.1.26107 WP_000639789.1.26123 WP_000639789.1.26129 WP_000639789.1.2615 WP_000639789.1.26194 WP_000639789.1.26213 WP_000639789.1.26217 WP_000639789.1.26224 WP_000639789.1.26230 WP_000639789.1.26232 WP_000639789.1.26269 WP_000639789.1.26272 WP_000639789.1.26282 WP_000639789.1.26286 WP_000639789.1.26288 WP_000639789.1.26311 WP_000639789.1.26319 WP_000639789.1.26363 WP_000639789.1.26384 WP_000639789.1.26394 WP_000639789.1.26426 WP_000639789.1.26429 WP_000639789.1.26440 WP_000639789.1.26441 WP_000639789.1.26491 WP_000639789.1.26493 WP_000639789.1.26512 WP_000639789.1.26532 WP_000639789.1.2654 WP_000639789.1.26551 WP_000639789.1.26554 WP_000639789.1.26563 WP_000639789.1.26567 WP_000639789.1.26582 WP_000639789.1.26587 WP_000639789.1.26636 WP_000639789.1.26646 WP_000639789.1.2667 WP_000639789.1.26689 WP_000639789.1.26709 WP_000639789.1.2672 WP_000639789.1.26741 WP_000639789.1.26758 WP_000639789.1.26787 WP_000639789.1.2679 WP_000639789.1.26794 WP_000639789.1.26882 WP_000639789.1.26892 WP_000639789.1.26908 WP_000639789.1.26919 WP_000639789.1.2692 WP_000639789.1.26924 WP_000639789.1.26928 WP_000639789.1.26936 WP_000639789.1.26980 WP_000639789.1.270 WP_000639789.1.27008 WP_000639789.1.27010 WP_000639789.1.27027 WP_000639789.1.27055 WP_000639789.1.27070 WP_000639789.1.27072 WP_000639789.1.27077 WP_000639789.1.27084 WP_000639789.1.27086 WP_000639789.1.27087 WP_000639789.1.27111 WP_000639789.1.27115 WP_000639789.1.27122 WP_000639789.1.2713 WP_000639789.1.27169 WP_000639789.1.2717 WP_000639789.1.27173 WP_000639789.1.27206 WP_000639789.1.27223 WP_000639789.1.27228 WP_000639789.1.27255 WP_000639789.1.27272 WP_000639789.1.27279 WP_000639789.1.27282 WP_000639789.1.27285 WP_000639789.1.27309 WP_000639789.1.27314 WP_000639789.1.27329 WP_000639789.1.27361 WP_000639789.1.27383 WP_000639789.1.27419 WP_000639789.1.27423 WP_000639789.1.27522 WP_000639789.1.27523 WP_000639789.1.27535 WP_000639789.1.27544 WP_000639789.1.27547 WP_000639789.1.27561 WP_000639789.1.27565 WP_000639789.1.27595 WP_000639789.1.27598 WP_000639789.1.2763 WP_000639789.1.27632 WP_000639789.1.27638 WP_000639789.1.27658 WP_000639789.1.27665 WP_000639789.1.27679 WP_000639789.1.27706 WP_000639789.1.27707 WP_000639789.1.27713 WP_000639789.1.27755 WP_000639789.1.27761 WP_000639789.1.2777 WP_000639789.1.27775 WP_000639789.1.27776 WP_000639789.1.27785 WP_000639789.1.27800 WP_000639789.1.27833 WP_000639789.1.27857 WP_000639789.1.27883 WP_000639789.1.27900 WP_000639789.1.27928 WP_000639789.1.27945 WP_000639789.1.27969 WP_000639789.1.27977 WP_000639789.1.27995 WP_000639789.1.28004 WP_000639789.1.28032 WP_000639789.1.28037 WP_000639789.1.28056 WP_000639789.1.28073 WP_000639789.1.2809 WP_000639789.1.28094 WP_000639789.1.28116 WP_000639789.1.28126 WP_000639789.1.28139 WP_000639789.1.28155 WP_000639789.1.28170 WP_000639789.1.28198 WP_000639789.1.28200 WP_000639789.1.2822 WP_000639789.1.28225 WP_000639789.1.28229 WP_000639789.1.28232 WP_000639789.1.28233 WP_000639789.1.28235 WP_000639789.1.28267 WP_000639789.1.2829 WP_000639789.1.28301 WP_000639789.1.28302 WP_000639789.1.28303 WP_000639789.1.2835 WP_000639789.1.28370 WP_000639789.1.28384 WP_000639789.1.28386 WP_000639789.1.28393 WP_000639789.1.28395 WP_000639789.1.284 WP_000639789.1.2845 WP_000639789.1.28462 WP_000639789.1.28479 WP_000639789.1.28504 WP_000639789.1.2853 WP_000639789.1.28538 WP_000639789.1.28570 WP_000639789.1.28575 WP_000639789.1.28612 WP_000639789.1.28620 WP_000639789.1.28625 WP_000639789.1.28627 WP_000639789.1.28655 WP_000639789.1.28673 WP_000639789.1.28692 WP_000639789.1.28694 WP_000639789.1.287 WP_000639789.1.2873 WP_000639789.1.28773 WP_000639789.1.28775 WP_000639789.1.2879 WP_000639789.1.28830 WP_000639789.1.2890 WP_000639789.1.28917 WP_000639789.1.28921 WP_000639789.1.28938 WP_000639789.1.28946 WP_000639789.1.28948 WP_000639789.1.28962 WP_000639789.1.29006 WP_000639789.1.29010 WP_000639789.1.29023 WP_000639789.1.29042 WP_000639789.1.2905 WP_000639789.1.2907 WP_000639789.1.29081 WP_000639789.1.29089 WP_000639789.1.29099 WP_000639789.1.2910 WP_000639789.1.29113 WP_000639789.1.29130 WP_000639789.1.29153 WP_000639789.1.29168 WP_000639789.1.29174 WP_000639789.1.29190 WP_000639789.1.29203 WP_000639789.1.29218 WP_000639789.1.29237 WP_000639789.1.2924 WP_000639789.1.29248 WP_000639789.1.29255 WP_000639789.1.29265 WP_000639789.1.29288 WP_000639789.1.2932 WP_000639789.1.29349 WP_000639789.1.29379 WP_000639789.1.29389 WP_000639789.1.29422 WP_000639789.1.29436 WP_000639789.1.29439 WP_000639789.1.29454 WP_000639789.1.2946 WP_000639789.1.29462 WP_000639789.1.29509 WP_000639789.1.29530 WP_000639789.1.29563 WP_000639789.1.29576 WP_000639789.1.29588 WP_000639789.1.29593 WP_000639789.1.29601 WP_000639789.1.29606 WP_000639789.1.29615 WP_000639789.1.29619 WP_000639789.1.29682 WP_000639789.1.29704 WP_000639789.1.29727 WP_000639789.1.29743 WP_000639789.1.29768 WP_000639789.1.29774 WP_000639789.1.29782 WP_000639789.1.29827 WP_000639789.1.29833 WP_000639789.1.2984 WP_000639789.1.29845 WP_000639789.1.29851 WP_000639789.1.29865 WP_000639789.1.29886 WP_000639789.1.29898 WP_000639789.1.29919 WP_000639789.1.29924 WP_000639789.1.2994 WP_000639789.1.29964 WP_000639789.1.29969 WP_000639789.1.29983 WP_000639789.1.29990 WP_000639789.1.30006 WP_000639789.1.30009 WP_000639789.1.30013 WP_000639789.1.3002 WP_000639789.1.30022 WP_000639789.1.30027 WP_000639789.1.30034 WP_000639789.1.30049 WP_000639789.1.3005 WP_000639789.1.30058 WP_000639789.1.30059 WP_000639789.1.30086 WP_000639789.1.30093 WP_000639789.1.30165 WP_000639789.1.3017 WP_000639789.1.30170 WP_000639789.1.30172 WP_000639789.1.30179 WP_000639789.1.30180 WP_000639789.1.30185 WP_000639789.1.30195 WP_000639789.1.30202 WP_000639789.1.30210 WP_000639789.1.30213 WP_000639789.1.30246 WP_000639789.1.30278 WP_000639789.1.30354 WP_000639789.1.30356 WP_000639789.1.30357 WP_000639789.1.30362 WP_000639789.1.3042 WP_000639789.1.30421 WP_000639789.1.30425 WP_000639789.1.30440 WP_000639789.1.30448 WP_000639789.1.30469 WP_000639789.1.30489 WP_000639789.1.30492 WP_000639789.1.30505 WP_000639789.1.30507 WP_000639789.1.30517 WP_000639789.1.30535 WP_000639789.1.30542 WP_000639789.1.30544 WP_000639789.1.30547 WP_000639789.1.30548 WP_000639789.1.30556 WP_000639789.1.30572 WP_000639789.1.30573 WP_000639789.1.30585 WP_000639789.1.30589 WP_000639789.1.30602 WP_000639789.1.30618 WP_000639789.1.30619 WP_000639789.1.30627 WP_000639789.1.30635 WP_000639789.1.30664 WP_000639789.1.3067 WP_000639789.1.3068 WP_000639789.1.30688 WP_000639789.1.30752 WP_000639789.1.3076 WP_000639789.1.30794 WP_000639789.1.3080 WP_000639789.1.30803 WP_000639789.1.30806 WP_000639789.1.30823 WP_000639789.1.30833 WP_000639789.1.30835 WP_000639789.1.3089 WP_000639789.1.30909 WP_000639789.1.30934 WP_000639789.1.3095 WP_000639789.1.30967 WP_000639789.1.30968 WP_000639789.1.30972 WP_000639789.1.31 WP_000639789.1.31011 WP_000639789.1.31042 WP_000639789.1.31046 WP_000639789.1.31066 WP_000639789.1.31078 WP_000639789.1.31092 WP_000639789.1.31107 WP_000639789.1.31111 WP_000639789.1.31122 WP_000639789.1.3113 WP_000639789.1.31139 WP_000639789.1.3114 WP_000639789.1.31145 WP_000639789.1.31156 WP_000639789.1.31167 WP_000639789.1.31182 WP_000639789.1.31185 WP_000639789.1.3119 WP_000639789.1.31190 WP_000639789.1.31195 WP_000639789.1.31196 WP_000639789.1.31198 WP_000639789.1.31205 WP_000639789.1.3121 WP_000639789.1.31210 WP_000639789.1.31214 WP_000639789.1.31219 WP_000639789.1.31222 WP_000639789.1.31223 WP_000639789.1.3124 WP_000639789.1.31262 WP_000639789.1.31272 WP_000639789.1.31281 WP_000639789.1.31303 WP_000639789.1.3131 WP_000639789.1.31335 WP_000639789.1.31352 WP_000639789.1.31362 WP_000639789.1.31389 WP_000639789.1.31413 WP_000639789.1.31435 WP_000639789.1.31446 WP_000639789.1.31451 WP_000639789.1.31476 WP_000639789.1.31504 WP_000639789.1.31515 WP_000639789.1.31533 WP_000639789.1.31578 WP_000639789.1.31585 WP_000639789.1.31658 WP_000639789.1.31665 WP_000639789.1.3167 WP_000639789.1.3170 WP_000639789.1.31720 WP_000639789.1.31725 WP_000639789.1.31782 WP_000639789.1.31799 WP_000639789.1.31836 WP_000639789.1.31854 WP_000639789.1.31895 WP_000639789.1.31901 WP_000639789.1.31927 WP_000639789.1.31940 WP_000639789.1.31951 WP_000639789.1.31952 WP_000639789.1.31967 WP_000639789.1.31972 WP_000639789.1.31983 WP_000639789.1.32038 WP_000639789.1.32041 WP_000639789.1.32042 WP_000639789.1.32054 WP_000639789.1.32056 WP_000639789.1.3207 WP_000639789.1.32109 WP_000639789.1.32116 WP_000639789.1.32170 WP_000639789.1.32189 WP_000639789.1.32192 WP_000639789.1.32202 WP_000639789.1.32204 WP_000639789.1.32206 WP_000639789.1.32252 WP_000639789.1.32260 WP_000639789.1.32263 WP_000639789.1.32274 WP_000639789.1.32275 WP_000639789.1.32293 WP_000639789.1.32299 WP_000639789.1.32309 WP_000639789.1.32357 WP_000639789.1.32368 WP_000639789.1.32408 WP_000639789.1.32422 WP_000639789.1.32423 WP_000639789.1.32424 WP_000639789.1.32425 WP_000639789.1.32438 WP_000639789.1.32458 WP_000639789.1.32459 WP_000639789.1.32460 WP_000639789.1.32491 WP_000639789.1.32515 WP_000639789.1.32519 WP_000639789.1.32527 WP_000639789.1.32529 WP_000639789.1.32545 WP_000639789.1.32563 WP_000639789.1.32578 WP_000639789.1.32617 WP_000639789.1.32629 WP_000639789.1.32660 WP_000639789.1.32668 WP_000639789.1.3270 WP_000639789.1.32702 WP_000639789.1.32714 WP_000639789.1.32725 WP_000639789.1.32740 WP_000639789.1.32747 WP_000639789.1.32786 WP_000639789.1.32804 WP_000639789.1.32832 WP_000639789.1.32838 WP_000639789.1.32848 WP_000639789.1.32860 WP_000639789.1.32868 WP_000639789.1.32881 WP_000639789.1.32899 WP_000639789.1.3290 WP_000639789.1.32900 WP_000639789.1.32907 WP_000639789.1.32930 WP_000639789.1.32940 WP_000639789.1.32941 WP_000639789.1.3296 WP_000639789.1.32966 WP_000639789.1.32977 WP_000639789.1.32985 WP_000639789.1.33010 WP_000639789.1.33030 WP_000639789.1.33037 WP_000639789.1.3305 WP_000639789.1.33051 WP_000639789.1.33065 WP_000639789.1.3310 WP_000639789.1.33106 WP_000639789.1.33114 WP_000639789.1.33122 WP_000639789.1.33127 WP_000639789.1.33143 WP_000639789.1.33144 WP_000639789.1.3315 WP_000639789.1.33208 WP_000639789.1.33214 WP_000639789.1.33247 WP_000639789.1.33248 WP_000639789.1.33253 WP_000639789.1.33261 WP_000639789.1.33270 WP_000639789.1.33280 WP_000639789.1.33283 WP_000639789.1.333 WP_000639789.1.33313 WP_000639789.1.33339 WP_000639789.1.33382 WP_000639789.1.33392 WP_000639789.1.33409 WP_000639789.1.33490 WP_000639789.1.33492 WP_000639789.1.33499 WP_000639789.1.335 WP_000639789.1.33501 WP_000639789.1.33529 WP_000639789.1.33553 WP_000639789.1.3356 WP_000639789.1.33580 WP_000639789.1.33586 WP_000639789.1.33592 WP_000639789.1.33609 WP_000639789.1.33629 WP_000639789.1.3364 WP_000639789.1.33659 WP_000639789.1.33689 WP_000639789.1.33693 WP_000639789.1.3370 WP_000639789.1.33730 WP_000639789.1.33741 WP_000639789.1.33825 WP_000639789.1.33840 WP_000639789.1.33865 WP_000639789.1.33894 WP_000639789.1.3392 WP_000639789.1.33926 WP_000639789.1.3394 WP_000639789.1.3395 WP_000639789.1.33957 WP_000639789.1.3396 WP_000639789.1.33969 WP_000639789.1.33986 WP_000639789.1.34 WP_000639789.1.34001 WP_000639789.1.34043 WP_000639789.1.34059 WP_000639789.1.34075 WP_000639789.1.34091 WP_000639789.1.34107 WP_000639789.1.34118 WP_000639789.1.34126 WP_000639789.1.34179 WP_000639789.1.34184 WP_000639789.1.34185 WP_000639789.1.34211 WP_000639789.1.34214 WP_000639789.1.34234 WP_000639789.1.34257 WP_000639789.1.34259 WP_000639789.1.34279 WP_000639789.1.34284 WP_000639789.1.34292 WP_000639789.1.34319 WP_000639789.1.34330 WP_000639789.1.34376 WP_000639789.1.3438 WP_000639789.1.34382 WP_000639789.1.34417 WP_000639789.1.34431 WP_000639789.1.34453 WP_000639789.1.34454 WP_000639789.1.34458 WP_000639789.1.34484 WP_000639789.1.34517 WP_000639789.1.34530 WP_000639789.1.34610 WP_000639789.1.34614 WP_000639789.1.34647 WP_000639789.1.34659 WP_000639789.1.34665 WP_000639789.1.34684 WP_000639789.1.34694 WP_000639789.1.34703 WP_000639789.1.34704 WP_000639789.1.34707 WP_000639789.1.34711 WP_000639789.1.34745 WP_000639789.1.34751 WP_000639789.1.3476 WP_000639789.1.34801 WP_000639789.1.34808 WP_000639789.1.34820 WP_000639789.1.34824 WP_000639789.1.34834 WP_000639789.1.34854 WP_000639789.1.34856 WP_000639789.1.34932 WP_000639789.1.34962 WP_000639789.1.34972 WP_000639789.1.34975 WP_000639789.1.34977 WP_000639789.1.35001 WP_000639789.1.35035 WP_000639789.1.35040 WP_000639789.1.35045 WP_000639789.1.35074 WP_000639789.1.35075 WP_000639789.1.35125 WP_000639789.1.35129 WP_000639789.1.35175 WP_000639789.1.35184 WP_000639789.1.35193 WP_000639789.1.35240 WP_000639789.1.35274 WP_000639789.1.35294 WP_000639789.1.35298 WP_000639789.1.35321 WP_000639789.1.35332 WP_000639789.1.35404 WP_000639789.1.35408 WP_000639789.1.3541 WP_000639789.1.35425 WP_000639789.1.35429 WP_000639789.1.35446 WP_000639789.1.35460 WP_000639789.1.35463 WP_000639789.1.35494 WP_000639789.1.35503 WP_000639789.1.35509 WP_000639789.1.35532 WP_000639789.1.3556 WP_000639789.1.35560 WP_000639789.1.35563 WP_000639789.1.3557 