SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452903|ref|YP_005240263.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452903|ref|YP_005240263.1|
Domain Number 1 Region: 523-928
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4e-162
Family DNA polymerase I 0.00000000000053
Further Details:      
 
Domain Number 2 Region: 7-170
Classification Level Classification E-value
Superfamily PIN domain-like 1.07e-56
Family 5' to 3' exonuclease catalytic domain 0.0000465
Further Details:      
 
Domain Number 3 Region: 327-518
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-55
Family DnaQ-like 3'-5' exonuclease 0.0000000147
Further Details:      
 
Domain Number 4 Region: 171-291
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 9.12e-29
Family 5' to 3' exonuclease, C-terminal subdomain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378452903|ref|YP_005240263.1|
Sequence length 928
Comment DNA polymerase I [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MVQIPENPLILVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLNMLRSLIMQYQPTHAAV
VFDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAVSGVEADDVIGT
LAREAEKVGRPVLISTGDKDMAQLVTPNITLINTMTNTILGPDEVVNKYGVPPELIIDFL
ALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLYAEPEKIAGLTFRGAKTMAGKLAQNK
DVAYLSYKLATIKTDVELELTCEQLEVQQPIADELLGLFKKYEFKRWTADVESGKWLQAK
GAKPAAKPQETVVIDESPSEPAAALSYENYVTILDDVTLESWIEKLKKAPVFAFDTETDS
LDNIAANLVGLSFAIEPGVAAYVPVAHDYLDAPDQISRQRALELLKPLLEDEKVRKVGQN
LKYDRGVLQNYGIELRGIAFDTMLESYILNSVAGRHDMDSLSDRWLKHKTITFEDIAGKG
KNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPELQQHKGPLNVFENIEMPLVPVLSRV
ERNGVKIDPAVLHKHSEEITLRLAELEKKAHDIAGEAFNLSSTKQLQTILFEKQGIKPLK
KTPGGAPSTSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYH
QAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYLIVSADYSQIELRIMAHLSRD
KGLLTAFAEGKDIHRATAAEVFGLPLDSVTGEQRRSAKAINFGLIYGMSAFGLSRQLNIP
RKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLEGRRLYLPDIKSSNAARRAGAE
RAAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDDLDAVAKRI
HQLMENCTRIDVPLLVEVGSGENWDQAH
Download sequence
Identical sequences A0A0F6B9G5 A0A0H2WUJ9 A0A0H3BRT1 A0A0H3NHZ9 A0A0M0PQZ1 A0A0R9MF29 A0A0T9XKN5 A0A0U1G3K5 A0A265AYW9 A0A2D0MHQ3 A0A2D3AIS5 A0A2H9YEV8 A0A2J0RK99 C0Q3G6 E8XJI2 Q57HL5 Q9F173 S5HFJ0 V1X2W1 V7IJX3
gi|16767264|ref|NP_462879.1| gi|194444061|ref|YP_002043223.1| gi|482906550|ref|YP_007905110.1| gi|525855935|ref|YP_008258545.1| gi|538364578|ref|YP_008507863.1| gi|194448474|ref|YP_002048004.1| gi|378986684|ref|YP_005249840.1| gi|379703242|ref|YP_005244970.1| 272994.SPAB_04960 295319.SPA3840 321314.SC3891 423368.SNSL254_A4281 454169.SeHA_C4327 476213.SPC_4103 554290.SSPA3571 99287.STM3999 gi|550903362|ref|YP_008672454.1| gi|197364776|ref|YP_002144413.1| gi|549726525|ref|YP_008646715.1| gi|378447337|ref|YP_005234969.1| gi|378701859|ref|YP_005183817.1| gi|224585810|ref|YP_002639609.1| gi|386589358|ref|YP_006085758.1| gi|378991281|ref|YP_005254445.1| gi|56415846|ref|YP_152921.1| gi|161617122|ref|YP_001591087.1| gi|62182461|ref|YP_218878.1| gi|525828363|ref|YP_008251211.1| ABEL01000012|CDS_133207-130421 