WP_000639789.1.35570 WP_000639789.1.35590 WP_000639789.1.35594 WP_000639789.1.35619 WP_000639789.1.35624 WP_000639789.1.35628 WP_000639789.1.35648 WP_000639789.1.3566 WP_000639789.1.3570 WP_000639789.1.35712 WP_000639789.1.35713 WP_000639789.1.3572 WP_000639789.1.35736 WP_000639789.1.35791 WP_000639789.1.35795 WP_000639789.1.35809 WP_000639789.1.35868 WP_000639789.1.35870 WP_000639789.1.35887 WP_000639789.1.35892 WP_000639789.1.35916 WP_000639789.1.35936 WP_000639789.1.35938 WP_000639789.1.35940 WP_000639789.1.35966 WP_000639789.1.35993 WP_000639789.1.36000 WP_000639789.1.36003 WP_000639789.1.3601 WP_000639789.1.36011 WP_000639789.1.36017 WP_000639789.1.36034 WP_000639789.1.36036 WP_000639789.1.36037 WP_000639789.1.36063 WP_000639789.1.36069 WP_000639789.1.3610 WP_000639789.1.36157 WP_000639789.1.36232 WP_000639789.1.36236 WP_000639789.1.36291 WP_000639789.1.36298 WP_000639789.1.36308 WP_000639789.1.36323 WP_000639789.1.36343 WP_000639789.1.36409 WP_000639789.1.36445 WP_000639789.1.36460 WP_000639789.1.3649 WP_000639789.1.36495 WP_000639789.1.36512 WP_000639789.1.36526 WP_000639789.1.36547 WP_000639789.1.36567 WP_000639789.1.36579 WP_000639789.1.36584 WP_000639789.1.36592 WP_000639789.1.36609 WP_000639789.1.36617 WP_000639789.1.36618 WP_000639789.1.36643 WP_000639789.1.36652 WP_000639789.1.36663 WP_000639789.1.36685 WP_000639789.1.36690 WP_000639789.1.3670 WP_000639789.1.36701 WP_000639789.1.36705 WP_000639789.1.36721 WP_000639789.1.36725 WP_000639789.1.36751 WP_000639789.1.36764 WP_000639789.1.36765 WP_000639789.1.36779 WP_000639789.1.36792 WP_000639789.1.36798 WP_000639789.1.36802 WP_000639789.1.36821 WP_000639789.1.36839 WP_000639789.1.36853 WP_000639789.1.3688 WP_000639789.1.36889 WP_000639789.1.36899 WP_000639789.1.36918 WP_000639789.1.36931 WP_000639789.1.36949 WP_000639789.1.36950 WP_000639789.1.37013 WP_000639789.1.37014 WP_000639789.1.37028 WP_000639789.1.37029 WP_000639789.1.37063 WP_000639789.1.37073 WP_000639789.1.37111 WP_000639789.1.37112 WP_000639789.1.37114 WP_000639789.1.37133 WP_000639789.1.37176 WP_000639789.1.37191 WP_000639789.1.37199 WP_000639789.1.37200 WP_000639789.1.37256 WP_000639789.1.37258 WP_000639789.1.3726 WP_000639789.1.37293 WP_000639789.1.37297 WP_000639789.1.37303 WP_000639789.1.3734 WP_000639789.1.37351 WP_000639789.1.37363 WP_000639789.1.37370 WP_000639789.1.37376 WP_000639789.1.37405 WP_000639789.1.3744 WP_000639789.1.37478 WP_000639789.1.3748 WP_000639789.1.37498 WP_000639789.1.37504 WP_000639789.1.3751 WP_000639789.1.37513 WP_000639789.1.37521 WP_000639789.1.37558 WP_000639789.1.37584 WP_000639789.1.37590 WP_000639789.1.37593 WP_000639789.1.37600 WP_000639789.1.37610 WP_000639789.1.37613 WP_000639789.1.37618 WP_000639789.1.37659 WP_000639789.1.37662 WP_000639789.1.37666 WP_000639789.1.37675 WP_000639789.1.37687 WP_000639789.1.37691 WP_000639789.1.3771 WP_000639789.1.37719 WP_000639789.1.37761 WP_000639789.1.37775 WP_000639789.1.37777 WP_000639789.1.3778 WP_000639789.1.378 WP_000639789.1.37848 WP_000639789.1.37864 WP_000639789.1.379 WP_000639789.1.3790 WP_000639789.1.37911 WP_000639789.1.37941 WP_000639789.1.37965 WP_000639789.1.37968 WP_000639789.1.37978 WP_000639789.1.37985 WP_000639789.1.38037 WP_000639789.1.38047 WP_000639789.1.38061 WP_000639789.1.38064 WP_000639789.1.38108 WP_000639789.1.38125 WP_000639789.1.38145 WP_000639789.1.3816 WP_000639789.1.38199 WP_000639789.1.38207 WP_000639789.1.38261 WP_000639789.1.38266 WP_000639789.1.383 WP_000639789.1.38310 WP_000639789.1.38322 WP_000639789.1.3834 WP_000639789.1.38341 WP_000639789.1.38344 WP_000639789.1.38349 WP_000639789.1.38351 WP_000639789.1.3838 WP_000639789.1.38381 WP_000639789.1.38393 WP_000639789.1.38408 WP_000639789.1.38440 WP_000639789.1.3848 WP_000639789.1.38486 WP_000639789.1.38512 WP_000639789.1.38515 WP_000639789.1.38569 WP_000639789.1.38595 WP_000639789.1.3860 WP_000639789.1.38609 WP_000639789.1.38613 WP_000639789.1.38622 WP_000639789.1.38642 WP_000639789.1.38673 WP_000639789.1.3869 WP_000639789.1.38693 WP_000639789.1.38734 WP_000639789.1.38773 WP_000639789.1.38781 WP_000639789.1.38797 WP_000639789.1.38830 WP_000639789.1.38857 WP_000639789.1.38877 WP_000639789.1.38882 WP_000639789.1.38898 WP_000639789.1.38913 WP_000639789.1.38942 WP_000639789.1.38983 WP_000639789.1.38996 WP_000639789.1.39003 WP_000639789.1.39048 WP_000639789.1.39055 WP_000639789.1.39056 WP_000639789.1.39059 WP_000639789.1.39065 WP_000639789.1.3907 WP_000639789.1.39075 WP_000639789.1.39082 WP_000639789.1.39105 WP_000639789.1.39113 WP_000639789.1.39128 WP_000639789.1.39136 WP_000639789.1.3914 WP_000639789.1.39146 WP_000639789.1.39147 WP_000639789.1.39161 WP_000639789.1.39183 WP_000639789.1.39197 WP_000639789.1.39210 WP_000639789.1.39229 WP_000639789.1.39235 WP_000639789.1.39265 WP_000639789.1.39275 WP_000639789.1.3931 WP_000639789.1.39311 WP_000639789.1.39312 WP_000639789.1.39395 WP_000639789.1.39405 WP_000639789.1.39414 WP_000639789.1.39420 WP_000639789.1.39435 WP_000639789.1.39449 WP_000639789.1.39466 WP_000639789.1.39471 WP_000639789.1.39497 WP_000639789.1.39502 WP_000639789.1.39503 WP_000639789.1.39512 WP_000639789.1.39530 WP_000639789.1.39553 WP_000639789.1.39556 WP_000639789.1.39576 WP_000639789.1.39584 WP_000639789.1.39609 WP_000639789.1.39614 WP_000639789.1.39619 WP_000639789.1.39620 WP_000639789.1.39624 WP_000639789.1.39629 WP_000639789.1.39632 WP_000639789.1.39659 WP_000639789.1.39667 WP_000639789.1.39722 WP_000639789.1.39723 WP_000639789.1.39724 WP_000639789.1.39763 WP_000639789.1.39775 WP_000639789.1.39808 WP_000639789.1.39862 WP_000639789.1.39879 WP_000639789.1.39890 WP_000639789.1.39921 WP_000639789.1.39923 WP_000639789.1.39941 WP_000639789.1.39945 WP_000639789.1.39947 WP_000639789.1.40008 WP_000639789.1.40017 WP_000639789.1.40025 WP_000639789.1.40072 WP_000639789.1.40073 WP_000639789.1.40081 WP_000639789.1.40095 WP_000639789.1.40097 WP_000639789.1.401 WP_000639789.1.4011 WP_000639789.1.40155 WP_000639789.1.40158 WP_000639789.1.40160 WP_000639789.1.40167 WP_000639789.1.40170 WP_000639789.1.40171 WP_000639789.1.40205 WP_000639789.1.40208 WP_000639789.1.40229 WP_000639789.1.40240 WP_000639789.1.40254 WP_000639789.1.40257 WP_000639789.1.40258 WP_000639789.1.40259 WP_000639789.1.40279 WP_000639789.1.40284 WP_000639789.1.40292 WP_000639789.1.40305 WP_000639789.1.40307 WP_000639789.1.40311 WP_000639789.1.40341 WP_000639789.1.40361 WP_000639789.1.40374 WP_000639789.1.40380 WP_000639789.1.40395 WP_000639789.1.4042 WP_000639789.1.40465 WP_000639789.1.40467 WP_000639789.1.40493 WP_000639789.1.40496 WP_000639789.1.40508 WP_000639789.1.40517 WP_000639789.1.40528 WP_000639789.1.40533 WP_000639789.1.40577 WP_000639789.1.40583 WP_000639789.1.40605 WP_000639789.1.40622 WP_000639789.1.40648 WP_000639789.1.40695 WP_000639789.1.40698 WP_000639789.1.40710 WP_000639789.1.40722 WP_000639789.1.40745 WP_000639789.1.4075 WP_000639789.1.40750 WP_000639789.1.40763 WP_000639789.1.40788 WP_000639789.1.40849 WP_000639789.1.40854 WP_000639789.1.4087 WP_000639789.1.40877 WP_000639789.1.4088 WP_000639789.1.4089 WP_000639789.1.40924 WP_000639789.1.40930 WP_000639789.1.40932 WP_000639789.1.40946 WP_000639789.1.40973 WP_000639789.1.40979 WP_000639789.1.40996 WP_000639789.1.41004 WP_000639789.1.41017 WP_000639789.1.41018 WP_000639789.1.41048 WP_000639789.1.41050 WP_000639789.1.4106 WP_000639789.1.41070 WP_000639789.1.41074 WP_000639789.1.41075 WP_000639789.1.41086 WP_000639789.1.41091 WP_000639789.1.41097 WP_000639789.1.41116 WP_000639789.1.41128 WP_000639789.1.41132 WP_000639789.1.41176 WP_000639789.1.41192 WP_000639789.1.41225 WP_000639789.1.41226 WP_000639789.1.41251 WP_000639789.1.41258 WP_000639789.1.41277 WP_000639789.1.41279 WP_000639789.1.41305 WP_000639789.1.41321 WP_000639789.1.41333 WP_000639789.1.41335 WP_000639789.1.4136 WP_000639789.1.41375 WP_000639789.1.4141 WP_000639789.1.41415 WP_000639789.1.41427 WP_000639789.1.41434 WP_000639789.1.41438 WP_000639789.1.41459 WP_000639789.1.41468 WP_000639789.1.41498 WP_000639789.1.41516 WP_000639789.1.41519 WP_000639789.1.41524 WP_000639789.1.41528 WP_000639789.1.41554 WP_000639789.1.41572 WP_000639789.1.41591 WP_000639789.1.41610 WP_000639789.1.41631 WP_000639789.1.41658 WP_000639789.1.41659 WP_000639789.1.41662 WP_000639789.1.41688 WP_000639789.1.41690 WP_000639789.1.41708 WP_000639789.1.41716 WP_000639789.1.41724 WP_000639789.1.41746 WP_000639789.1.41761 WP_000639789.1.41789 WP_000639789.1.41799 WP_000639789.1.41824 WP_000639789.1.41825 WP_000639789.1.41836 WP_000639789.1.41859 WP_000639789.1.41862 WP_000639789.1.41877 WP_000639789.1.41882 WP_000639789.1.41894 WP_000639789.1.41897 WP_000639789.1.41904 WP_000639789.1.41911 WP_000639789.1.41919 WP_000639789.1.41929 WP_000639789.1.41931 WP_000639789.1.41938 WP_000639789.1.4194 WP_000639789.1.41949 WP_000639789.1.41978 WP_000639789.1.41979 WP_000639789.1.41985 WP_000639789.1.41994 WP_000639789.1.41998 WP_000639789.1.42009 WP_000639789.1.42069 WP_000639789.1.42081 WP_000639789.1.42090 WP_000639789.1.42104 WP_000639789.1.42109 WP_000639789.1.42111 WP_000639789.1.42136 WP_000639789.1.42156 WP_000639789.1.42187 WP_000639789.1.422 WP_000639789.1.42200 WP_000639789.1.42219 WP_000639789.1.4222 WP_000639789.1.42243 WP_000639789.1.42244 WP_000639789.1.42248 WP_000639789.1.42257 WP_000639789.1.42261 WP_000639789.1.42262 WP_000639789.1.42263 WP_000639789.1.42276 WP_000639789.1.42320 WP_000639789.1.42322 WP_000639789.1.42328 WP_000639789.1.42342 WP_000639789.1.42349 WP_000639789.1.42364 WP_000639789.1.42371 WP_000639789.1.42379 WP_000639789.1.42391 WP_000639789.1.42392 WP_000639789.1.42399 WP_000639789.1.42422 WP_000639789.1.42433 WP_000639789.1.42444 WP_000639789.1.42489 WP_000639789.1.42491 WP_000639789.1.42539 WP_000639789.1.4257 WP_000639789.1.42603 WP_000639789.1.42605 WP_000639789.1.42650 WP_000639789.1.42655 WP_000639789.1.42666 WP_000639789.1.4267 WP_000639789.1.42675 WP_000639789.1.42676 WP_000639789.1.42683 WP_000639789.1.42701 WP_000639789.1.42707 WP_000639789.1.42734 WP_000639789.1.4276 WP_000639789.1.42767 WP_000639789.1.42794 WP_000639789.1.42797 WP_000639789.1.42805 WP_000639789.1.42815 WP_000639789.1.42829 WP_000639789.1.42859 WP_000639789.1.42861 WP_000639789.1.42864 WP_000639789.1.4288 WP_000639789.1.42887 WP_000639789.1.4289 WP_000639789.1.42892 WP_000639789.1.42923 WP_000639789.1.42932 WP_000639789.1.42978 WP_000639789.1.4298 WP_000639789.1.43008 WP_000639789.1.43016 WP_000639789.1.43018 WP_000639789.1.43019 WP_000639789.1.43041 WP_000639789.1.43065 WP_000639789.1.43068 WP_000639789.1.43069 WP_000639789.1.43070 WP_000639789.1.43077 WP_000639789.1.43086 WP_000639789.1.43089 WP_000639789.1.43126 WP_000639789.1.43128 WP_000639789.1.43141 WP_000639789.1.43149 WP_000639789.1.43157 WP_000639789.1.43160 WP_000639789.1.43161 WP_000639789.1.43190 WP_000639789.1.43198 WP_000639789.1.43201 WP_000639789.1.43244 WP_000639789.1.43258 WP_000639789.1.4326 WP_000639789.1.43272 WP_000639789.1.43276 WP_000639789.1.43290 WP_000639789.1.43292 WP_000639789.1.43299 WP_000639789.1.43307 WP_000639789.1.43312 WP_000639789.1.4332 WP_000639789.1.43334 WP_000639789.1.43339 WP_000639789.1.43351 WP_000639789.1.43371 WP_000639789.1.43437 WP_000639789.1.43438 WP_000639789.1.4344 WP_000639789.1.43441 WP_000639789.1.43476 WP_000639789.1.43508 WP_000639789.1.43513 WP_000639789.1.43520 WP_000639789.1.43522 WP_000639789.1.43606 WP_000639789.1.43613 WP_000639789.1.43633 WP_000639789.1.43637 WP_000639789.1.43651 WP_000639789.1.43668 WP_000639789.1.43685 WP_000639789.1.43710 WP_000639789.1.43722 WP_000639789.1.4373 WP_000639789.1.43763 WP_000639789.1.43778 WP_000639789.1.43782 WP_000639789.1.43785 WP_000639789.1.43801 WP_000639789.1.43812 WP_000639789.1.43839 WP_000639789.1.43873 WP_000639789.1.43875 WP_000639789.1.43878 WP_000639789.1.43886 WP_000639789.1.43888 WP_000639789.1.43919 WP_000639789.1.43951 WP_000639789.1.43974 WP_000639789.1.44005 WP_000639789.1.44010 WP_000639789.1.4404 WP_000639789.1.44043 WP_000639789.1.44049 WP_000639789.1.4405 WP_000639789.1.44063 WP_000639789.1.44099 WP_000639789.1.44101 WP_000639789.1.44113 WP_000639789.1.44121 WP_000639789.1.44132 WP_000639789.1.44160 WP_000639789.1.44180 WP_000639789.1.44191 WP_000639789.1.44196 WP_000639789.1.4422 WP_000639789.1.4423 WP_000639789.1.44248 WP_000639789.1.44250 WP_000639789.1.44262 WP_000639789.1.44268 WP_000639789.1.4427 WP_000639789.1.44291 WP_000639789.1.44296 WP_000639789.1.44300 WP_000639789.1.44310 WP_000639789.1.44337 WP_000639789.1.44343 WP_000639789.1.44351 WP_000639789.1.44360 WP_000639789.1.44380 WP_000639789.1.44386 WP_000639789.1.44397 WP_000639789.1.4440 WP_000639789.1.44416 WP_000639789.1.44431 WP_000639789.1.44433 WP_000639789.1.44437 WP_000639789.1.44438 WP_000639789.1.44440 WP_000639789.1.44443 WP_000639789.1.44474 WP_000639789.1.44479 WP_000639789.1.44546 WP_000639789.1.44549 WP_000639789.1.44633 WP_000639789.1.44640 WP_000639789.1.4467 WP_000639789.1.44678 WP_000639789.1.4468 WP_000639789.1.44705 WP_000639789.1.44747 