AE006468|CDS_4206131-4208917 AE017220|CDS_4140207-4142993 CP000026|CDS_3984210-3986996 CP000857|CDS_4179412-4182198 CP000886|CDS_4151474-4154260 CP001113|CDS_4170717-4173503 CP001120|CDS_4214458-4217244 CP001363|CDS_4219715-4222501 FM200053|CDS_3979893-3982679 FN424405|CDS_4228898-4231684 gi|525815265|ref|YP_008245283.1| gi|383498601|ref|YP_005399290.1| NP_462879.1.58477 WP_000249972.1.100010 WP_000249972.1.100234 WP_000249972.1.100376 WP_000249972.1.100424 WP_000249972.1.100432 WP_000249972.1.100436 WP_000249972.1.100484 WP_000249972.1.100488 WP_000249972.1.100502 WP_000249972.1.100597 WP_000249972.1.100711 WP_000249972.1.100730 WP_000249972.1.100793 WP_000249972.1.100870 WP_000249972.1.100871 WP_000249972.1.101007 WP_000249972.1.101042 WP_000249972.1.101074 WP_000249972.1.101111 WP_000249972.1.101180 WP_000249972.1.101199 WP_000249972.1.101239 WP_000249972.1.101259 WP_000249972.1.101284 WP_000249972.1.101291 WP_000249972.1.1013 WP_000249972.1.101353 WP_000249972.1.101404 WP_000249972.1.101420 WP_000249972.1.101589 WP_000249972.1.101707 WP_000249972.1.101841 WP_000249972.1.101878 WP_000249972.1.101904 WP_000249972.1.10191 WP_000249972.1.101953 WP_000249972.1.102009 WP_000249972.1.10220 WP_000249972.1.10266 WP_000249972.1.10276 WP_000249972.1.10439 WP_000249972.1.10465 WP_000249972.1.10521 WP_000249972.1.10566 WP_000249972.1.10675 WP_000249972.1.10753 WP_000249972.1.10992 WP_000249972.1.11031 WP_000249972.1.11098 WP_000249972.1.1110 WP_000249972.1.11156 WP_000249972.1.11295 WP_000249972.1.11458 WP_000249972.1.11518 WP_000249972.1.11532 WP_000249972.1.11543 WP_000249972.1.11565 WP_000249972.1.11588 WP_000249972.1.11687 WP_000249972.1.11735 WP_000249972.1.11763 WP_000249972.1.11772 WP_000249972.1.11810 WP_000249972.1.11834 WP_000249972.1.11938 WP_000249972.1.12017 WP_000249972.1.12210 WP_000249972.1.12280 WP_000249972.1.12308 WP_000249972.1.12351 WP_000249972.1.12370 WP_000249972.1.12456 WP_000249972.1.12546 WP_000249972.1.12864 WP_000249972.1.12865 WP_000249972.1.12879 WP_000249972.1.12936 WP_000249972.1.12995 WP_000249972.1.13027 WP_000249972.1.13106 WP_000249972.1.13207 WP_000249972.1.1326 WP_000249972.1.13262 WP_000249972.1.13446 WP_000249972.1.13488 WP_000249972.1.13509 WP_000249972.1.13543 WP_000249972.1.13602 WP_000249972.1.13661 WP_000249972.1.13848 WP_000249972.1.1387 WP_000249972.1.13908 WP_000249972.1.13932 WP_000249972.1.13967 WP_000249972.1.13968 WP_000249972.1.14041 WP_000249972.1.14111 WP_000249972.1.14151 WP_000249972.1.14239 WP_000249972.1.14320 WP_000249972.1.14379 WP_000249972.1.14410 WP_000249972.1.14436 WP_000249972.1.14446 WP_000249972.1.14458 WP_000249972.1.14466 WP_000249972.1.14524 WP_000249972.1.14554 WP_000249972.1.14618 WP_000249972.1.14725 WP_000249972.1.14808 WP_000249972.1.14852 WP_000249972.1.14884 WP_000249972.1.1489 WP_000249972.1.14932 WP_000249972.1.15011 WP_000249972.1.15055 WP_000249972.1.15124 WP_000249972.1.15223 WP_000249972.1.15316 WP_000249972.1.15369 WP_000249972.1.1540 WP_000249972.1.15468 WP_000249972.1.15483 WP_000249972.1.15508 WP_000249972.1.15625 WP_000249972.1.15637 WP_000249972.1.15708 WP_000249972.1.15784 WP_000249972.1.15835 WP_000249972.1.15862 WP_000249972.1.15938 WP_000249972.1.15986 WP_000249972.1.16004 WP_000249972.1.16028 WP_000249972.1.16047 WP_000249972.1.16103 WP_000249972.1.1611 WP_000249972.1.16233 WP_000249972.1.16244 WP_000249972.1.16284 WP_000249972.1.16331 WP_000249972.1.1635 WP_000249972.1.16361 WP_000249972.1.16468 WP_000249972.1.16525 WP_000249972.1.16650 WP_000249972.1.16686 WP_000249972.1.16691 WP_000249972.1.16710 WP_000249972.1.16735 WP_000249972.1.16786 WP_000249972.1.16858 WP_000249972.1.16873 WP_000249972.1.16896 WP_000249972.1.16903 WP_000249972.1.16941 WP_000249972.1.16965 WP_000249972.1.16998 WP_000249972.1.17093 WP_000249972.1.17285 WP_000249972.1.17307 WP_000249972.1.17390 WP_000249972.1.174 WP_000249972.1.17439 WP_000249972.1.17480 WP_000249972.1.17546 WP_000249972.1.17560 WP_000249972.1.17702 WP_000249972.1.17705 WP_000249972.1.17743 WP_000249972.1.17758 WP_000249972.1.17865 WP_000249972.1.17891 WP_000249972.1.17901 WP_000249972.1.1798 WP_000249972.1.17991 WP_000249972.1.18019 WP_000249972.1.18122 WP_000249972.1.1814 WP_000249972.1.18163 WP_000249972.1.18177 WP_000249972.1.18178 WP_000249972.1.1818 WP_000249972.1.18254 WP_000249972.1.18265 WP_000249972.1.18355 WP_000249972.1.18607 WP_000249972.1.18705 WP_000249972.1.18715 WP_000249972.1.18776 WP_000249972.1.18949 WP_000249972.1.1897 WP_000249972.1.19038 WP_000249972.1.19273 WP_000249972.1.19320 WP_000249972.1.19340 WP_000249972.1.1939 WP_000249972.1.19458 WP_000249972.1.19460 WP_000249972.1.19461 WP_000249972.1.19588 WP_000249972.1.19614 WP_000249972.1.19616 WP_000249972.1.19683 WP_000249972.1.19702 WP_000249972.1.19723 WP_000249972.1.19724 WP_000249972.1.19749 WP_000249972.1.19784 WP_000249972.1.19793 WP_000249972.1.19802 WP_000249972.1.19851 WP_000249972.1.19867 WP_000249972.1.19882 WP_000249972.1.19975 WP_000249972.1.20 WP_000249972.1.20034 WP_000249972.1.20089 WP_000249972.1.2010 WP_000249972.1.20119 WP_000249972.1.20218 WP_000249972.1.20266 WP_000249972.1.20271 WP_000249972.1.20391 WP_000249972.1.20418 WP_000249972.1.20425 WP_000249972.1.20443 WP_000249972.1.20446 WP_000249972.1.20525 WP_000249972.1.2054 WP_000249972.1.20553 WP_000249972.1.20564 WP_000249972.1.20614 WP_000249972.1.20626 WP_000249972.1.20631 WP_000249972.1.20646 WP_000249972.1.20695 WP_000249972.1.20886 WP_000249972.1.20894 WP_000249972.1.20908 WP_000249972.1.21049 WP_000249972.1.21136 WP_000249972.1.21245 WP_000249972.1.21269 WP_000249972.1.21309 WP_000249972.1.21326 WP_000249972.1.21351 WP_000249972.1.2139 WP_000249972.1.21400 WP_000249972.1.21404 WP_000249972.1.21497 WP_000249972.1.21499 WP_000249972.1.21534 