WP_000639789.1.44762 WP_000639789.1.44781 WP_000639789.1.44791 WP_000639789.1.44795 WP_000639789.1.44815 WP_000639789.1.44828 WP_000639789.1.44831 WP_000639789.1.44833 WP_000639789.1.4485 WP_000639789.1.44877 WP_000639789.1.44879 WP_000639789.1.449 WP_000639789.1.44917 WP_000639789.1.44927 WP_000639789.1.44933 WP_000639789.1.44950 WP_000639789.1.44966 WP_000639789.1.44971 WP_000639789.1.44978 WP_000639789.1.44985 WP_000639789.1.44997 WP_000639789.1.44998 WP_000639789.1.4500 WP_000639789.1.4501 WP_000639789.1.45038 WP_000639789.1.45045 WP_000639789.1.45067 WP_000639789.1.45072 WP_000639789.1.45074 WP_000639789.1.45079 WP_000639789.1.45093 WP_000639789.1.45098 WP_000639789.1.45123 WP_000639789.1.45136 WP_000639789.1.45138 WP_000639789.1.45145 WP_000639789.1.45173 WP_000639789.1.45177 WP_000639789.1.45184 WP_000639789.1.45229 WP_000639789.1.45241 WP_000639789.1.45251 WP_000639789.1.45259 WP_000639789.1.45268 WP_000639789.1.45302 WP_000639789.1.4531 WP_000639789.1.45344 WP_000639789.1.45349 WP_000639789.1.45351 WP_000639789.1.45365 WP_000639789.1.4540 WP_000639789.1.45402 WP_000639789.1.45432 WP_000639789.1.45434 WP_000639789.1.45435 WP_000639789.1.45462 WP_000639789.1.45468 WP_000639789.1.45523 WP_000639789.1.45549 WP_000639789.1.45550 WP_000639789.1.45566 WP_000639789.1.45569 WP_000639789.1.45571 WP_000639789.1.45582 WP_000639789.1.45583 WP_000639789.1.45585 WP_000639789.1.45596 WP_000639789.1.45622 WP_000639789.1.45648 WP_000639789.1.45660 WP_000639789.1.45690 WP_000639789.1.45781 WP_000639789.1.45797 WP_000639789.1.458 WP_000639789.1.45829 WP_000639789.1.45844 WP_000639789.1.45848 WP_000639789.1.45871 WP_000639789.1.45906 WP_000639789.1.45918 WP_000639789.1.4592 WP_000639789.1.45984 WP_000639789.1.46011 WP_000639789.1.46028 WP_000639789.1.46030 WP_000639789.1.46069 WP_000639789.1.46077 WP_000639789.1.46091 WP_000639789.1.46112 WP_000639789.1.46124 WP_000639789.1.46169 WP_000639789.1.46173 WP_000639789.1.46174 WP_000639789.1.46187 WP_000639789.1.46205 WP_000639789.1.46215 WP_000639789.1.46225 WP_000639789.1.46232 WP_000639789.1.46241 WP_000639789.1.46243 WP_000639789.1.46278 WP_000639789.1.46299 WP_000639789.1.46303 WP_000639789.1.46307 WP_000639789.1.46322 WP_000639789.1.46323 WP_000639789.1.46345 WP_000639789.1.46355 WP_000639789.1.464 WP_000639789.1.46406 WP_000639789.1.46434 WP_000639789.1.46444 WP_000639789.1.46454 WP_000639789.1.46461 WP_000639789.1.46499 WP_000639789.1.46504 WP_000639789.1.46505 WP_000639789.1.46551 WP_000639789.1.46559 WP_000639789.1.46572 WP_000639789.1.46578 WP_000639789.1.46595 WP_000639789.1.46620 WP_000639789.1.46675 WP_000639789.1.46689 WP_000639789.1.46693 WP_000639789.1.46701 WP_000639789.1.4671 WP_000639789.1.46726 WP_000639789.1.46730 WP_000639789.1.46732 WP_000639789.1.4674 WP_000639789.1.46781 WP_000639789.1.46803 WP_000639789.1.46804 WP_000639789.1.46816 WP_000639789.1.46842 WP_000639789.1.4686 WP_000639789.1.4690 WP_000639789.1.46920 WP_000639789.1.46930 WP_000639789.1.46945 WP_000639789.1.46961 WP_000639789.1.46967 WP_000639789.1.46976 WP_000639789.1.47008 WP_000639789.1.47014 WP_000639789.1.47036 WP_000639789.1.47037 WP_000639789.1.47042 WP_000639789.1.47057 WP_000639789.1.47058 WP_000639789.1.47059 WP_000639789.1.47085 WP_000639789.1.47123 WP_000639789.1.47214 WP_000639789.1.47215 WP_000639789.1.47245 WP_000639789.1.47389 WP_000639789.1.47429 WP_000639789.1.47448 WP_000639789.1.4747 WP_000639789.1.47472 WP_000639789.1.47478 WP_000639789.1.47506 WP_000639789.1.47507 WP_000639789.1.47523 WP_000639789.1.47531 WP_000639789.1.47532 WP_000639789.1.47567 WP_000639789.1.47576 WP_000639789.1.47579 WP_000639789.1.4758 WP_000639789.1.47587 WP_000639789.1.47605 WP_000639789.1.47621 WP_000639789.1.47630 WP_000639789.1.4769 WP_000639789.1.4770 WP_000639789.1.47714 WP_000639789.1.4774 WP_000639789.1.47756 WP_000639789.1.47799 WP_000639789.1.4781 WP_000639789.1.47829 WP_000639789.1.47849 WP_000639789.1.47850 WP_000639789.1.47875 WP_000639789.1.47886 WP_000639789.1.47898 WP_000639789.1.47902 WP_000639789.1.47911 WP_000639789.1.47928 WP_000639789.1.4795 WP_000639789.1.47988 WP_000639789.1.47992 WP_000639789.1.48019 WP_000639789.1.48100 WP_000639789.1.48114 WP_000639789.1.48124 WP_000639789.1.48132 WP_000639789.1.48139 WP_000639789.1.48190 WP_000639789.1.48215 WP_000639789.1.48242 WP_000639789.1.48244 WP_000639789.1.48253 WP_000639789.1.48262 WP_000639789.1.48268 WP_000639789.1.48292 WP_000639789.1.483 WP_000639789.1.48324 WP_000639789.1.48367 WP_000639789.1.48377 WP_000639789.1.4839 WP_000639789.1.48399 WP_000639789.1.48426 WP_000639789.1.48430 WP_000639789.1.48436 WP_000639789.1.48493 WP_000639789.1.4853 WP_000639789.1.48586 WP_000639789.1.4859 WP_000639789.1.48591 WP_000639789.1.48610 WP_000639789.1.48631 WP_000639789.1.48647 WP_000639789.1.48651 WP_000639789.1.48663 WP_000639789.1.48690 WP_000639789.1.48734 WP_000639789.1.48755 WP_000639789.1.48756 WP_000639789.1.48778 WP_000639789.1.48788 WP_000639789.1.48797 WP_000639789.1.48849 WP_000639789.1.4885 WP_000639789.1.48855 WP_000639789.1.48886 WP_000639789.1.48894 WP_000639789.1.48896 WP_000639789.1.48908 WP_000639789.1.48918 WP_000639789.1.48919 WP_000639789.1.48931 WP_000639789.1.48955 WP_000639789.1.48963 WP_000639789.1.48973 WP_000639789.1.49004 WP_000639789.1.49005 WP_000639789.1.49012 WP_000639789.1.49084 WP_000639789.1.49102 WP_000639789.1.49106 WP_000639789.1.49113 WP_000639789.1.49117 WP_000639789.1.49121 WP_000639789.1.4914 WP_000639789.1.49140 WP_000639789.1.49153 WP_000639789.1.49155 WP_000639789.1.49162 WP_000639789.1.49166 WP_000639789.1.49175 WP_000639789.1.49204 WP_000639789.1.49226 WP_000639789.1.49233 WP_000639789.1.49239 WP_000639789.1.49256 WP_000639789.1.49290 WP_000639789.1.49304 WP_000639789.1.49311 WP_000639789.1.49334 WP_000639789.1.49340 WP_000639789.1.49355 WP_000639789.1.49358 WP_000639789.1.49366 WP_000639789.1.49375 WP_000639789.1.49429 WP_000639789.1.49434 WP_000639789.1.49443 WP_000639789.1.49450 WP_000639789.1.49490 WP_000639789.1.495 WP_000639789.1.49515 WP_000639789.1.49545 WP_000639789.1.49550 WP_000639789.1.49572 WP_000639789.1.49590 WP_000639789.1.49595 WP_000639789.1.49602 WP_000639789.1.49626 WP_000639789.1.49630 WP_000639789.1.49647 WP_000639789.1.49650 WP_000639789.1.49686 WP_000639789.1.49703 WP_000639789.1.49769 WP_000639789.1.49770 WP_000639789.1.49778 WP_000639789.1.49780 WP_000639789.1.4979 WP_000639789.1.49803 WP_000639789.1.49805 WP_000639789.1.49846 WP_000639789.1.49848 WP_000639789.1.4991 WP_000639789.1.49929 WP_000639789.1.49931 WP_000639789.1.49947 WP_000639789.1.49959 WP_000639789.1.49997 WP_000639789.1.50 WP_000639789.1.50003 WP_000639789.1.50007 WP_000639789.1.50014 WP_000639789.1.50030 WP_000639789.1.50043 WP_000639789.1.50080 WP_000639789.1.5009 WP_000639789.1.50103 WP_000639789.1.50128 WP_000639789.1.50158 WP_000639789.1.50161 WP_000639789.1.50198 WP_000639789.1.50211 WP_000639789.1.50238 WP_000639789.1.50247 WP_000639789.1.50251 WP_000639789.1.50308 WP_000639789.1.50309 WP_000639789.1.50332 WP_000639789.1.50349 WP_000639789.1.50376 WP_000639789.1.50387 WP_000639789.1.50389 WP_000639789.1.50404 WP_000639789.1.50406 WP_000639789.1.50413 WP_000639789.1.50449 WP_000639789.1.50468 WP_000639789.1.50469 WP_000639789.1.50478 WP_000639789.1.50480 WP_000639789.1.5051 WP_000639789.1.50517 WP_000639789.1.50563 WP_000639789.1.50565 WP_000639789.1.50566 WP_000639789.1.50570 WP_000639789.1.5058 WP_000639789.1.50593 WP_000639789.1.50626 WP_000639789.1.50652 WP_000639789.1.50676 WP_000639789.1.50684 WP_000639789.1.50726 WP_000639789.1.50769 WP_000639789.1.50771 WP_000639789.1.50774 WP_000639789.1.50782 WP_000639789.1.50804 WP_000639789.1.50808 WP_000639789.1.50875 WP_000639789.1.5088 WP_000639789.1.50882 WP_000639789.1.50885 WP_000639789.1.50893 WP_000639789.1.509 WP_000639789.1.50905 WP_000639789.1.50908 WP_000639789.1.50929 WP_000639789.1.50941 WP_000639789.1.50960 WP_000639789.1.50970 WP_000639789.1.50999 WP_000639789.1.51014 WP_000639789.1.51022 WP_000639789.1.51025 WP_000639789.1.51040 WP_000639789.1.51048 WP_000639789.1.51066 WP_000639789.1.51100 WP_000639789.1.51131 WP_000639789.1.51134 WP_000639789.1.51139 WP_000639789.1.51162 WP_000639789.1.51179 WP_000639789.1.51182 WP_000639789.1.51186 WP_000639789.1.51224 WP_000639789.1.51227 WP_000639789.1.5127 WP_000639789.1.51285 WP_000639789.1.51305 WP_000639789.1.51308 WP_000639789.1.51315 WP_000639789.1.51331 WP_000639789.1.51356 WP_000639789.1.5136 WP_000639789.1.5138 WP_000639789.1.51394 WP_000639789.1.51412 WP_000639789.1.51414 WP_000639789.1.51419 WP_000639789.1.51451 WP_000639789.1.51474 WP_000639789.1.51487 WP_000639789.1.51488 WP_000639789.1.51502 WP_000639789.1.51506 WP_000639789.1.51514 WP_000639789.1.51519 WP_000639789.1.51555 WP_000639789.1.51598 WP_000639789.1.51611 WP_000639789.1.51613 WP_000639789.1.51615 WP_000639789.1.51634 WP_000639789.1.51642 WP_000639789.1.51644 WP_000639789.1.51649 WP_000639789.1.51686 WP_000639789.1.51724 WP_000639789.1.51734 WP_000639789.1.51756 WP_000639789.1.51764 WP_000639789.1.51810 WP_000639789.1.51831 WP_000639789.1.51838 WP_000639789.1.51863 WP_000639789.1.51868 WP_000639789.1.51888 WP_000639789.1.51900 WP_000639789.1.51911 WP_000639789.1.51930 WP_000639789.1.51932 WP_000639789.1.51935 WP_000639789.1.51989 WP_000639789.1.51994 WP_000639789.1.520 WP_000639789.1.52057 WP_000639789.1.5211 WP_000639789.1.52114 WP_000639789.1.52121 WP_000639789.1.52129 WP_000639789.1.52148 WP_000639789.1.52156 WP_000639789.1.52161 WP_000639789.1.52170 WP_000639789.1.52191 WP_000639789.1.52202 WP_000639789.1.52209 WP_000639789.1.52255 WP_000639789.1.52301 WP_000639789.1.52321 WP_000639789.1.52336 WP_000639789.1.52339 WP_000639789.1.52346 WP_000639789.1.52353 WP_000639789.1.52356 WP_000639789.1.52361 WP_000639789.1.52446 WP_000639789.1.52469 WP_000639789.1.52527 WP_000639789.1.52528 WP_000639789.1.52571 WP_000639789.1.52582 WP_000639789.1.52586 WP_000639789.1.526 WP_000639789.1.52637 WP_000639789.1.52647 WP_000639789.1.52653 WP_000639789.1.52656 WP_000639789.1.52675 WP_000639789.1.52692 WP_000639789.1.5273 WP_000639789.1.52738 WP_000639789.1.52742 WP_000639789.1.52743 WP_000639789.1.52744 WP_000639789.1.52773 WP_000639789.1.52795 WP_000639789.1.52807 WP_000639789.1.52824 WP_000639789.1.52833 WP_000639789.1.52851 WP_000639789.1.52857 WP_000639789.1.52866 WP_000639789.1.52887 WP_000639789.1.52898 WP_000639789.1.52915 WP_000639789.1.52924 WP_000639789.1.52949 WP_000639789.1.52985 WP_000639789.1.5301 WP_000639789.1.53016 WP_000639789.1.53092 WP_000639789.1.53107 WP_000639789.1.53119 WP_000639789.1.5313 WP_000639789.1.53141 WP_000639789.1.53151 WP_000639789.1.53154 WP_000639789.1.53159 WP_000639789.1.53179 WP_000639789.1.53190 WP_000639789.1.53198 WP_000639789.1.53203 WP_000639789.1.53206 WP_000639789.1.53210 WP_000639789.1.53233 WP_000639789.1.53234 WP_000639789.1.53272 WP_000639789.1.53274 WP_000639789.1.53286 WP_000639789.1.53307 WP_000639789.1.53316 WP_000639789.1.53321 WP_000639789.1.53328 WP_000639789.1.5333 WP_000639789.1.53362 WP_000639789.1.53368 WP_000639789.1.53375 WP_000639789.1.53385 WP_000639789.1.53406 WP_000639789.1.53436 WP_000639789.1.53450 WP_000639789.1.53466 WP_000639789.1.5349 WP_000639789.1.53529 WP_000639789.1.53534 WP_000639789.1.53540 WP_000639789.1.53543 WP_000639789.1.53555 WP_000639789.1.53559 WP_000639789.1.5356 WP_000639789.1.53567 WP_000639789.1.53571 WP_000639789.1.5358 WP_000639789.1.53664 WP_000639789.1.53692 WP_000639789.1.53694 WP_000639789.1.53696 WP_000639789.1.53723 WP_000639789.1.5374 WP_000639789.1.53750 WP_000639789.1.53757 WP_000639789.1.53772 WP_000639789.1.53778 WP_000639789.1.53781 WP_000639789.1.53790 WP_000639789.1.53800 WP_000639789.1.53812 WP_000639789.1.53815 WP_000639789.1.53839 WP_000639789.1.53892 WP_000639789.1.53896 WP_000639789.1.53898 WP_000639789.1.53902 WP_000639789.1.53905 WP_000639789.1.53958 WP_000639789.1.53961 WP_000639789.1.53981 WP_000639789.1.53984 WP_000639789.1.54033 WP_000639789.1.54061 WP_000639789.1.54075 WP_000639789.1.54082 WP_000639789.1.54085 WP_000639789.1.54132 WP_000639789.1.54136 WP_000639789.1.54170 WP_000639789.1.54175 WP_000639789.1.54196 WP_000639789.1.542 WP_000639789.1.54203 WP_000639789.1.54209 WP_000639789.1.54259 WP_000639789.1.54271 WP_000639789.1.54273 WP_000639789.1.54274 WP_000639789.1.54283 WP_000639789.1.5430 WP_000639789.1.54319 WP_000639789.1.54324 WP_000639789.1.54364 WP_000639789.1.54366 WP_000639789.1.54371 WP_000639789.1.54400 WP_000639789.1.54431 WP_000639789.1.54442 WP_000639789.1.54469 WP_000639789.1.54482 WP_000639789.1.54500 WP_000639789.1.54522 WP_000639789.1.54526 WP_000639789.1.54558 WP_000639789.1.5456 WP_000639789.1.54589 WP_000639789.1.5459 WP_000639789.1.54607 WP_000639789.1.54615 WP_000639789.1.54644 WP_000639789.1.54662 WP_000639789.1.54667 WP_000639789.1.54678 WP_000639789.1.54681 WP_000639789.1.54694 WP_000639789.1.54722 WP_000639789.1.54748 WP_000639789.1.54749 WP_000639789.1.54764 WP_000639789.1.54774 WP_000639789.1.5481 WP_000639789.1.54814 