WP_000249972.1.21603 WP_000249972.1.21792 WP_000249972.1.21845 WP_000249972.1.21940 WP_000249972.1.21991 WP_000249972.1.22019 WP_000249972.1.22024 WP_000249972.1.22030 WP_000249972.1.22062 WP_000249972.1.22067 WP_000249972.1.22117 WP_000249972.1.22169 WP_000249972.1.2221 WP_000249972.1.22235 WP_000249972.1.2224 WP_000249972.1.22270 WP_000249972.1.2235 WP_000249972.1.22379 WP_000249972.1.22451 WP_000249972.1.22485 WP_000249972.1.22514 WP_000249972.1.22566 WP_000249972.1.22692 WP_000249972.1.22758 WP_000249972.1.22864 WP_000249972.1.23114 WP_000249972.1.2314 WP_000249972.1.23192 WP_000249972.1.23246 WP_000249972.1.23274 WP_000249972.1.23279 WP_000249972.1.23379 WP_000249972.1.2342 WP_000249972.1.23460 WP_000249972.1.23466 WP_000249972.1.23482 WP_000249972.1.23503 WP_000249972.1.23509 WP_000249972.1.23634 WP_000249972.1.23639 WP_000249972.1.2364 WP_000249972.1.23736 WP_000249972.1.23932 WP_000249972.1.23959 WP_000249972.1.24082 WP_000249972.1.24163 WP_000249972.1.24308 WP_000249972.1.24325 WP_000249972.1.24394 WP_000249972.1.24419 WP_000249972.1.24433 WP_000249972.1.24567 WP_000249972.1.24578 WP_000249972.1.2467 WP_000249972.1.24779 WP_000249972.1.25008 WP_000249972.1.25036 WP_000249972.1.25119 WP_000249972.1.25405 WP_000249972.1.25454 WP_000249972.1.25498 WP_000249972.1.2554 WP_000249972.1.25564 WP_000249972.1.25668 WP_000249972.1.25690 WP_000249972.1.2570 WP_000249972.1.25722 WP_000249972.1.25740 WP_000249972.1.25793 WP_000249972.1.25814 WP_000249972.1.25825 WP_000249972.1.25846 WP_000249972.1.25988 WP_000249972.1.26122 WP_000249972.1.26123 WP_000249972.1.26269 WP_000249972.1.26311 WP_000249972.1.26319 WP_000249972.1.26363 WP_000249972.1.26426 WP_000249972.1.26429 WP_000249972.1.26440 WP_000249972.1.26493 WP_000249972.1.26551 WP_000249972.1.26567 WP_000249972.1.26741 WP_000249972.1.26750 WP_000249972.1.26787 WP_000249972.1.26856 WP_000249972.1.26919 WP_000249972.1.26924 WP_000249972.1.27010 WP_000249972.1.27051 WP_000249972.1.27173 WP_000249972.1.27206 WP_000249972.1.27223 WP_000249972.1.27279 WP_000249972.1.27419 WP_000249972.1.27423 WP_000249972.1.27544 WP_000249972.1.2763 WP_000249972.1.27679 WP_000249972.1.27761 WP_000249972.1.2777 WP_000249972.1.27798 WP_000249972.1.27969 WP_000249972.1.27977 WP_000249972.1.28032 WP_000249972.1.28094 WP_000249972.1.28170 WP_000249972.1.28225 WP_000249972.1.28235 WP_000249972.1.2835 WP_000249972.1.28575 WP_000249972.1.28612 WP_000249972.1.28625 WP_000249972.1.28655 WP_000249972.1.28694 WP_000249972.1.2879 WP_000249972.1.28830 WP_000249972.1.2890 WP_000249972.1.28902 WP_000249972.1.28938 WP_000249972.1.28946 WP_000249972.1.29010 WP_000249972.1.2910 WP_000249972.1.29113 WP_000249972.1.29130 WP_000249972.1.29509 WP_000249972.1.29530 WP_000249972.1.29606 WP_000249972.1.29615 WP_000249972.1.29619 WP_000249972.1.29682 WP_000249972.1.29768 WP_000249972.1.29774 WP_000249972.1.29827 WP_000249972.1.2984 WP_000249972.1.29845 WP_000249972.1.29924 WP_000249972.1.29969 WP_000249972.1.30022 WP_000249972.1.30027 WP_000249972.1.30179 WP_000249972.1.30180 WP_000249972.1.30238 WP_000249972.1.30246 WP_000249972.1.30505 WP_000249972.1.30507 WP_000249972.1.30547 WP_000249972.1.30555 WP_000249972.1.30573 WP_000249972.1.3076 WP_000249972.1.30794 WP_000249972.1.30803 WP_000249972.1.30819 WP_000249972.1.30833 WP_000249972.1.30835 WP_000249972.1.30909 WP_000249972.1.30972 WP_000249972.1.31 WP_000249972.1.31001 WP_000249972.1.31069 WP_000249972.1.31092 WP_000249972.1.31107 WP_000249972.1.31111 WP_000249972.1.31122 WP_000249972.1.3113 WP_000249972.1.31156 WP_000249972.1.3119 WP_000249972.1.31190 WP_000249972.1.31195 WP_000249972.1.31196 WP_000249972.1.31210 WP_000249972.1.31251 WP_000249972.1.31362 WP_000249972.1.31451 WP_000249972.1.31476 WP_000249972.1.31504 WP_000249972.1.31515 WP_000249972.1.31546 WP_000249972.1.31578 WP_000249972.1.31658 WP_000249972.1.3170 WP_000249972.1.31854 WP_000249972.1.31940 WP_000249972.1.31967 WP_000249972.1.31972 WP_000249972.1.32006 WP_000249972.1.32192 WP_000249972.1.32206 WP_000249972.1.32260 WP_000249972.1.32277 WP_000249972.1.32408 WP_000249972.1.32423 WP_000249972.1.32438 WP_000249972.1.32493 WP_000249972.1.32515 WP_000249972.1.32624 WP_000249972.1.32629 WP_000249972.1.32702 WP_000249972.1.32747 WP_000249972.1.329 WP_000249972.1.33010 WP_000249972.1.33030 WP_000249972.1.33127 WP_000249972.1.33143 WP_000249972.1.33248 WP_000249972.1.33261 WP_000249972.1.333 WP_000249972.1.33420 WP_000249972.1.33486 WP_000249972.1.33492 WP_000249972.1.33504 WP_000249972.1.33553 WP_000249972.1.33592 WP_000249972.1.33609 WP_000249972.1.33629 WP_000249972.1.33870 WP_000249972.1.33894 WP_000249972.1.34043 WP_000249972.1.34075 WP_000249972.1.34081 WP_000249972.1.34126 WP_000249972.1.34257 WP_000249972.1.34279 WP_000249972.1.34304 WP_000249972.1.34319 WP_000249972.1.34417 WP_000249972.1.34424 WP_000249972.1.3445 WP_000249972.1.34610 WP_000249972.1.34704 WP_000249972.1.34817 WP_000249972.1.34856 WP_000249972.1.34975 WP_000249972.1.35045 WP_000249972.1.35129 WP_000249972.1.35184 WP_000249972.1.35331 WP_000249972.1.35404 WP_000249972.1.35408 WP_000249972.1.35425 WP_000249972.1.35446 WP_000249972.1.35463 WP_000249972.1.35503 WP_000249972.1.35507 WP_000249972.1.35509 WP_000249972.1.3556 WP_000249972.1.35590 WP_000249972.1.3566 WP_000249972.1.35892 WP_000249972.1.35940 WP_000249972.1.36003 WP_000249972.1.3601 WP_000249972.1.36011 WP_000249972.1.36017 WP_000249972.1.36057 WP_000249972.1.36157 WP_000249972.1.36286 WP_000249972.1.36586 WP_000249972.1.3670 WP_000249972.1.36705 WP_000249972.1.36751 WP_000249972.1.36875 WP_000249972.1.36931 WP_000249972.1.36948 WP_000249972.1.36949 WP_000249972.1.37073 WP_000249972.1.37111 WP_000249972.1.37112 WP_000249972.1.37256 WP_000249972.1.37267 WP_000249972.1.37293 WP_000249972.1.37370 WP_000249972.1.3744 WP_000249972.1.37498 WP_000249972.1.37558 WP_000249972.1.3756 WP_000249972.1.37618 WP_000249972.1.37968 WP_000249972.1.37978 