WP_000639789.1.54833 WP_000639789.1.54845 WP_000639789.1.5485 WP_000639789.1.54865 WP_000639789.1.54877 WP_000639789.1.54935 WP_000639789.1.54936 WP_000639789.1.54979 WP_000639789.1.54992 WP_000639789.1.55008 WP_000639789.1.55010 WP_000639789.1.55034 WP_000639789.1.55073 WP_000639789.1.55152 WP_000639789.1.55156 WP_000639789.1.55163 WP_000639789.1.55165 WP_000639789.1.5517 WP_000639789.1.55178 WP_000639789.1.55215 WP_000639789.1.55223 WP_000639789.1.55224 WP_000639789.1.5525 WP_000639789.1.55285 WP_000639789.1.55290 WP_000639789.1.55294 WP_000639789.1.55310 WP_000639789.1.55317 WP_000639789.1.55325 WP_000639789.1.55361 WP_000639789.1.55379 WP_000639789.1.5539 WP_000639789.1.55418 WP_000639789.1.55430 WP_000639789.1.55468 WP_000639789.1.55475 WP_000639789.1.55506 WP_000639789.1.5552 WP_000639789.1.55528 WP_000639789.1.55545 WP_000639789.1.55554 WP_000639789.1.55557 WP_000639789.1.55559 WP_000639789.1.5560 WP_000639789.1.55604 WP_000639789.1.55614 WP_000639789.1.55623 WP_000639789.1.55639 WP_000639789.1.55640 WP_000639789.1.55647 WP_000639789.1.55672 WP_000639789.1.55680 WP_000639789.1.55699 WP_000639789.1.55706 WP_000639789.1.5572 WP_000639789.1.55725 WP_000639789.1.55743 WP_000639789.1.55768 WP_000639789.1.5577 WP_000639789.1.55780 WP_000639789.1.55782 WP_000639789.1.55796 WP_000639789.1.55853 WP_000639789.1.55923 WP_000639789.1.55948 WP_000639789.1.55967 WP_000639789.1.55973 WP_000639789.1.55993 WP_000639789.1.55995 WP_000639789.1.56002 WP_000639789.1.56012 WP_000639789.1.56026 WP_000639789.1.56069 WP_000639789.1.56097 WP_000639789.1.56100 WP_000639789.1.56105 WP_000639789.1.56130 WP_000639789.1.56144 WP_000639789.1.56152 WP_000639789.1.56172 WP_000639789.1.5621 WP_000639789.1.56222 WP_000639789.1.56226 WP_000639789.1.56235 WP_000639789.1.56238 WP_000639789.1.56244 WP_000639789.1.56247 WP_000639789.1.56261 WP_000639789.1.56263 WP_000639789.1.56286 WP_000639789.1.56303 WP_000639789.1.56304 WP_000639789.1.56311 WP_000639789.1.5633 WP_000639789.1.56354 WP_000639789.1.56370 WP_000639789.1.56385 WP_000639789.1.56389 WP_000639789.1.56393 WP_000639789.1.56396 WP_000639789.1.56414 WP_000639789.1.56419 WP_000639789.1.56420 WP_000639789.1.56423 WP_000639789.1.56438 WP_000639789.1.56468 WP_000639789.1.56514 WP_000639789.1.56535 WP_000639789.1.56559 WP_000639789.1.56560 WP_000639789.1.56585 WP_000639789.1.56597 WP_000639789.1.56601 WP_000639789.1.56614 WP_000639789.1.56615 WP_000639789.1.56640 WP_000639789.1.56647 WP_000639789.1.56651 WP_000639789.1.56660 WP_000639789.1.56671 WP_000639789.1.5668 WP_000639789.1.56682 WP_000639789.1.56724 WP_000639789.1.56824 WP_000639789.1.56825 WP_000639789.1.56851 WP_000639789.1.56861 WP_000639789.1.56875 WP_000639789.1.56877 WP_000639789.1.56887 WP_000639789.1.56889 WP_000639789.1.56898 WP_000639789.1.56905 WP_000639789.1.56950 WP_000639789.1.56981 WP_000639789.1.57000 WP_000639789.1.57026 WP_000639789.1.57039 WP_000639789.1.57056 WP_000639789.1.57084 WP_000639789.1.57101 WP_000639789.1.5711 WP_000639789.1.57125 WP_000639789.1.57137 WP_000639789.1.57143 WP_000639789.1.57147 WP_000639789.1.57149 WP_000639789.1.57168 WP_000639789.1.57179 WP_000639789.1.57186 WP_000639789.1.57187 WP_000639789.1.57232 WP_000639789.1.57233 WP_000639789.1.57246 WP_000639789.1.57296 WP_000639789.1.57342 WP_000639789.1.57356 WP_000639789.1.57357 WP_000639789.1.57362 WP_000639789.1.57377 WP_000639789.1.57399 WP_000639789.1.57418 WP_000639789.1.57433 WP_000639789.1.57494 WP_000639789.1.57510 WP_000639789.1.57515 WP_000639789.1.57529 WP_000639789.1.5753 WP_000639789.1.57534 WP_000639789.1.57559 WP_000639789.1.57576 WP_000639789.1.57601 WP_000639789.1.57607 WP_000639789.1.57631 WP_000639789.1.57641 WP_000639789.1.57684 WP_000639789.1.57699 WP_000639789.1.57709 WP_000639789.1.57710 WP_000639789.1.57735 WP_000639789.1.5774 WP_000639789.1.57763 WP_000639789.1.57778 WP_000639789.1.57781 WP_000639789.1.57785 WP_000639789.1.57797 WP_000639789.1.57800 WP_000639789.1.57835 WP_000639789.1.57862 WP_000639789.1.57873 WP_000639789.1.57890 WP_000639789.1.57891 WP_000639789.1.57893 WP_000639789.1.57965 WP_000639789.1.57972 WP_000639789.1.57978 WP_000639789.1.58008 WP_000639789.1.5801 WP_000639789.1.58041 WP_000639789.1.58044 WP_000639789.1.58081 WP_000639789.1.5809 WP_000639789.1.58090 WP_000639789.1.58132 WP_000639789.1.58144 WP_000639789.1.58153 WP_000639789.1.58173 WP_000639789.1.58191 WP_000639789.1.58194 WP_000639789.1.58249 WP_000639789.1.58252 WP_000639789.1.58261 WP_000639789.1.58274 WP_000639789.1.5828 WP_000639789.1.58282 WP_000639789.1.58290 WP_000639789.1.58301 WP_000639789.1.58324 WP_000639789.1.58326 WP_000639789.1.58334 WP_000639789.1.58358 WP_000639789.1.5836 WP_000639789.1.58372 WP_000639789.1.58407 WP_000639789.1.58418 WP_000639789.1.58443 WP_000639789.1.58451 WP_000639789.1.5846 WP_000639789.1.58485 WP_000639789.1.58486 WP_000639789.1.58489 WP_000639789.1.58537 WP_000639789.1.5854 WP_000639789.1.58548 WP_000639789.1.58564 WP_000639789.1.58568 WP_000639789.1.5858 WP_000639789.1.58583 WP_000639789.1.58604 WP_000639789.1.58633 WP_000639789.1.58652 WP_000639789.1.58662 WP_000639789.1.58663 WP_000639789.1.58669 WP_000639789.1.58675 WP_000639789.1.587 WP_000639789.1.58724 WP_000639789.1.58744 WP_000639789.1.58745 WP_000639789.1.58749 WP_000639789.1.5875 WP_000639789.1.5878 WP_000639789.1.58796 WP_000639789.1.58803 WP_000639789.1.58807 WP_000639789.1.58831 WP_000639789.1.58834 WP_000639789.1.58847 WP_000639789.1.5886 WP_000639789.1.58861 WP_000639789.1.58883 WP_000639789.1.58884 WP_000639789.1.58898 WP_000639789.1.58926 WP_000639789.1.58932 WP_000639789.1.58949 WP_000639789.1.58963 WP_000639789.1.58970 WP_000639789.1.58974 WP_000639789.1.59012 WP_000639789.1.59020 WP_000639789.1.59043 WP_000639789.1.59056 WP_000639789.1.59061 WP_000639789.1.59064 WP_000639789.1.59084 WP_000639789.1.59094 WP_000639789.1.59125 WP_000639789.1.59136 WP_000639789.1.59142 WP_000639789.1.59163 WP_000639789.1.59224 WP_000639789.1.59236 WP_000639789.1.59282 WP_000639789.1.59294 WP_000639789.1.59295 WP_000639789.1.59299 WP_000639789.1.59313 WP_000639789.1.59335 WP_000639789.1.59375 WP_000639789.1.59412 WP_000639789.1.59420 WP_000639789.1.59427 WP_000639789.1.59439 WP_000639789.1.59458 WP_000639789.1.59486 WP_000639789.1.5949 WP_000639789.1.59490 WP_000639789.1.59501 WP_000639789.1.59508 WP_000639789.1.59510 WP_000639789.1.59521 WP_000639789.1.5953 WP_000639789.1.59538 WP_000639789.1.59548 WP_000639789.1.59562 WP_000639789.1.59587 WP_000639789.1.59604 WP_000639789.1.59636 WP_000639789.1.59646 WP_000639789.1.59648 WP_000639789.1.59684 WP_000639789.1.5969 WP_000639789.1.59694 WP_000639789.1.59709 WP_000639789.1.59710 WP_000639789.1.59751 WP_000639789.1.59771 WP_000639789.1.5979 WP_000639789.1.59827 WP_000639789.1.59829 WP_000639789.1.59847 WP_000639789.1.59848 WP_000639789.1.59863 WP_000639789.1.59928 WP_000639789.1.5993 WP_000639789.1.59953 WP_000639789.1.59969 WP_000639789.1.59994 WP_000639789.1.60004 WP_000639789.1.60008 WP_000639789.1.60015 WP_000639789.1.60021 WP_000639789.1.60045 WP_000639789.1.60052 WP_000639789.1.60069 WP_000639789.1.60076 WP_000639789.1.60106 WP_000639789.1.60114 WP_000639789.1.60126 WP_000639789.1.60137 WP_000639789.1.60140 WP_000639789.1.60154 WP_000639789.1.60155 WP_000639789.1.60168 WP_000639789.1.60192 WP_000639789.1.60199 WP_000639789.1.60209 WP_000639789.1.60212 WP_000639789.1.60213 WP_000639789.1.60226 WP_000639789.1.60253 WP_000639789.1.60285 WP_000639789.1.60320 WP_000639789.1.60322 WP_000639789.1.60324 WP_000639789.1.6033 WP_000639789.1.60330 WP_000639789.1.60356 WP_000639789.1.60379 WP_000639789.1.6038 WP_000639789.1.60380 WP_000639789.1.6041 WP_000639789.1.60424 WP_000639789.1.60425 WP_000639789.1.60464 WP_000639789.1.60469 WP_000639789.1.60481 WP_000639789.1.605 WP_000639789.1.60507 WP_000639789.1.6052 WP_000639789.1.60545 WP_000639789.1.60560 WP_000639789.1.60561 WP_000639789.1.6058 WP_000639789.1.60584 WP_000639789.1.60597 WP_000639789.1.6060 WP_000639789.1.60661 WP_000639789.1.60676 WP_000639789.1.60708 WP_000639789.1.60713 WP_000639789.1.60725 WP_000639789.1.60746 WP_000639789.1.60772 WP_000639789.1.60783 WP_000639789.1.60792 WP_000639789.1.608 WP_000639789.1.60807 WP_000639789.1.60838 WP_000639789.1.60851 WP_000639789.1.60857 WP_000639789.1.6086 WP_000639789.1.60866 WP_000639789.1.60874 WP_000639789.1.60882 WP_000639789.1.60889 WP_000639789.1.60897 WP_000639789.1.6090 WP_000639789.1.60941 WP_000639789.1.60950 WP_000639789.1.60976 WP_000639789.1.60988 WP_000639789.1.60990 WP_000639789.1.6104 WP_000639789.1.61044 WP_000639789.1.61045 WP_000639789.1.61076 WP_000639789.1.61078 WP_000639789.1.61087 WP_000639789.1.61114 WP_000639789.1.61123 WP_000639789.1.6114 WP_000639789.1.61146 WP_000639789.1.61147 WP_000639789.1.61168 WP_000639789.1.61184 WP_000639789.1.61200 WP_000639789.1.61201 WP_000639789.1.61210 WP_000639789.1.61218 WP_000639789.1.61232 WP_000639789.1.61233 WP_000639789.1.6129 WP_000639789.1.61296 WP_000639789.1.61345 WP_000639789.1.61356 WP_000639789.1.61357 WP_000639789.1.61381 WP_000639789.1.61417 WP_000639789.1.61501 WP_000639789.1.61511 WP_000639789.1.61519 WP_000639789.1.61539 WP_000639789.1.61542 WP_000639789.1.61553 WP_000639789.1.61574 WP_000639789.1.61582 WP_000639789.1.61594 WP_000639789.1.61595 WP_000639789.1.61609 WP_000639789.1.61649 WP_000639789.1.61652 WP_000639789.1.61662 WP_000639789.1.61667 WP_000639789.1.61671 WP_000639789.1.61697 WP_000639789.1.61712 WP_000639789.1.61714 WP_000639789.1.61730 WP_000639789.1.61737 WP_000639789.1.61743 WP_000639789.1.61783 WP_000639789.1.61809 WP_000639789.1.61857 WP_000639789.1.61877 WP_000639789.1.61908 WP_000639789.1.61918 WP_000639789.1.61920 WP_000639789.1.61922 WP_000639789.1.61924 WP_000639789.1.61952 WP_000639789.1.61968 WP_000639789.1.62007 WP_000639789.1.62020 WP_000639789.1.62025 WP_000639789.1.6209 WP_000639789.1.6210 WP_000639789.1.62120 WP_000639789.1.62122 WP_000639789.1.62124 WP_000639789.1.62142 WP_000639789.1.62158 WP_000639789.1.62184 WP_000639789.1.62199 WP_000639789.1.62201 WP_000639789.1.62204 WP_000639789.1.62210 WP_000639789.1.62219 WP_000639789.1.62223 WP_000639789.1.62241 WP_000639789.1.62245 WP_000639789.1.62257 WP_000639789.1.62271 WP_000639789.1.62302 WP_000639789.1.62304 WP_000639789.1.62310 WP_000639789.1.62314 WP_000639789.1.62323 WP_000639789.1.62333 WP_000639789.1.62338 WP_000639789.1.62339 WP_000639789.1.62344 WP_000639789.1.62364 WP_000639789.1.62374 WP_000639789.1.62380 WP_000639789.1.62403 WP_000639789.1.62404 WP_000639789.1.62411 WP_000639789.1.62412 WP_000639789.1.62436 WP_000639789.1.62475 WP_000639789.1.62504 WP_000639789.1.62522 WP_000639789.1.6253 WP_000639789.1.62536 WP_000639789.1.62564 WP_000639789.1.62570 WP_000639789.1.62619 WP_000639789.1.62640 WP_000639789.1.62648 WP_000639789.1.62677 WP_000639789.1.62686 WP_000639789.1.62725 WP_000639789.1.62745 WP_000639789.1.62751 WP_000639789.1.62757 WP_000639789.1.62798 WP_000639789.1.62825 WP_000639789.1.62828 WP_000639789.1.62853 WP_000639789.1.62903 WP_000639789.1.62910 WP_000639789.1.62913 WP_000639789.1.6292 WP_000639789.1.62932 WP_000639789.1.62955 WP_000639789.1.62960 WP_000639789.1.62976 WP_000639789.1.62983 WP_000639789.1.62988 WP_000639789.1.63016 WP_000639789.1.63025 WP_000639789.1.63043 WP_000639789.1.63045 WP_000639789.1.63063 WP_000639789.1.63069 WP_000639789.1.63087 WP_000639789.1.63102 WP_000639789.1.63118 WP_000639789.1.63129 WP_000639789.1.63135 WP_000639789.1.63169 WP_000639789.1.63181 WP_000639789.1.63186 WP_000639789.1.63203 WP_000639789.1.63229 WP_000639789.1.63234 WP_000639789.1.63243 WP_000639789.1.63250 WP_000639789.1.63256 WP_000639789.1.63290 WP_000639789.1.63297 WP_000639789.1.63358 WP_000639789.1.63382 WP_000639789.1.63422 WP_000639789.1.63432 WP_000639789.1.63448 WP_000639789.1.63455 WP_000639789.1.63461 WP_000639789.1.63479 WP_000639789.1.63497 WP_000639789.1.63499 WP_000639789.1.63509 WP_000639789.1.63513 WP_000639789.1.63514 WP_000639789.1.63525 WP_000639789.1.63529 WP_000639789.1.63532 WP_000639789.1.63568 WP_000639789.1.6357 WP_000639789.1.63577 WP_000639789.1.63583 WP_000639789.1.63585 WP_000639789.1.63592 WP_000639789.1.63603 WP_000639789.1.63633 WP_000639789.1.63663 WP_000639789.1.63664 WP_000639789.1.6367 WP_000639789.1.6370 WP_000639789.1.63718 WP_000639789.1.63731 WP_000639789.1.63736 WP_000639789.1.63748 WP_000639789.1.6375 WP_000639789.1.63757 WP_000639789.1.63766 WP_000639789.1.63797 WP_000639789.1.63816 WP_000639789.1.63824 WP_000639789.1.63831 WP_000639789.1.63834 WP_000639789.1.63851 WP_000639789.1.63863 WP_000639789.1.63864 WP_000639789.1.63876 WP_000639789.1.6389 WP_000639789.1.63901 WP_000639789.1.63903 WP_000639789.1.63955 WP_000639789.1.63963 WP_000639789.1.63977 WP_000639789.1.6399 WP_000639789.1.63992 WP_000639789.1.64010 WP_000639789.1.64018 WP_000639789.1.64032 WP_000639789.1.64034 WP_000639789.1.64046 WP_000639789.1.64072 WP_000639789.1.64085 WP_000639789.1.64087 WP_000639789.1.64109 WP_000639789.1.64121 