WP_000249972.1.38199 WP_000249972.1.383 WP_000249972.1.38393 WP_000249972.1.38452 WP_000249972.1.3848 WP_000249972.1.38569 WP_000249972.1.38609 WP_000249972.1.38620 WP_000249972.1.38673 WP_000249972.1.38693 WP_000249972.1.38781 WP_000249972.1.3891 WP_000249972.1.38913 WP_000249972.1.38942 WP_000249972.1.39112 WP_000249972.1.39136 WP_000249972.1.39197 WP_000249972.1.39229 WP_000249972.1.39265 WP_000249972.1.39405 WP_000249972.1.39420 WP_000249972.1.39497 WP_000249972.1.39512 WP_000249972.1.39584 WP_000249972.1.39629 WP_000249972.1.39632 WP_000249972.1.39723 WP_000249972.1.39724 WP_000249972.1.39763 WP_000249972.1.39862 WP_000249972.1.39921 WP_000249972.1.39923 WP_000249972.1.39953 WP_000249972.1.40017 WP_000249972.1.40031 WP_000249972.1.40072 WP_000249972.1.40073 WP_000249972.1.4011 WP_000249972.1.40208 WP_000249972.1.40240 WP_000249972.1.40254 WP_000249972.1.40257 WP_000249972.1.40292 WP_000249972.1.40374 WP_000249972.1.40380 WP_000249972.1.40395 WP_000249972.1.40465 WP_000249972.1.40492 WP_000249972.1.40688 WP_000249972.1.40710 WP_000249972.1.4075 WP_000249972.1.4087 WP_000249972.1.40877 WP_000249972.1.40996 WP_000249972.1.41017 WP_000249972.1.41018 WP_000249972.1.41086 WP_000249972.1.41091 WP_000249972.1.41279 WP_000249972.1.41299 WP_000249972.1.41310 WP_000249972.1.41438 WP_000249972.1.41440 WP_000249972.1.41516 WP_000249972.1.41554 WP_000249972.1.41572 WP_000249972.1.41591 WP_000249972.1.41761 WP_000249972.1.41882 WP_000249972.1.41979 WP_000249972.1.41998 WP_000249972.1.42009 WP_000249972.1.42098 WP_000249972.1.42156 WP_000249972.1.4222 WP_000249972.1.42243 WP_000249972.1.4229 WP_000249972.1.42320 WP_000249972.1.42372 WP_000249972.1.4239 WP_000249972.1.42422 WP_000249972.1.42444 WP_000249972.1.42676 WP_000249972.1.4276 WP_000249972.1.42767 WP_000249972.1.42797 WP_000249972.1.42829 WP_000249972.1.42864 WP_000249972.1.42887 WP_000249972.1.42981 WP_000249972.1.43018 WP_000249972.1.43041 WP_000249972.1.43077 WP_000249972.1.43244 WP_000249972.1.43312 WP_000249972.1.43334 WP_000249972.1.43371 WP_000249972.1.43437 WP_000249972.1.43528 WP_000249972.1.43535 WP_000249972.1.43613 WP_000249972.1.43668 WP_000249972.1.4373 WP_000249972.1.43778 WP_000249972.1.43875 WP_000249972.1.43886 WP_000249972.1.43951 WP_000249972.1.44005 WP_000249972.1.44043 WP_000249972.1.4405 WP_000249972.1.44099 WP_000249972.1.44121 WP_000249972.1.44144 WP_000249972.1.44291 WP_000249972.1.44300 WP_000249972.1.44310 WP_000249972.1.44386 WP_000249972.1.44433 WP_000249972.1.44440 WP_000249972.1.44578 WP_000249972.1.44606 WP_000249972.1.44607 WP_000249972.1.44640 WP_000249972.1.4467 WP_000249972.1.44687 WP_000249972.1.4485 WP_000249972.1.44877 WP_000249972.1.44933 WP_000249972.1.44943 WP_000249972.1.45038 WP_000249972.1.4505 WP_000249972.1.45067 WP_000249972.1.45074 WP_000249972.1.45079 WP_000249972.1.45145 WP_000249972.1.45177 WP_000249972.1.45184 WP_000249972.1.45259 WP_000249972.1.45322 WP_000249972.1.45349 WP_000249972.1.45365 