WP_000639789.1.6415 WP_000639789.1.64157 WP_000639789.1.64208 WP_000639789.1.64217 WP_000639789.1.64229 WP_000639789.1.6423 WP_000639789.1.64242 WP_000639789.1.64244 WP_000639789.1.64266 WP_000639789.1.64293 WP_000639789.1.64294 WP_000639789.1.64332 WP_000639789.1.64350 WP_000639789.1.6437 WP_000639789.1.64374 WP_000639789.1.64376 WP_000639789.1.64385 WP_000639789.1.64387 WP_000639789.1.64389 WP_000639789.1.644 WP_000639789.1.64403 WP_000639789.1.64412 WP_000639789.1.64462 WP_000639789.1.64471 WP_000639789.1.64500 WP_000639789.1.64501 WP_000639789.1.64538 WP_000639789.1.64569 WP_000639789.1.64597 WP_000639789.1.64632 WP_000639789.1.64645 WP_000639789.1.64648 WP_000639789.1.64649 WP_000639789.1.64654 WP_000639789.1.64662 WP_000639789.1.64663 WP_000639789.1.64674 WP_000639789.1.64690 WP_000639789.1.64702 WP_000639789.1.64709 WP_000639789.1.64710 WP_000639789.1.64711 WP_000639789.1.64744 WP_000639789.1.64757 WP_000639789.1.64763 WP_000639789.1.64771 WP_000639789.1.64781 WP_000639789.1.64798 WP_000639789.1.64817 WP_000639789.1.64831 WP_000639789.1.64847 WP_000639789.1.6487 WP_000639789.1.6489 WP_000639789.1.64891 WP_000639789.1.64894 WP_000639789.1.64920 WP_000639789.1.64944 WP_000639789.1.64972 WP_000639789.1.64974 WP_000639789.1.64977 WP_000639789.1.65011 WP_000639789.1.65016 WP_000639789.1.65018 WP_000639789.1.65022 WP_000639789.1.65028 WP_000639789.1.65052 WP_000639789.1.65054 WP_000639789.1.65075 WP_000639789.1.6514 WP_000639789.1.65168 WP_000639789.1.65171 WP_000639789.1.65172 WP_000639789.1.65191 WP_000639789.1.65200 WP_000639789.1.65211 WP_000639789.1.65218 WP_000639789.1.65226 WP_000639789.1.65238 WP_000639789.1.65248 WP_000639789.1.65249 WP_000639789.1.6525 WP_000639789.1.65266 WP_000639789.1.65269 WP_000639789.1.65295 WP_000639789.1.65348 WP_000639789.1.6535 WP_000639789.1.65357 WP_000639789.1.65363 WP_000639789.1.65394 WP_000639789.1.65395 WP_000639789.1.65437 WP_000639789.1.65459 WP_000639789.1.65463 WP_000639789.1.65474 WP_000639789.1.65487 WP_000639789.1.6549 WP_000639789.1.65499 WP_000639789.1.6550 WP_000639789.1.65508 WP_000639789.1.65538 WP_000639789.1.6554 WP_000639789.1.65558 WP_000639789.1.65572 WP_000639789.1.6560 WP_000639789.1.65601 WP_000639789.1.6561 WP_000639789.1.65633 WP_000639789.1.6565 WP_000639789.1.65650 WP_000639789.1.65687 WP_000639789.1.65696 WP_000639789.1.65697 WP_000639789.1.65698 WP_000639789.1.65699 WP_000639789.1.6572 WP_000639789.1.65737 WP_000639789.1.6575 WP_000639789.1.65755 WP_000639789.1.65771 WP_000639789.1.65782 WP_000639789.1.65795 WP_000639789.1.65812 WP_000639789.1.65838 WP_000639789.1.65846 WP_000639789.1.65849 WP_000639789.1.65863 WP_000639789.1.65881 WP_000639789.1.65883 WP_000639789.1.65901 WP_000639789.1.65940 WP_000639789.1.6595 WP_000639789.1.65956 WP_000639789.1.65985 WP_000639789.1.66021 WP_000639789.1.66031 WP_000639789.1.66049 WP_000639789.1.66052 WP_000639789.1.66064 WP_000639789.1.66074 WP_000639789.1.66082 WP_000639789.1.66085 WP_000639789.1.66109 WP_000639789.1.66122 WP_000639789.1.66129 WP_000639789.1.66145 WP_000639789.1.66167 WP_000639789.1.66171 WP_000639789.1.66183 WP_000639789.1.6620 WP_000639789.1.66216 WP_000639789.1.66234 WP_000639789.1.66235 WP_000639789.1.66250 WP_000639789.1.66273 WP_000639789.1.66289 WP_000639789.1.6630 WP_000639789.1.66314 WP_000639789.1.66315 WP_000639789.1.66324 WP_000639789.1.66330 WP_000639789.1.6634 WP_000639789.1.66358 WP_000639789.1.66361 WP_000639789.1.66362 WP_000639789.1.66365 WP_000639789.1.66368 WP_000639789.1.6638 WP_000639789.1.66385 WP_000639789.1.6640 WP_000639789.1.66400 WP_000639789.1.66428 WP_000639789.1.66446 WP_000639789.1.66462 WP_000639789.1.6647 WP_000639789.1.66480 WP_000639789.1.66492 WP_000639789.1.66506 WP_000639789.1.66534 WP_000639789.1.66539 WP_000639789.1.66600 WP_000639789.1.66630 WP_000639789.1.66665 WP_000639789.1.66678 WP_000639789.1.66681 WP_000639789.1.66684 WP_000639789.1.66698 WP_000639789.1.66702 WP_000639789.1.66733 WP_000639789.1.66755 WP_000639789.1.66759 WP_000639789.1.66779 WP_000639789.1.6680 WP_000639789.1.66800 WP_000639789.1.66801 WP_000639789.1.66807 WP_000639789.1.66825 WP_000639789.1.66834 WP_000639789.1.66860 WP_000639789.1.66876 WP_000639789.1.66901 WP_000639789.1.6692 WP_000639789.1.66937 WP_000639789.1.66953 WP_000639789.1.66955 WP_000639789.1.66959 WP_000639789.1.66962 WP_000639789.1.66981 WP_000639789.1.67 WP_000639789.1.67024 WP_000639789.1.67037 WP_000639789.1.67042 WP_000639789.1.67045 WP_000639789.1.67075 WP_000639789.1.6710 WP_000639789.1.67100 WP_000639789.1.67101 WP_000639789.1.67143 WP_000639789.1.67173 WP_000639789.1.67181 WP_000639789.1.67184 WP_000639789.1.67201 WP_000639789.1.67211 WP_000639789.1.67235 WP_000639789.1.67237 WP_000639789.1.67268 WP_000639789.1.67279 WP_000639789.1.67336 WP_000639789.1.67339 WP_000639789.1.67347 WP_000639789.1.67374 WP_000639789.1.67387 WP_000639789.1.6739 WP_000639789.1.67394 WP_000639789.1.67397 WP_000639789.1.67403 WP_000639789.1.67405 WP_000639789.1.67430 WP_000639789.1.67442 WP_000639789.1.67465 WP_000639789.1.67539 WP_000639789.1.67552 WP_000639789.1.67556 WP_000639789.1.67576 WP_000639789.1.6760 WP_000639789.1.67603 WP_000639789.1.67604 WP_000639789.1.67617 WP_000639789.1.67619 WP_000639789.1.67625 WP_000639789.1.67627 WP_000639789.1.67633 WP_000639789.1.67637 WP_000639789.1.67641 WP_000639789.1.67657 WP_000639789.1.67673 WP_000639789.1.67682 WP_000639789.1.67700 WP_000639789.1.67707 WP_000639789.1.67718 WP_000639789.1.67729 WP_000639789.1.67731 WP_000639789.1.67772 WP_000639789.1.67774 WP_000639789.1.67776 WP_000639789.1.67803 WP_000639789.1.6782 WP_000639789.1.67820 WP_000639789.1.67827 WP_000639789.1.67829 WP_000639789.1.67887 WP_000639789.1.67905 WP_000639789.1.67910 WP_000639789.1.67924 WP_000639789.1.67932 WP_000639789.1.67942 WP_000639789.1.67954 WP_000639789.1.67970 WP_000639789.1.67977 WP_000639789.1.67988 WP_000639789.1.68 WP_000639789.1.68036 WP_000639789.1.68043 WP_000639789.1.68073 WP_000639789.1.68075 WP_000639789.1.6809 WP_000639789.1.68105 WP_000639789.1.68113 WP_000639789.1.68131 WP_000639789.1.68140 WP_000639789.1.68159 WP_000639789.1.68167 WP_000639789.1.68182 WP_000639789.1.6819 WP_000639789.1.68201 WP_000639789.1.68206 WP_000639789.1.68210 WP_000639789.1.6827 WP_000639789.1.68275 WP_000639789.1.68285 WP_000639789.1.6833 WP_000639789.1.68359 WP_000639789.1.68401 WP_000639789.1.68420 WP_000639789.1.68477 WP_000639789.1.68478 WP_000639789.1.6849 WP_000639789.1.68514 WP_000639789.1.68547 WP_000639789.1.68564 WP_000639789.1.6857 WP_000639789.1.6858 WP_000639789.1.68589 WP_000639789.1.68629 WP_000639789.1.68652 WP_000639789.1.68655 WP_000639789.1.68656 WP_000639789.1.68658 WP_000639789.1.68677 WP_000639789.1.68688 WP_000639789.1.6869 WP_000639789.1.68742 WP_000639789.1.68770 WP_000639789.1.68778 WP_000639789.1.68787 WP_000639789.1.68809 WP_000639789.1.68816 WP_000639789.1.68818 WP_000639789.1.6882 WP_000639789.1.6883 WP_000639789.1.68893 WP_000639789.1.68894 WP_000639789.1.68895 WP_000639789.1.68914 WP_000639789.1.68928 WP_000639789.1.68966 WP_000639789.1.68975 WP_000639789.1.68999 WP_000639789.1.69001 WP_000639789.1.69006 WP_000639789.1.69011 WP_000639789.1.69029 WP_000639789.1.6904 WP_000639789.1.6905 WP_000639789.1.69053 WP_000639789.1.69058 WP_000639789.1.69080 WP_000639789.1.69086 WP_000639789.1.6913 WP_000639789.1.69131 WP_000639789.1.69139 WP_000639789.1.69146 WP_000639789.1.69151 WP_000639789.1.69170 WP_000639789.1.69210 WP_000639789.1.69236 WP_000639789.1.69255 WP_000639789.1.69270 WP_000639789.1.69273 WP_000639789.1.69282 WP_000639789.1.69288 WP_000639789.1.69296 WP_000639789.1.69320 WP_000639789.1.69357 WP_000639789.1.69359 WP_000639789.1.69376 WP_000639789.1.69385 WP_000639789.1.69396 WP_000639789.1.69397 WP_000639789.1.69466 WP_000639789.1.69485 WP_000639789.1.69515 WP_000639789.1.6954 WP_000639789.1.69564 WP_000639789.1.69575 WP_000639789.1.69588 WP_000639789.1.69592 WP_000639789.1.69611 WP_000639789.1.69616 WP_000639789.1.69642 WP_000639789.1.69644 WP_000639789.1.69656 WP_000639789.1.69657 WP_000639789.1.69690 WP_000639789.1.69696 WP_000639789.1.69704 WP_000639789.1.69710 WP_000639789.1.69754 WP_000639789.1.69758 WP_000639789.1.69760 WP_000639789.1.69767 WP_000639789.1.69785 WP_000639789.1.69787 WP_000639789.1.69790 WP_000639789.1.69807 WP_000639789.1.69808 WP_000639789.1.69817 WP_000639789.1.69848 WP_000639789.1.69890 WP_000639789.1.69923 WP_000639789.1.69948 WP_000639789.1.69953 WP_000639789.1.69965 WP_000639789.1.69975 WP_000639789.1.69977 WP_000639789.1.70010 WP_000639789.1.70028 WP_000639789.1.70047 WP_000639789.1.70049 WP_000639789.1.70058 WP_000639789.1.70061 WP_000639789.1.70087 WP_000639789.1.70088 WP_000639789.1.7014 WP_000639789.1.7016 WP_000639789.1.70183 WP_000639789.1.70205 WP_000639789.1.7021 WP_000639789.1.70240 WP_000639789.1.70241 WP_000639789.1.70248 WP_000639789.1.70249 WP_000639789.1.70261 WP_000639789.1.70269 WP_000639789.1.70272 WP_000639789.1.70289 WP_000639789.1.70290 WP_000639789.1.70303 WP_000639789.1.70314 WP_000639789.1.70326 WP_000639789.1.7033 WP_000639789.1.70427 WP_000639789.1.70433 WP_000639789.1.70440 WP_000639789.1.70447 WP_000639789.1.70485 WP_000639789.1.70488 WP_000639789.1.70491 WP_000639789.1.70523 WP_000639789.1.70531 WP_000639789.1.70545 WP_000639789.1.70547 WP_000639789.1.7055 WP_000639789.1.70580 WP_000639789.1.70596 WP_000639789.1.70623 WP_000639789.1.70643 WP_000639789.1.70644 WP_000639789.1.70671 WP_000639789.1.70678 WP_000639789.1.70679 WP_000639789.1.70683 WP_000639789.1.70685 WP_000639789.1.70708 WP_000639789.1.70712 WP_000639789.1.70717 WP_000639789.1.70731 WP_000639789.1.70732 WP_000639789.1.70772 WP_000639789.1.70785 WP_000639789.1.70797 WP_000639789.1.70837 WP_000639789.1.70845 WP_000639789.1.70846 WP_000639789.1.70869 WP_000639789.1.70883 WP_000639789.1.70922 WP_000639789.1.70929 WP_000639789.1.70948 WP_000639789.1.70959 WP_000639789.1.70969 WP_000639789.1.70971 WP_000639789.1.70977 WP_000639789.1.70981 WP_000639789.1.70985 WP_000639789.1.70995 WP_000639789.1.71007 WP_000639789.1.71010 WP_000639789.1.71023 WP_000639789.1.71039 WP_000639789.1.71057 WP_000639789.1.71069 WP_000639789.1.71081 WP_000639789.1.71088 WP_000639789.1.7110 WP_000639789.1.71116 WP_000639789.1.71117 WP_000639789.1.71120 WP_000639789.1.71146 WP_000639789.1.71165 WP_000639789.1.71171 WP_000639789.1.71172 WP_000639789.1.71184 WP_000639789.1.71186 WP_000639789.1.71188 WP_000639789.1.71201 WP_000639789.1.71202 WP_000639789.1.71243 WP_000639789.1.71268 WP_000639789.1.71299 WP_000639789.1.71305 WP_000639789.1.71306 WP_000639789.1.71337 WP_000639789.1.7134 WP_000639789.1.71363 WP_000639789.1.71378 WP_000639789.1.71401 WP_000639789.1.7142 WP_000639789.1.71452 WP_000639789.1.71455 WP_000639789.1.71456 WP_000639789.1.71481 WP_000639789.1.71487 WP_000639789.1.71500 WP_000639789.1.71523 WP_000639789.1.71542 WP_000639789.1.71566 WP_000639789.1.71600 WP_000639789.1.71626 WP_000639789.1.71636 WP_000639789.1.71640 WP_000639789.1.71649 WP_000639789.1.71651 WP_000639789.1.71653 WP_000639789.1.71667 WP_000639789.1.71691 WP_000639789.1.71702 WP_000639789.1.71716 WP_000639789.1.71746 WP_000639789.1.71750 WP_000639789.1.71798 WP_000639789.1.71845 WP_000639789.1.71872 WP_000639789.1.71881 WP_000639789.1.71908 WP_000639789.1.71923 WP_000639789.1.71929 WP_000639789.1.71941 WP_000639789.1.71950 WP_000639789.1.71952 WP_000639789.1.71954 WP_000639789.1.71973 WP_000639789.1.71979 WP_000639789.1.71984 WP_000639789.1.71985 WP_000639789.1.720 WP_000639789.1.72003 WP_000639789.1.72065 WP_000639789.1.72068 WP_000639789.1.72073 WP_000639789.1.72100 WP_000639789.1.72105 WP_000639789.1.72119 WP_000639789.1.72182 WP_000639789.1.72188 WP_000639789.1.72190 WP_000639789.1.72203 WP_000639789.1.72221 WP_000639789.1.72234 WP_000639789.1.72269 WP_000639789.1.72281 WP_000639789.1.72283 WP_000639789.1.72300 WP_000639789.1.72307 WP_000639789.1.72325 WP_000639789.1.72339 WP_000639789.1.72350 WP_000639789.1.72372 WP_000639789.1.72376 WP_000639789.1.72382 WP_000639789.1.72383 WP_000639789.1.72403 WP_000639789.1.72412 WP_000639789.1.7243 WP_000639789.1.72438 WP_000639789.1.72461 WP_000639789.1.72470 WP_000639789.1.72527 WP_000639789.1.72532 WP_000639789.1.7255 WP_000639789.1.72594 WP_000639789.1.72602 WP_000639789.1.72625 WP_000639789.1.72629 WP_000639789.1.72631 WP_000639789.1.72638 WP_000639789.1.72642 WP_000639789.1.72667 WP_000639789.1.72671 WP_000639789.1.72674 WP_000639789.1.72689 WP_000639789.1.72716 WP_000639789.1.72718 WP_000639789.1.72724 WP_000639789.1.72728 WP_000639789.1.72789 WP_000639789.1.72827 WP_000639789.1.72828 WP_000639789.1.72843 WP_000639789.1.72850 WP_000639789.1.72865 WP_000639789.1.72871 WP_000639789.1.72872 WP_000639789.1.72887 WP_000639789.1.72896 WP_000639789.1.72897 WP_000639789.1.72944 WP_000639789.1.7295 WP_000639789.1.72969 WP_000639789.1.72975 WP_000639789.1.72987 WP_000639789.1.7304 WP_000639789.1.73052 WP_000639789.1.73062 WP_000639789.1.73068 WP_000639789.1.7311 WP_000639789.1.73114 WP_000639789.1.73125 WP_000639789.1.73144 WP_000639789.1.7315 WP_000639789.1.73177 WP_000639789.1.73180 WP_000639789.1.73200 WP_000639789.1.73258 WP_000639789.1.73270 WP_000639789.1.73285 WP_000639789.1.7332 WP_000639789.1.73328 WP_000639789.1.7333 WP_000639789.1.7334 WP_000639789.1.73352 WP_000639789.1.73362 WP_000639789.1.73377 WP_000639789.1.73379 WP_000639789.1.73389 WP_000639789.1.73425 WP_000639789.1.73461 WP_000639789.1.73481 WP_000639789.1.73488 WP_000639789.1.73504 WP_000639789.1.73512 WP_000639789.1.7353 WP_000639789.1.73544 WP_000639789.1.7356 WP_000639789.1.73561 WP_000639789.1.73581 WP_000639789.1.73598 WP_000639789.1.7361 WP_000639789.1.73617 WP_000639789.1.73648 WP_000639789.1.73667 WP_000639789.1.73708 WP_000639789.1.7374 WP_000639789.1.73753 WP_000639789.1.73758 WP_000639789.1.73764 WP_000639789.1.73768 WP_000639789.1.73794 WP_000639789.1.73804 WP_000639789.1.73847 WP_000639789.1.73849 WP_000639789.1.7387 WP_000639789.1.73924 WP_000639789.1.73926 WP_000639789.1.73948 WP_000639789.1.73965 WP_000639789.1.73999 WP_000639789.1.74024 WP_000639789.1.74028 WP_000639789.1.74029 WP_000639789.1.74030 WP_000639789.1.74038 WP_000639789.1.74040 WP_000639789.1.74043 WP_000639789.1.74049 WP_000639789.1.7405 WP_000639789.1.74058 WP_000639789.1.74070 WP_000639789.1.74077 WP_000639789.1.74117 WP_000639789.1.74135 WP_000639789.1.74174 WP_000639789.1.74181 WP_000639789.1.74191 WP_000639789.1.74207 WP_000639789.1.74214 WP_000639789.1.74228 WP_000639789.1.74241 WP_000639789.1.74248 WP_000639789.1.74285 WP_000639789.1.743 WP_000639789.1.7430 WP_000639789.1.74300 WP_000639789.1.74317 WP_000639789.1.7433 WP_000639789.1.74379 WP_000639789.1.74402 WP_000639789.1.74410 WP_000639789.1.74414 WP_000639789.1.74415 WP_000639789.1.74422 WP_000639789.1.74428 WP_000639789.1.7444 WP_000639789.1.74466 WP_000639789.1.74481 WP_000639789.1.745 WP_000639789.1.74529 WP_000639789.1.74545 WP_000639789.1.74578 WP_000639789.1.74616 WP_000639789.1.74620 WP_000639789.1.74621 WP_000639789.1.74632 WP_000639789.1.74647 WP_000639789.1.74661 WP_000639789.1.74677 WP_000639789.1.74699 WP_000639789.1.74745 WP_000639789.1.74757 WP_000639789.1.74806 WP_000639789.1.74807 WP_000639789.1.74831 WP_000639789.1.74884 WP_000639789.1.74894 WP_000639789.1.7491 WP_000639789.1.74929 WP_000639789.1.74939 WP_000639789.1.74946 WP_000639789.1.74972 WP_000639789.1.74973 WP_000639789.1.74992 WP_000639789.1.74996 WP_000639789.1.75009 WP_000639789.1.75051 WP_000639789.1.75056 WP_000639789.1.75058 WP_000639789.1.7507 WP_000639789.1.75089 WP_000639789.1.75116 WP_000639789.1.75129 WP_000639789.1.75134 WP_000639789.1.75148 WP_000639789.1.75159 WP_000639789.1.75187 WP_000639789.1.75237 WP_000639789.1.75273 WP_000639789.1.75288 WP_000639789.1.75296 WP_000639789.1.75334 WP_000639789.1.75362 WP_000639789.1.75385 WP_000639789.1.75392 WP_000639789.1.75400 WP_000639789.1.75413 WP_000639789.1.7543 WP_000639789.1.75433 WP_000639789.1.75450 WP_000639789.1.75494 WP_000639789.1.75532 WP_000639789.1.75565 WP_000639789.1.7558 WP_000639789.1.75585 WP_000639789.1.75593 WP_000639789.1.75607 WP_000639789.1.75609 WP_000639789.1.75610 WP_000639789.1.75626 WP_000639789.1.75633 WP_000639789.1.75703 WP_000639789.1.75716 WP_000639789.1.75718 WP_000639789.1.75745 WP_000639789.1.75751 WP_000639789.1.75760 WP_000639789.1.75793 WP_000639789.1.75794 WP_000639789.1.75810 WP_000639789.1.75828 WP_000639789.1.75837 WP_000639789.1.75844 WP_000639789.1.75863 WP_000639789.1.75873 WP_000639789.1.75874 WP_000639789.1.75886 WP_000639789.1.75898 WP_000639789.1.75902 WP_000639789.1.75932 WP_000639789.1.75945 WP_000639789.1.75957 WP_000639789.1.76 WP_000639789.1.76020 WP_000639789.1.76055 WP_000639789.1.76081 WP_000639789.1.76102 WP_000639789.1.76108 WP_000639789.1.76116 WP_000639789.1.76122 WP_000639789.1.76137 WP_000639789.1.76156 WP_000639789.1.76164 WP_000639789.1.76170 WP_000639789.1.76208 WP_000639789.1.76252 WP_000639789.1.76256 WP_000639789.1.76301 WP_000639789.1.76327 WP_000639789.1.7633 WP_000639789.1.76339 WP_000639789.1.7634 WP_000639789.1.76345 WP_000639789.1.76346 WP_000639789.1.76366 WP_000639789.1.76417 WP_000639789.1.76434 WP_000639789.1.76445 WP_000639789.1.76451 WP_000639789.1.7646 WP_000639789.1.76471 WP_000639789.1.76495 WP_000639789.1.76510 WP_000639789.1.76529 WP_000639789.1.76532 WP_000639789.1.76548 WP_000639789.1.7655 WP_000639789.1.76558 WP_000639789.1.7657 WP_000639789.1.76572 WP_000639789.1.76576 WP_000639789.1.7660 WP_000639789.1.76641 WP_000639789.1.76651 WP_000639789.1.76653 WP_000639789.1.76673 WP_000639789.1.76706 WP_000639789.1.7672 WP_000639789.1.76721 WP_000639789.1.76724 WP_000639789.1.76738 WP_000639789.1.76756 WP_000639789.1.76760 WP_000639789.1.76776 WP_000639789.1.76788 WP_000639789.1.76854 WP_000639789.1.76866 WP_000639789.1.76875 WP_000639789.1.76880 WP_000639789.1.76899 WP_000639789.1.76913 WP_000639789.1.76916 WP_000639789.1.76932 WP_000639789.1.76968 WP_000639789.1.76973 WP_000639789.1.76988 WP_000639789.1.77016 WP_000639789.1.77017 WP_000639789.1.77038 WP_000639789.1.77047 WP_000639789.1.77067 WP_000639789.1.77080 WP_000639789.1.77087 WP_000639789.1.77090 WP_000639789.1.77111 WP_000639789.1.7712 WP_000639789.1.77177 WP_000639789.1.77180 WP_000639789.1.77193 WP_000639789.1.77244 WP_000639789.1.77267 WP_000639789.1.77271 WP_000639789.1.77292 WP_000639789.1.77299 WP_000639789.1.77306 WP_000639789.1.77313 WP_000639789.1.77349 WP_000639789.1.77356 WP_000639789.1.77384 WP_000639789.1.77390 WP_000639789.1.77414 WP_000639789.1.77431 WP_000639789.1.77440 WP_000639789.1.77475 WP_000639789.1.77496 WP_000639789.1.77501 WP_000639789.1.77512 WP_000639789.1.77513 WP_000639789.1.77514 WP_000639789.1.77529 WP_000639789.1.77543 WP_000639789.1.77549 WP_000639789.1.77555 WP_000639789.1.77563 WP_000639789.1.77565 WP_000639789.1.77575 WP_000639789.1.77596 WP_000639789.1.77629 WP_000639789.1.77646 WP_000639789.1.77653 WP_000639789.1.77692 WP_000639789.1.77702 WP_000639789.1.77710 WP_000639789.1.77713 WP_000639789.1.7772 WP_000639789.1.77761 WP_000639789.1.7782 WP_000639789.1.77825 WP_000639789.1.77837 WP_000639789.1.77851 WP_000639789.1.77871 WP_000639789.1.77898 WP_000639789.1.77900 WP_000639789.1.77918 WP_000639789.1.7792 WP_000639789.1.77923 WP_000639789.1.7793 WP_000639789.1.77951 WP_000639789.1.77960 WP_000639789.1.77975 WP_000639789.1.77983 WP_000639789.1.77987 WP_000639789.1.77989 WP_000639789.1.78 WP_000639789.1.78016 WP_000639789.1.7802 WP_000639789.1.78026 WP_000639789.1.78033 WP_000639789.1.78035 WP_000639789.1.78048 WP_000639789.1.78051 WP_000639789.1.78076 WP_000639789.1.78096 WP_000639789.1.78100 WP_000639789.1.78107 WP_000639789.1.78110 WP_000639789.1.78120 WP_000639789.1.78166 WP_000639789.1.78170 WP_000639789.1.78180 WP_000639789.1.78192 WP_000639789.1.78195 WP_000639789.1.78245 WP_000639789.1.78259 WP_000639789.1.78291 WP_000639789.1.78301 WP_000639789.1.78309 WP_000639789.1.78320 WP_000639789.1.78339 WP_000639789.1.78366 WP_000639789.1.78372 WP_000639789.1.78382 WP_000639789.1.78383 WP_000639789.1.78388 WP_000639789.1.78407 WP_000639789.1.78410 WP_000639789.1.78443 WP_000639789.1.78495 WP_000639789.1.78496 WP_000639789.1.78501 WP_000639789.1.78502 WP_000639789.1.78602 WP_000639789.1.78603 WP_000639789.1.7861 WP_000639789.1.78618 WP_000639789.1.7862 WP_000639789.1.78626 WP_000639789.1.78632 WP_000639789.1.78658 WP_000639789.1.78661 WP_000639789.1.78673 WP_000639789.1.78674 WP_000639789.1.78676 WP_000639789.1.78697 WP_000639789.1.78734 WP_000639789.1.78735 WP_000639789.1.78738 WP_000639789.1.78761 WP_000639789.1.7877 WP_000639789.1.78771 WP_000639789.1.78802 WP_000639789.1.78815 WP_000639789.1.78830 WP_000639789.1.78835 WP_000639789.1.78838 WP_000639789.1.78862 WP_000639789.1.78871 WP_000639789.1.78874 WP_000639789.1.78877 WP_000639789.1.78896 WP_000639789.1.789 WP_000639789.1.7891 WP_000639789.1.78918 WP_000639789.1.78928 WP_000639789.1.7893 WP_000639789.1.78930 WP_000639789.1.78993 WP_000639789.1.79011 WP_000639789.1.79012 WP_000639789.1.79032 WP_000639789.1.79069 WP_000639789.1.79074 WP_000639789.1.79081 WP_000639789.1.79098 WP_000639789.1.79151 WP_000639789.1.79155 WP_000639789.1.79164 WP_000639789.1.79167 WP_000639789.1.79189 WP_000639789.1.79203 WP_000639789.1.79204 WP_000639789.1.79280 WP_000639789.1.79289 WP_000639789.1.79297 WP_000639789.1.79302 WP_000639789.1.79335 WP_000639789.1.79397 WP_000639789.1.794 WP_000639789.1.79427 WP_000639789.1.79456 WP_000639789.1.79462 WP_000639789.1.79466 WP_000639789.1.79468 WP_000639789.1.79472 WP_000639789.1.79490 WP_000639789.1.79495 WP_000639789.1.79529 WP_000639789.1.79532 WP_000639789.1.79547 WP_000639789.1.7956 WP_000639789.1.79570 WP_000639789.1.79580 WP_000639789.1.79586 WP_000639789.1.79635 WP_000639789.1.7964 WP_000639789.1.79654 WP_000639789.1.79659 WP_000639789.1.79668 WP_000639789.1.7970 WP_000639789.1.79708 WP_000639789.1.7972 WP_000639789.1.79722 WP_000639789.1.79734 WP_000639789.1.79738 WP_000639789.1.79757 WP_000639789.1.79772 WP_000639789.1.79778 WP_000639789.1.7979 WP_000639789.1.7982 WP_000639789.1.79832 WP_000639789.1.79845 WP_000639789.1.79867 WP_000639789.1.79880 WP_000639789.1.79892 WP_000639789.1.7991 WP_000639789.1.79916 WP_000639789.1.79929 WP_000639789.1.79934 WP_000639789.1.7994 WP_000639789.1.79942 WP_000639789.1.79945 WP_000639789.1.79951 WP_000639789.1.79966 WP_000639789.1.79996 WP_000639789.1.80065 WP_000639789.1.80077 WP_000639789.1.80103 WP_000639789.1.80137 WP_000639789.1.80149 WP_000639789.1.80182 WP_000639789.1.80229 WP_000639789.1.80236 WP_000639789.1.80249 WP_000639789.1.80250 WP_000639789.1.80254 WP_000639789.1.80273 WP_000639789.1.80282 WP_000639789.1.80293 WP_000639789.1.80296 WP_000639789.1.80307 WP_000639789.1.80333 WP_000639789.1.80354 WP_000639789.1.80366 WP_000639789.1.80368 WP_000639789.1.80380 WP_000639789.1.80386 WP_000639789.1.80400 WP_000639789.1.80441 WP_000639789.1.80448 WP_000639789.1.80462 WP_000639789.1.80480 WP_000639789.1.8049 WP_000639789.1.80492 WP_000639789.1.80569 WP_000639789.1.80586 WP_000639789.1.80609 WP_000639789.1.80629 WP_000639789.1.80638 WP_000639789.1.80651 WP_000639789.1.80664 WP_000639789.1.80667 WP_000639789.1.80674 WP_000639789.1.80696 WP_000639789.1.80707 WP_000639789.1.80723 WP_000639789.1.80725 WP_000639789.1.80741 WP_000639789.1.80750 WP_000639789.1.80757 WP_000639789.1.80760 WP_000639789.1.80780 WP_000639789.1.80803 WP_000639789.1.80819 WP_000639789.1.80827 WP_000639789.1.80831 WP_000639789.1.80840 WP_000639789.1.80850 WP_000639789.1.80857 WP_000639789.1.80868 WP_000639789.1.80874 WP_000639789.1.80876 WP_000639789.1.80881 WP_000639789.1.80913 WP_000639789.1.80927 WP_000639789.1.80939 WP_000639789.1.80959 WP_000639789.1.8096 WP_000639789.1.80984 WP_000639789.1.81037 WP_000639789.1.8106 WP_000639789.1.81062 WP_000639789.1.81067 WP_000639789.1.81069 WP_000639789.1.81109 WP_000639789.1.81110 WP_000639789.1.81131 WP_000639789.1.81175 WP_000639789.1.81187 WP_000639789.1.8119 WP_000639789.1.81193 WP_000639789.1.81197 WP_000639789.1.81225 WP_000639789.1.81231 WP_000639789.1.81262 WP_000639789.1.81268 WP_000639789.1.81269 WP_000639789.1.8127 WP_000639789.1.81271 WP_000639789.1.81275 WP_000639789.1.8130 WP_000639789.1.81302 WP_000639789.1.81305 WP_000639789.1.8131 WP_000639789.1.81320 WP_000639789.1.81321 WP_000639789.1.81328 WP_000639789.1.81333 WP_000639789.1.8134 WP_000639789.1.81342 WP_000639789.1.81354 WP_000639789.1.81364 WP_000639789.1.81388 WP_000639789.1.81404 WP_000639789.1.81409 WP_000639789.1.81410 WP_000639789.1.81425 WP_000639789.1.81455 WP_000639789.1.81494 WP_000639789.1.81504 WP_000639789.1.81528 WP_000639789.1.81548 WP_000639789.1.81557 WP_000639789.1.81667 WP_000639789.1.81668 WP_000639789.1.81676 WP_000639789.1.8168 WP_000639789.1.81681 WP_000639789.1.8170 WP_000639789.1.81727 WP_000639789.1.81735 WP_000639789.1.81746 WP_000639789.1.81750 WP_000639789.1.81760 WP_000639789.1.81763 WP_000639789.1.81768 WP_000639789.1.81785 WP_000639789.1.81855 WP_000639789.1.81902 WP_000639789.1.81921 WP_000639789.1.81931 WP_000639789.1.81936 WP_000639789.1.81941 WP_000639789.1.81949 WP_000639789.1.81965 WP_000639789.1.81974 WP_000639789.1.81995 WP_000639789.1.82037 WP_000639789.1.82070 WP_000639789.1.82076 WP_000639789.1.82099 WP_000639789.1.82131 WP_000639789.1.82144 WP_000639789.1.82149 WP_000639789.1.82156 WP_000639789.1.8218 WP_000639789.1.82180 WP_000639789.1.82192 WP_000639789.1.82201 WP_000639789.1.82214 WP_000639789.1.82225 WP_000639789.1.82232 WP_000639789.1.82258 WP_000639789.1.82269 WP_000639789.1.82337 WP_000639789.1.82352 WP_000639789.1.8236 WP_000639789.1.82369 WP_000639789.1.8240 WP_000639789.1.82401 WP_000639789.1.82408 WP_000639789.1.82416 WP_000639789.1.8242 WP_000639789.1.82420 WP_000639789.1.82434 WP_000639789.1.82456 WP_000639789.1.82464 WP_000639789.1.82465 WP_000639789.1.8247 WP_000639789.1.82473 WP_000639789.1.82474 WP_000639789.1.82479 WP_000639789.1.82503 WP_000639789.1.82515 WP_000639789.1.82529 WP_000639789.1.82553 WP_000639789.1.82562 WP_000639789.1.82569 