WP_000249972.1.45434 WP_000249972.1.45550 WP_000249972.1.45582 WP_000249972.1.45585 WP_000249972.1.45622 WP_000249972.1.45660 WP_000249972.1.45690 WP_000249972.1.45848 WP_000249972.1.46011 WP_000249972.1.46028 WP_000249972.1.46069 WP_000249972.1.46173 WP_000249972.1.46174 WP_000249972.1.46187 WP_000249972.1.46250 WP_000249972.1.46278 WP_000249972.1.46303 WP_000249972.1.46322 WP_000249972.1.46345 WP_000249972.1.46595 WP_000249972.1.46620 WP_000249972.1.46689 WP_000249972.1.46693 WP_000249972.1.46730 WP_000249972.1.46749 WP_000249972.1.46803 WP_000249972.1.46804 WP_000249972.1.46961 WP_000249972.1.47005 WP_000249972.1.47008 WP_000249972.1.47023 WP_000249972.1.47057 WP_000249972.1.47061 WP_000249972.1.47067 WP_000249972.1.47214 WP_000249972.1.47243 WP_000249972.1.47429 WP_000249972.1.47442 WP_000249972.1.4747 WP_000249972.1.47472 WP_000249972.1.47478 WP_000249972.1.47492 WP_000249972.1.47542 WP_000249972.1.47579 WP_000249972.1.47587 WP_000249972.1.47621 WP_000249972.1.47660 WP_000249972.1.47714 WP_000249972.1.4775 WP_000249972.1.47799 WP_000249972.1.47902 WP_000249972.1.47992 WP_000249972.1.48124 WP_000249972.1.48132 WP_000249972.1.48134 WP_000249972.1.48218 WP_000249972.1.48247 WP_000249972.1.483 WP_000249972.1.48367 WP_000249972.1.48377 WP_000249972.1.48510 WP_000249972.1.4853 WP_000249972.1.48651 WP_000249972.1.48755 WP_000249972.1.48768 WP_000249972.1.48774 WP_000249972.1.48788 WP_000249972.1.48841 WP_000249972.1.4885 WP_000249972.1.48876 WP_000249972.1.48886 WP_000249972.1.48894 WP_000249972.1.48919 WP_000249972.1.49084 WP_000249972.1.49102 WP_000249972.1.49155 WP_000249972.1.49204 WP_000249972.1.49226 WP_000249972.1.49233 WP_000249972.1.49239 WP_000249972.1.49256 WP_000249972.1.49262 WP_000249972.1.49276 WP_000249972.1.49290 WP_000249972.1.49304 WP_000249972.1.49366 WP_000249972.1.49375 WP_000249972.1.49430 WP_000249972.1.49490 WP_000249972.1.49494 WP_000249972.1.49515 WP_000249972.1.49550 WP_000249972.1.49572 WP_000249972.1.49574 WP_000249972.1.49590 WP_000249972.1.49602 WP_000249972.1.49626 WP_000249972.1.49686 WP_000249972.1.4979 WP_000249972.1.49790 WP_000249972.1.49803 WP_000249972.1.49929 WP_000249972.1.49931 WP_000249972.1.50007 WP_000249972.1.50080 WP_000249972.1.5009 WP_000249972.1.50153 WP_000249972.1.50161 WP_000249972.1.50374 WP_000249972.1.50376 WP_000249972.1.50386 WP_000249972.1.50389 WP_000249972.1.50404 WP_000249972.1.50413 WP_000249972.1.50469 WP_000249972.1.50478 WP_000249972.1.50497 WP_000249972.1.50517 WP_000249972.1.50529 WP_000249972.1.50563 WP_000249972.1.50565 WP_000249972.1.5058 WP_000249972.1.50676 WP_000249972.1.50750 WP_000249972.1.50769 WP_000249972.1.50777 WP_000249972.1.50804 WP_000249972.1.50808 WP_000249972.1.5088 WP_000249972.1.50918 WP_000249972.1.50941 WP_000249972.1.50999 WP_000249972.1.51014 WP_000249972.1.51025 WP_000249972.1.51066 WP_000249972.1.51131 WP_000249972.1.51162 WP_000249972.1.51182 WP_000249972.1.51186 WP_000249972.1.51224 