WP_000639789.1.82570 WP_000639789.1.82584 WP_000639789.1.82636 WP_000639789.1.82637 WP_000639789.1.82646 WP_000639789.1.82648 WP_000639789.1.82670 WP_000639789.1.82676 WP_000639789.1.82731 WP_000639789.1.82761 WP_000639789.1.82763 WP_000639789.1.82812 WP_000639789.1.8282 WP_000639789.1.82843 WP_000639789.1.82850 WP_000639789.1.82872 WP_000639789.1.82886 WP_000639789.1.82895 WP_000639789.1.82899 WP_000639789.1.82908 WP_000639789.1.82937 WP_000639789.1.8294 WP_000639789.1.82944 WP_000639789.1.82946 WP_000639789.1.82956 WP_000639789.1.82959 WP_000639789.1.82964 WP_000639789.1.82992 WP_000639789.1.83005 WP_000639789.1.83006 WP_000639789.1.83007 WP_000639789.1.8304 WP_000639789.1.83061 WP_000639789.1.83092 WP_000639789.1.83119 WP_000639789.1.83128 WP_000639789.1.83139 WP_000639789.1.83163 WP_000639789.1.83180 WP_000639789.1.83204 WP_000639789.1.8322 WP_000639789.1.83221 WP_000639789.1.83229 WP_000639789.1.83235 WP_000639789.1.83247 WP_000639789.1.83252 WP_000639789.1.83290 WP_000639789.1.83301 WP_000639789.1.83305 WP_000639789.1.83331 WP_000639789.1.83333 WP_000639789.1.83354 WP_000639789.1.83356 WP_000639789.1.83365 WP_000639789.1.83378 WP_000639789.1.83382 WP_000639789.1.83388 WP_000639789.1.83413 WP_000639789.1.83491 WP_000639789.1.83510 WP_000639789.1.83523 WP_000639789.1.8354 WP_000639789.1.83558 WP_000639789.1.83572 WP_000639789.1.83598 WP_000639789.1.83651 WP_000639789.1.83657 WP_000639789.1.83677 WP_000639789.1.83710 WP_000639789.1.83721 WP_000639789.1.83739 WP_000639789.1.8375 WP_000639789.1.83759 WP_000639789.1.83760 WP_000639789.1.83897 WP_000639789.1.83923 WP_000639789.1.83960 WP_000639789.1.83979 WP_000639789.1.8399 WP_000639789.1.83994 WP_000639789.1.83995 WP_000639789.1.84 WP_000639789.1.84000 WP_000639789.1.84011 WP_000639789.1.84031 WP_000639789.1.8406 WP_000639789.1.84075 WP_000639789.1.84076 WP_000639789.1.84077 WP_000639789.1.84083 WP_000639789.1.84086 WP_000639789.1.84103 WP_000639789.1.84110 WP_000639789.1.84127 WP_000639789.1.84150 WP_000639789.1.84154 WP_000639789.1.84168 WP_000639789.1.84179 WP_000639789.1.84198 WP_000639789.1.84205 WP_000639789.1.84229 WP_000639789.1.84230 WP_000639789.1.8425 WP_000639789.1.84252 WP_000639789.1.84283 WP_000639789.1.84291 WP_000639789.1.84300 WP_000639789.1.8431 WP_000639789.1.84325 WP_000639789.1.84345 WP_000639789.1.84359 WP_000639789.1.84369 WP_000639789.1.84373 WP_000639789.1.84392 WP_000639789.1.84397 WP_000639789.1.84401 WP_000639789.1.8441 WP_000639789.1.84435 WP_000639789.1.84459 WP_000639789.1.84461 WP_000639789.1.84475 WP_000639789.1.84497 WP_000639789.1.84515 WP_000639789.1.84523 WP_000639789.1.84532 WP_000639789.1.84551 WP_000639789.1.84554 WP_000639789.1.84567 WP_000639789.1.84572 WP_000639789.1.84631 WP_000639789.1.84644 WP_000639789.1.84659 WP_000639789.1.84683 WP_000639789.1.84693 WP_000639789.1.84711 WP_000639789.1.84721 WP_000639789.1.84727 WP_000639789.1.84744 WP_000639789.1.84745 WP_000639789.1.84773 WP_000639789.1.84876 WP_000639789.1.84899 WP_000639789.1.849 WP_000639789.1.84945 WP_000639789.1.84967 WP_000639789.1.8497 WP_000639789.1.84983 WP_000639789.1.850 WP_000639789.1.85004 WP_000639789.1.85014 WP_000639789.1.8502 WP_000639789.1.85031 WP_000639789.1.85039 WP_000639789.1.85040 WP_000639789.1.85079 WP_000639789.1.85094 WP_000639789.1.85120 WP_000639789.1.85126 WP_000639789.1.85134 WP_000639789.1.85147 WP_000639789.1.85153 WP_000639789.1.85178 WP_000639789.1.85180 WP_000639789.1.85190 WP_000639789.1.8526 WP_000639789.1.85271 WP_000639789.1.85273 WP_000639789.1.85301 WP_000639789.1.8533 WP_000639789.1.85338 WP_000639789.1.85339 WP_000639789.1.8537 WP_000639789.1.85433 WP_000639789.1.8545 WP_000639789.1.85456 WP_000639789.1.85481 WP_000639789.1.85483 WP_000639789.1.85511 WP_000639789.1.85512 WP_000639789.1.8552 WP_000639789.1.85541 WP_000639789.1.8556 WP_000639789.1.85568 WP_000639789.1.8557 WP_000639789.1.85606 WP_000639789.1.85615 WP_000639789.1.85617 WP_000639789.1.85635 WP_000639789.1.85646 WP_000639789.1.85654 WP_000639789.1.85663 WP_000639789.1.85665 WP_000639789.1.85669 WP_000639789.1.85671 WP_000639789.1.85672 WP_000639789.1.85675 WP_000639789.1.85688 WP_000639789.1.85703 WP_000639789.1.85723 WP_000639789.1.85728 WP_000639789.1.85746 WP_000639789.1.85759 WP_000639789.1.85777 WP_000639789.1.85780 WP_000639789.1.85811 WP_000639789.1.85855 WP_000639789.1.85864 WP_000639789.1.85886 WP_000639789.1.859 WP_000639789.1.85900 WP_000639789.1.85904 WP_000639789.1.85917 WP_000639789.1.8594 WP_000639789.1.85943 WP_000639789.1.85976 WP_000639789.1.85977 WP_000639789.1.85982 WP_000639789.1.860 WP_000639789.1.86007 WP_000639789.1.86017 WP_000639789.1.86043 WP_000639789.1.8605 WP_000639789.1.86084 WP_000639789.1.8610 WP_000639789.1.86120 WP_000639789.1.86126 WP_000639789.1.86138 WP_000639789.1.8614 WP_000639789.1.86156 WP_000639789.1.86157 WP_000639789.1.86159 WP_000639789.1.8616 WP_000639789.1.86173 WP_000639789.1.86206 WP_000639789.1.86224 WP_000639789.1.86240 WP_000639789.1.86285 WP_000639789.1.86306 WP_000639789.1.86316 WP_000639789.1.86323 WP_000639789.1.86335 WP_000639789.1.86342 WP_000639789.1.86347 WP_000639789.1.86356 WP_000639789.1.86380 WP_000639789.1.8640 WP_000639789.1.8642 WP_000639789.1.86426 WP_000639789.1.86442 WP_000639789.1.86450 WP_000639789.1.86469 WP_000639789.1.8647 WP_000639789.1.86489 WP_000639789.1.86514 WP_000639789.1.86530 WP_000639789.1.86580 WP_000639789.1.86588 WP_000639789.1.86593 WP_000639789.1.86601 WP_000639789.1.86610 WP_000639789.1.86634 WP_000639789.1.86661 WP_000639789.1.86663 WP_000639789.1.86676 WP_000639789.1.86699 WP_000639789.1.8671 WP_000639789.1.8672 WP_000639789.1.86744 WP_000639789.1.86770 WP_000639789.1.8678 WP_000639789.1.86794 WP_000639789.1.86800 WP_000639789.1.86810 WP_000639789.1.86811 WP_000639789.1.86815 WP_000639789.1.8684 WP_000639789.1.86859 WP_000639789.1.86895 WP_000639789.1.86902 WP_000639789.1.86906 WP_000639789.1.86915 WP_000639789.1.86921 WP_000639789.1.86945 WP_000639789.1.86982 WP_000639789.1.86989 WP_000639789.1.87023 WP_000639789.1.87034 WP_000639789.1.87038 WP_000639789.1.87041 WP_000639789.1.87051 WP_000639789.1.87095 WP_000639789.1.87136 WP_000639789.1.87143 WP_000639789.1.87148 WP_000639789.1.87155 WP_000639789.1.87187 WP_000639789.1.8722 WP_000639789.1.87258 WP_000639789.1.87265 WP_000639789.1.87283 WP_000639789.1.87293 WP_000639789.1.87323 WP_000639789.1.87346 WP_000639789.1.8736 WP_000639789.1.87365 WP_000639789.1.87370 WP_000639789.1.87420 WP_000639789.1.87460 WP_000639789.1.87484 WP_000639789.1.87493 WP_000639789.1.87500 WP_000639789.1.87528 WP_000639789.1.87552 WP_000639789.1.87560 WP_000639789.1.87583 WP_000639789.1.87584 WP_000639789.1.8760 WP_000639789.1.87600 WP_000639789.1.87609 WP_000639789.1.87612 WP_000639789.1.87615 WP_000639789.1.87626 WP_000639789.1.87653 WP_000639789.1.87659 WP_000639789.1.8767 WP_000639789.1.87695 WP_000639789.1.87698 WP_000639789.1.87706 WP_000639789.1.87712 WP_000639789.1.87739 WP_000639789.1.87741 WP_000639789.1.87742 WP_000639789.1.87760 WP_000639789.1.87779 WP_000639789.1.87813 WP_000639789.1.87852 WP_000639789.1.87899 WP_000639789.1.87905 WP_000639789.1.8792 WP_000639789.1.87933 WP_000639789.1.87936 WP_000639789.1.87945 WP_000639789.1.87949 WP_000639789.1.87999 WP_000639789.1.8800 WP_000639789.1.88014 WP_000639789.1.88019 WP_000639789.1.88025 WP_000639789.1.88026 WP_000639789.1.8805 WP_000639789.1.88052 WP_000639789.1.8806 WP_000639789.1.88073 WP_000639789.1.8809 WP_000639789.1.88092 WP_000639789.1.881 WP_000639789.1.88145 WP_000639789.1.88165 WP_000639789.1.88174 WP_000639789.1.88185 WP_000639789.1.88199 WP_000639789.1.88222 WP_000639789.1.88244 WP_000639789.1.88264 WP_000639789.1.88275 WP_000639789.1.88291 WP_000639789.1.88293 WP_000639789.1.88299 WP_000639789.1.88303 WP_000639789.1.88313 WP_000639789.1.88356 WP_000639789.1.88359 WP_000639789.1.8837 WP_000639789.1.88393 WP_000639789.1.88407 WP_000639789.1.88414 WP_000639789.1.88423 WP_000639789.1.88444 WP_000639789.1.88446 WP_000639789.1.88458 WP_000639789.1.88474 WP_000639789.1.88483 WP_000639789.1.8849 WP_000639789.1.88501 WP_000639789.1.88508 WP_000639789.1.88538 WP_000639789.1.88547 WP_000639789.1.88597 WP_000639789.1.886 WP_000639789.1.88609 WP_000639789.1.88620 WP_000639789.1.88624 WP_000639789.1.88647 WP_000639789.1.88648 WP_000639789.1.88675 WP_000639789.1.88692 WP_000639789.1.88703 WP_000639789.1.88707 WP_000639789.1.88727 WP_000639789.1.88731 WP_000639789.1.88772 WP_000639789.1.88776 WP_000639789.1.88792 WP_000639789.1.88845 WP_000639789.1.88850 WP_000639789.1.88854 WP_000639789.1.8889 WP_000639789.1.88892 WP_000639789.1.88894 WP_000639789.1.88902 WP_000639789.1.8891 WP_000639789.1.88942 WP_000639789.1.88957 WP_000639789.1.88966 WP_000639789.1.88967 WP_000639789.1.88968 WP_000639789.1.88980 WP_000639789.1.88981 WP_000639789.1.88995 WP_000639789.1.88998 WP_000639789.1.89008 WP_000639789.1.89054 WP_000639789.1.89114 WP_000639789.1.89116 WP_000639789.1.89119 WP_000639789.1.89120 WP_000639789.1.89138 WP_000639789.1.89174 WP_000639789.1.89177 WP_000639789.1.89182 WP_000639789.1.89188 WP_000639789.1.89215 WP_000639789.1.89221 WP_000639789.1.89291 WP_000639789.1.89298 WP_000639789.1.89304 WP_000639789.1.89308 WP_000639789.1.89314 WP_000639789.1.89328 WP_000639789.1.89332 WP_000639789.1.89343 WP_000639789.1.89354 WP_000639789.1.89355 WP_000639789.1.89362 WP_000639789.1.89395 WP_000639789.1.8940 WP_000639789.1.89408 WP_000639789.1.89425 WP_000639789.1.89449 WP_000639789.1.89452 WP_000639789.1.8947 WP_000639789.1.89503 WP_000639789.1.89512 WP_000639789.1.89527 WP_000639789.1.89570 WP_000639789.1.89580 WP_000639789.1.89591 WP_000639789.1.89604 WP_000639789.1.89606 WP_000639789.1.8961 WP_000639789.1.89612 WP_000639789.1.89622 WP_000639789.1.89634 WP_000639789.1.89647 WP_000639789.1.89657 WP_000639789.1.89659 WP_000639789.1.89668 WP_000639789.1.89680 WP_000639789.1.89706 WP_000639789.1.89713 WP_000639789.1.89733 WP_000639789.1.89746 WP_000639789.1.89765 WP_000639789.1.89777 WP_000639789.1.89789 WP_000639789.1.89796 WP_000639789.1.89804 WP_000639789.1.89815 WP_000639789.1.89817 WP_000639789.1.89832 WP_000639789.1.89845 WP_000639789.1.89870 WP_000639789.1.89888 WP_000639789.1.89902 WP_000639789.1.89911 WP_000639789.1.89914 WP_000639789.1.8995 WP_000639789.1.89952 WP_000639789.1.8996 WP_000639789.1.89965 WP_000639789.1.89975 WP_000639789.1.90007 WP_000639789.1.9002 WP_000639789.1.9003 WP_000639789.1.90033 WP_000639789.1.90084 WP_000639789.1.90097 WP_000639789.1.90108 WP_000639789.1.9011 WP_000639789.1.90193 WP_000639789.1.90196 WP_000639789.1.90211 WP_000639789.1.90240 WP_000639789.1.90248 WP_000639789.1.90252 WP_000639789.1.90274 WP_000639789.1.90280 WP_000639789.1.90293 WP_000639789.1.90311 WP_000639789.1.90330 WP_000639789.1.90338 WP_000639789.1.90348 WP_000639789.1.90365 WP_000639789.1.90417 WP_000639789.1.90421 WP_000639789.1.90428 WP_000639789.1.90440 WP_000639789.1.90453 WP_000639789.1.90458 WP_000639789.1.90489 WP_000639789.1.90513 WP_000639789.1.90522 WP_000639789.1.90540 WP_000639789.1.90557 WP_000639789.1.90563 WP_000639789.1.90582 WP_000639789.1.90585 WP_000639789.1.90620 WP_000639789.1.9064 WP_000639789.1.90641 WP_000639789.1.90686 WP_000639789.1.90701 WP_000639789.1.90713 WP_000639789.1.90734 WP_000639789.1.90748 WP_000639789.1.90759 WP_000639789.1.90792 WP_000639789.1.90794 WP_000639789.1.90796 WP_000639789.1.90811 WP_000639789.1.90814 WP_000639789.1.90859 WP_000639789.1.90866 WP_000639789.1.90876 WP_000639789.1.90878 WP_000639789.1.9089 WP_000639789.1.9091 WP_000639789.1.9093 WP_000639789.1.90959 WP_000639789.1.90973 WP_000639789.1.90984 WP_000639789.1.91003 WP_000639789.1.91023 WP_000639789.1.91042 WP_000639789.1.91049 WP_000639789.1.91056 WP_000639789.1.91067 WP_000639789.1.91069 WP_000639789.1.91107 WP_000639789.1.91156 WP_000639789.1.91164 WP_000639789.1.91179 WP_000639789.1.91189 WP_000639789.1.91205 WP_000639789.1.91215 WP_000639789.1.91239 WP_000639789.1.91278 WP_000639789.1.91291 WP_000639789.1.9131 WP_000639789.1.91313 WP_000639789.1.91334 WP_000639789.1.9135 WP_000639789.1.9137 WP_000639789.1.91372 WP_000639789.1.91381 WP_000639789.1.91424 WP_000639789.1.91453 WP_000639789.1.91459 WP_000639789.1.91473 WP_000639789.1.91474 WP_000639789.1.91493 WP_000639789.1.91505 WP_000639789.1.91506 WP_000639789.1.91512 WP_000639789.1.91524 WP_000639789.1.91528 WP_000639789.1.91557 WP_000639789.1.91564 WP_000639789.1.91579 WP_000639789.1.91597 WP_000639789.1.91621 WP_000639789.1.91625 WP_000639789.1.91628 WP_000639789.1.91655 WP_000639789.1.91715 WP_000639789.1.91724 WP_000639789.1.91732 WP_000639789.1.91736 WP_000639789.1.91742 WP_000639789.1.91772 WP_000639789.1.91776 WP_000639789.1.91788 WP_000639789.1.91795 WP_000639789.1.91806 WP_000639789.1.9187 WP_000639789.1.91870 WP_000639789.1.91880 WP_000639789.1.91898 WP_000639789.1.91903 WP_000639789.1.91904 WP_000639789.1.91914 WP_000639789.1.91974 WP_000639789.1.92013 WP_000639789.1.92018 WP_000639789.1.92039 WP_000639789.1.92044 WP_000639789.1.92047 WP_000639789.1.92060 WP_000639789.1.92067 WP_000639789.1.92068 WP_000639789.1.92082 WP_000639789.1.92087 WP_000639789.1.92093 WP_000639789.1.92098 WP_000639789.1.92108 WP_000639789.1.92122 WP_000639789.1.92129 WP_000639789.1.92149 WP_000639789.1.92156 WP_000639789.1.92165 WP_000639789.1.92171 WP_000639789.1.92172 WP_000639789.1.92183 WP_000639789.1.92208 WP_000639789.1.92213 WP_000639789.1.9222 WP_000639789.1.92240 WP_000639789.1.92243 WP_000639789.1.92268 WP_000639789.1.92270 WP_000639789.1.92310 WP_000639789.1.92318 WP_000639789.1.92327 WP_000639789.1.92375 WP_000639789.1.92408 WP_000639789.1.92411 WP_000639789.1.92439 WP_000639789.1.92443 WP_000639789.1.92452 WP_000639789.1.92470 WP_000639789.1.92477 WP_000639789.1.92482 WP_000639789.1.92529 WP_000639789.1.9253 WP_000639789.1.92531 WP_000639789.1.92545 WP_000639789.1.92557 WP_000639789.1.92562 WP_000639789.1.92570 WP_000639789.1.92575 WP_000639789.1.92588 WP_000639789.1.926 WP_000639789.1.92628 WP_000639789.1.92633 WP_000639789.1.92649 WP_000639789.1.92659 WP_000639789.1.92669 WP_000639789.1.92671 WP_000639789.1.92676 WP_000639789.1.92705 WP_000639789.1.9271 WP_000639789.1.92734 WP_000639789.1.92738 WP_000639789.1.92754 WP_000639789.1.92758 WP_000639789.1.92806 WP_000639789.1.92810 WP_000639789.1.92823 WP_000639789.1.92832 WP_000639789.1.92875 WP_000639789.1.92879 WP_000639789.1.92883 WP_000639789.1.92890 WP_000639789.1.92893 WP_000639789.1.92926 WP_000639789.1.92929 WP_000639789.1.92939 WP_000639789.1.92987 WP_000639789.1.92988 WP_000639789.1.93007 WP_000639789.1.93022 WP_000639789.1.93059 WP_000639789.1.93076 WP_000639789.1.93086 WP_000639789.1.93101 WP_000639789.1.93103 WP_000639789.1.93105 WP_000639789.1.93111 WP_000639789.1.93121 WP_000639789.1.93136 WP_000639789.1.93155 WP_000639789.1.93168 WP_000639789.1.93184 WP_000639789.1.93213 WP_000639789.1.93215 WP_000639789.1.93221 WP_000639789.1.93223 WP_000639789.1.93239 WP_000639789.1.93275 WP_000639789.1.93302 WP_000639789.1.93322 WP_000639789.1.93339 WP_000639789.1.93350 WP_000639789.1.9336 WP_000639789.1.93365 WP_000639789.1.93376 WP_000639789.1.93387 WP_000639789.1.93410 WP_000639789.1.93469 WP_000639789.1.93511 WP_000639789.1.93512 WP_000639789.1.93524 WP_000639789.1.93543 WP_000639789.1.93577 WP_000639789.1.93596 WP_000639789.1.93604 WP_000639789.1.93635 WP_000639789.1.93648 WP_000639789.1.93650 WP_000639789.1.93656 WP_000639789.1.93657 WP_000639789.1.93662 WP_000639789.1.93671 WP_000639789.1.937 WP_000639789.1.93705 WP_000639789.1.9374 WP_000639789.1.93741 WP_000639789.1.9375 WP_000639789.1.93754 WP_000639789.1.93761 WP_000639789.1.93767 WP_000639789.1.93780 WP_000639789.1.9380 WP_000639789.1.93803 WP_000639789.1.93804 WP_000639789.1.93809 WP_000639789.1.93828 WP_000639789.1.93837 WP_000639789.1.93842 WP_000639789.1.93843 WP_000639789.1.93875 WP_000639789.1.9389 WP_000639789.1.93909 WP_000639789.1.93919 WP_000639789.1.93937 WP_000639789.1.93938 WP_000639789.1.93956 WP_000639789.1.93984 WP_000639789.1.93986 WP_000639789.1.9399 WP_000639789.1.93994 WP_000639789.1.94017 WP_000639789.1.94070 WP_000639789.1.94072 WP_000639789.1.94079 WP_000639789.1.94097 WP_000639789.1.94107 WP_000639789.1.94132 WP_000639789.1.94142 WP_000639789.1.94162 WP_000639789.1.94168 WP_000639789.1.94181 WP_000639789.1.94198 WP_000639789.1.94215 WP_000639789.1.94303 WP_000639789.1.9432 WP_000639789.1.94354 WP_000639789.1.94365 WP_000639789.1.94379 WP_000639789.1.94380 WP_000639789.1.94383 WP_000639789.1.94390 WP_000639789.1.9440 WP_000639789.1.94415 WP_000639789.1.94458 WP_000639789.1.94473 WP_000639789.1.94492 WP_000639789.1.94510 WP_000639789.1.94527 WP_000639789.1.94557 WP_000639789.1.94562 WP_000639789.1.94565 WP_000639789.1.94573 WP_000639789.1.94579 WP_000639789.1.94584 WP_000639789.1.94586 WP_000639789.1.94588 WP_000639789.1.94593 WP_000639789.1.94598 WP_000639789.1.94622 WP_000639789.1.9463 WP_000639789.1.94649 WP_000639789.1.94650 WP_000639789.1.94655 WP_000639789.1.94659 WP_000639789.1.94662 WP_000639789.1.94669 WP_000639789.1.94670 WP_000639789.1.94674 WP_000639789.1.94700 WP_000639789.1.94745 WP_000639789.1.94782 WP_000639789.1.94785 WP_000639789.1.94796 WP_000639789.1.94798 WP_000639789.1.9481 WP_000639789.1.94815 WP_000639789.1.94817 WP_000639789.1.94820 WP_000639789.1.94835 WP_000639789.1.94849 WP_000639789.1.94850 WP_000639789.1.94851 WP_000639789.1.94864 WP_000639789.1.94952 WP_000639789.1.94959 WP_000639789.1.94971 WP_000639789.1.94983 WP_000639789.1.94987 WP_000639789.1.95006 WP_000639789.1.95051 WP_000639789.1.95055 WP_000639789.1.95076 WP_000639789.1.95085 WP_000639789.1.95094 WP_000639789.1.95099 WP_000639789.1.95121 WP_000639789.1.95136 WP_000639789.1.95152 WP_000639789.1.9516 WP_000639789.1.95165 WP_000639789.1.95239 WP_000639789.1.95246 WP_000639789.1.95248 WP_000639789.1.95249 WP_000639789.1.9525 WP_000639789.1.95255 WP_000639789.1.95265 WP_000639789.1.9527 WP_000639789.1.95277 WP_000639789.1.95282 WP_000639789.1.95289 WP_000639789.1.9530 WP_000639789.1.95338 WP_000639789.1.95388 WP_000639789.1.95404 WP_000639789.1.95412 WP_000639789.1.95434 WP_000639789.1.95447 WP_000639789.1.95456 WP_000639789.1.95465 WP_000639789.1.95530 WP_000639789.1.95546 WP_000639789.1.95547 WP_000639789.1.95558 WP_000639789.1.95579 WP_000639789.1.95590 WP_000639789.1.95607 WP_000639789.1.95625 WP_000639789.1.95630 WP_000639789.1.95641 WP_000639789.1.95656 WP_000639789.1.95670 WP_000639789.1.95675 WP_000639789.1.95691 WP_000639789.1.95701 WP_000639789.1.95703 WP_000639789.1.95716 WP_000639789.1.95757 WP_000639789.1.95776 WP_000639789.1.95803 WP_000639789.1.95805 WP_000639789.1.95826 WP_000639789.1.95840 WP_000639789.1.9586 WP_000639789.1.95866 WP_000639789.1.95884 WP_000639789.1.95890 WP_000639789.1.95901 WP_000639789.1.95906 WP_000639789.1.95911 WP_000639789.1.95939 WP_000639789.1.95940 WP_000639789.1.95963 WP_000639789.1.96004 WP_000639789.1.96025 WP_000639789.1.96044 WP_000639789.1.96054 WP_000639789.1.9609 WP_000639789.1.96094 WP_000639789.1.96107 WP_000639789.1.96127 WP_000639789.1.96139 WP_000639789.1.96141 WP_000639789.1.96144 WP_000639789.1.96162 WP_000639789.1.96172 WP_000639789.1.96188 WP_000639789.1.96190 WP_000639789.1.96203 WP_000639789.1.96206 WP_000639789.1.96211 WP_000639789.1.96212 WP_000639789.1.9624 WP_000639789.1.96260 WP_000639789.1.9627 WP_000639789.1.96317 WP_000639789.1.96319 WP_000639789.1.9633 WP_000639789.1.96340 WP_000639789.1.96343 WP_000639789.1.96348 WP_000639789.1.96349 WP_000639789.1.96359 WP_000639789.1.96380 WP_000639789.1.96429 WP_000639789.1.9644 WP_000639789.1.96469 WP_000639789.1.96490 WP_000639789.1.96497 WP_000639789.1.96500 WP_000639789.1.96521 WP_000639789.1.96537 WP_000639789.1.96539 WP_000639789.1.96552 WP_000639789.1.96555 WP_000639789.1.96563 WP_000639789.1.96584 WP_000639789.1.96588 WP_000639789.1.96590 WP_000639789.1.96600 WP_000639789.1.96610 WP_000639789.1.96625 WP_000639789.1.96635 WP_000639789.1.9664 WP_000639789.1.96640 WP_000639789.1.96675 WP_000639789.1.9670 WP_000639789.1.96721 WP_000639789.1.96732 WP_000639789.1.96735 WP_000639789.1.9674 WP_000639789.1.96750 WP_000639789.1.96758 WP_000639789.1.96761 WP_000639789.1.96771 WP_000639789.1.96792 WP_000639789.1.96798 WP_000639789.1.96801 WP_000639789.1.96803 WP_000639789.1.9686 WP_000639789.1.96876 WP_000639789.1.96890 WP_000639789.1.96917 WP_000639789.1.96925 WP_000639789.1.96938 WP_000639789.1.96946 WP_000639789.1.96957 WP_000639789.1.96978 WP_000639789.1.96993 WP_000639789.1.97015 WP_000639789.1.97026 WP_000639789.1.97028 WP_000639789.1.97043 WP_000639789.1.97047 WP_000639789.1.97079 WP_000639789.1.97089 WP_000639789.1.97103 WP_000639789.1.97109 WP_000639789.1.97143 WP_000639789.1.97145 WP_000639789.1.97154 WP_000639789.1.97184 WP_000639789.1.97185 WP_000639789.1.97190 WP_000639789.1.97224 WP_000639789.1.97260 WP_000639789.1.97287 WP_000639789.1.97291 WP_000639789.1.97297 WP_000639789.1.97318 WP_000639789.1.97322 WP_000639789.1.97328 WP_000639789.1.97337 WP_000639789.1.97369 WP_000639789.1.97386 WP_000639789.1.97413 WP_000639789.1.97422 WP_000639789.1.97441 WP_000639789.1.97477 WP_000639789.1.97487 WP_000639789.1.97497 WP_000639789.1.97505 WP_000639789.1.97534 WP_000639789.1.97547 WP_000639789.1.97594 WP_000639789.1.97597 WP_000639789.1.97599 WP_000639789.1.97606 WP_000639789.1.97613 WP_000639789.1.97615 WP_000639789.1.97620 WP_000639789.1.97628 WP_000639789.1.97631 WP_000639789.1.97640 WP_000639789.1.97646 WP_000639789.1.97648 WP_000639789.1.97656 WP_000639789.1.97690 WP_000639789.1.97691 WP_000639789.1.97693 WP_000639789.1.97704 WP_000639789.1.97726 WP_000639789.1.97727 WP_000639789.1.97732 WP_000639789.1.97736 WP_000639789.1.9774 WP_000639789.1.9775 WP_000639789.1.97768 WP_000639789.1.97772 WP_000639789.1.97800 WP_000639789.1.97819 WP_000639789.1.97840 WP_000639789.1.97846 WP_000639789.1.97873 WP_000639789.1.97907 WP_000639789.1.9793 WP_000639789.1.97938 WP_000639789.1.97981 WP_000639789.1.97983 WP_000639789.1.97986 WP_000639789.1.9799 WP_000639789.1.97991 WP_000639789.1.98006 WP_000639789.1.98019 WP_000639789.1.98022 WP_000639789.1.98036 WP_000639789.1.9805 WP_000639789.1.98080 WP_000639789.1.98086 WP_000639789.1.98107 WP_000639789.1.98110 WP_000639789.1.98119 WP_000639789.1.98124 WP_000639789.1.98146 WP_000639789.1.98158 WP_000639789.1.98170 WP_000639789.1.98201 WP_000639789.1.98219 WP_000639789.1.98250 WP_000639789.1.9826 WP_000639789.1.98263 WP_000639789.1.98314 WP_000639789.1.98338 WP_000639789.1.98403 WP_000639789.1.9841 WP_000639789.1.98418 WP_000639789.1.98440 WP_000639789.1.98448 WP_000639789.1.98457 WP_000639789.1.98472 WP_000639789.1.98483 WP_000639789.1.98495 WP_000639789.1.9850 WP_000639789.1.98502 WP_000639789.1.98513 WP_000639789.1.98531 WP_000639789.1.98551 WP_000639789.1.98570 WP_000639789.1.98577 WP_000639789.1.98607 WP_000639789.1.98608 WP_000639789.1.98627 WP_000639789.1.98634 WP_000639789.1.98676 WP_000639789.1.98677 WP_000639789.1.98726 WP_000639789.1.98731 WP_000639789.1.98760 WP_000639789.1.98762 WP_000639789.1.9877 WP_000639789.1.98779 WP_000639789.1.98801 WP_000639789.1.98818 WP_000639789.1.98843 WP_000639789.1.9887 WP_000639789.1.98947 WP_000639789.1.9898 WP_000639789.1.9899 WP_000639789.1.99040 WP_000639789.1.99057 WP_000639789.1.99071 WP_000639789.1.99072 WP_000639789.1.99083 WP_000639789.1.99097 WP_000639789.1.99098 WP_000639789.1.99107 WP_000639789.1.99163 WP_000639789.1.99164 WP_000639789.1.99184 WP_000639789.1.9919 WP_000639789.1.99197 WP_000639789.1.99198 WP_000639789.1.99215 WP_000639789.1.99219 WP_000639789.1.99255 WP_000639789.1.99267 WP_000639789.1.99276 WP_000639789.1.99327 WP_000639789.1.99335 WP_000639789.1.99339 WP_000639789.1.99350 WP_000639789.1.99360 WP_000639789.1.99363 WP_000639789.1.99369 WP_000639789.1.99388 WP_000639789.1.99397 WP_000639789.1.99456 WP_000639789.1.99463 WP_000639789.1.99483 WP_000639789.1.99490 WP_000639789.1.99493 WP_000639789.1.9954 WP_000639789.1.99546 WP_000639789.1.99561 WP_000639789.1.99577 WP_000639789.1.99579 WP_000639789.1.99595 WP_000639789.1.99613 WP_000639789.1.99626 WP_000639789.1.99630 WP_000639789.1.99637 WP_000639789.1.99646 WP_000639789.1.99657 WP_000639789.1.99660 WP_000639789.1.99671 WP_000639789.1.99676 WP_000639789.1.99712 WP_000639789.1.99725 WP_000639789.1.99764 WP_000639789.1.99783 WP_000639789.1.99813 WP_000639789.1.99829 WP_000639789.1.99837 WP_000639789.1.99841 WP_000639789.1.99858 WP_000639789.1.99889 WP_000639789.1.9992 WP_000639789.1.99924 WP_000639789.1.99958 WP_000639789.1.99961 WP_000639789.1.99996 gi|198245774|ref|YP_002217501.1| gi|525814815|ref|YP_008244833.1| gi|194450743|ref|YP_002047567.1| gi|29144245|ref|NP_807587.1| APC24028 gi|525859224|ref|YP_008262787.1| gi|379702803|ref|YP_005244531.1| gi|525840334|ref|YP_008257841.1| gi|378990848|ref|YP_005254012.1| gi|378962155|ref|YP_005219641.1| gi|528817065|ref|YP_008358268.1| gi|378452391|ref|YP_005239751.1| gi|549726097|ref|YP_008646287.1| gi|378446918|ref|YP_005234550.1| gi|16766830|ref|NP_462445.1| gi|550902887|ref|YP_008671979.1| gi|378701435|ref|YP_005183393.1| gi|409247220|ref|YP_006887919.1| gi|378986138|ref|YP_005249294.1| ABAK02000001|CDS_3030858-3030163 ABAM02000001|CDS_4086439-4085744 ABAN01000001|CDS_350112-350807 ABAO01000004|CDS_71715-71020 ABEH02000004|CDS_376691-377386 ABEI01000012|CDS_111247-110552 ABEL01000003|CDS_110780-110085 ABEW01000004|CDS_376426-377121 ABFF01000002|CDS_315545-316240 ABFG01000002|CDS_342214-342909 AE006468|CDS_3713987-3713292 AE014613|CDS_4116334-4117029 AL513382|CDS_4131687-4132382 AM933172|CDS_3594800-3594105 CP001113|CDS_3688500-3687805 CP001120|CDS_3727390-3726695 CP001144|CDS_3753742-3753047 CP001363|CDS_3727686-3726991 FN424405|CDS_3736860-3736165 NZ_ACBF01000002|CDS_350519-351214 gi|526218527|ref|YP_008263710.1| gi|488656416|ref|YP_007928219.1| gi|482906109|ref|YP_007904669.1| 209261.t3977 220341.STY4267 423368.SNSL254_A3811 439851.SeD_A3913 454169.SeHA_C3853 550537.SEN3367 99287.STM3544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]