WP_000249972.1.51419 WP_000249972.1.51487 WP_000249972.1.51611 WP_000249972.1.51634 WP_000249972.1.51649 WP_000249972.1.51686 WP_000249972.1.51700 WP_000249972.1.51756 WP_000249972.1.51831 WP_000249972.1.5185 WP_000249972.1.51911 WP_000249972.1.51932 WP_000249972.1.51989 WP_000249972.1.52047 WP_000249972.1.52101 WP_000249972.1.52121 WP_000249972.1.52170 WP_000249972.1.52255 WP_000249972.1.52336 WP_000249972.1.52346 WP_000249972.1.52353 WP_000249972.1.52356 WP_000249972.1.52527 WP_000249972.1.52653 WP_000249972.1.52656 WP_000249972.1.52692 WP_000249972.1.52743 WP_000249972.1.52857 WP_000249972.1.52866 WP_000249972.1.52949 WP_000249972.1.52985 WP_000249972.1.53100 WP_000249972.1.53206 WP_000249972.1.53406 WP_000249972.1.53529 WP_000249972.1.53543 WP_000249972.1.53694 WP_000249972.1.53696 WP_000249972.1.53757 WP_000249972.1.53772 WP_000249972.1.53812 WP_000249972.1.53905 WP_000249972.1.54033 WP_000249972.1.54061 WP_000249972.1.54075 WP_000249972.1.54082 WP_000249972.1.54196 WP_000249972.1.54209 WP_000249972.1.54274 WP_000249972.1.54319 WP_000249972.1.54340 WP_000249972.1.54364 WP_000249972.1.54400 WP_000249972.1.54526 WP_000249972.1.5462 WP_000249972.1.54662 WP_000249972.1.54722 WP_000249972.1.54749 WP_000249972.1.54764 WP_000249972.1.54774 WP_000249972.1.54822 WP_000249972.1.54984 WP_000249972.1.55008 WP_000249972.1.55152 WP_000249972.1.5517 WP_000249972.1.55178 WP_000249972.1.55200 WP_000249972.1.55223 WP_000249972.1.5523 WP_000249972.1.5527 WP_000249972.1.55285 WP_000249972.1.55294 WP_000249972.1.55325 WP_000249972.1.55430 WP_000249972.1.55461 WP_000249972.1.55475 WP_000249972.1.5555 WP_000249972.1.5560 WP_000249972.1.55647 WP_000249972.1.55743 WP_000249972.1.55768 WP_000249972.1.55796 WP_000249972.1.55973 WP_000249972.1.56002 WP_000249972.1.56012 WP_000249972.1.56070 WP_000249972.1.56105 WP_000249972.1.56222 WP_000249972.1.56238 WP_000249972.1.56247 WP_000249972.1.56286 WP_000249972.1.56304 WP_000249972.1.56374 WP_000249972.1.56389 WP_000249972.1.56393 WP_000249972.1.56414 WP_000249972.1.56559 WP_000249972.1.56560 WP_000249972.1.56601 WP_000249972.1.56614 WP_000249972.1.56615 WP_000249972.1.56671 WP_000249972.1.56682 WP_000249972.1.56791 WP_000249972.1.56877 WP_000249972.1.56942 WP_000249972.1.57149 WP_000249972.1.57168 WP_000249972.1.57187 WP_000249972.1.57244 WP_000249972.1.57356 WP_000249972.1.57357 WP_000249972.1.57377 WP_000249972.1.57399 WP_000249972.1.57433 WP_000249972.1.57510 WP_000249972.1.57555 WP_000249972.1.57576 WP_000249972.1.57601 WP_000249972.1.57607 WP_000249972.1.5761 WP_000249972.1.57641 WP_000249972.1.5774 WP_000249972.1.57781 WP_000249972.1.57797 WP_000249972.1.5781 WP_000249972.1.57862 WP_000249972.1.57890 WP_000249972.1.57891 WP_000249972.1.57902 WP_000249972.1.58041 WP_000249972.1.58144 WP_000249972.1.58249 WP_000249972.1.58301 WP_000249972.1.58358 WP_000249972.1.58407 WP_000249972.1.58418 WP_000249972.1.58442 WP_000249972.1.58467 WP_000249972.1.58548 WP_000249972.1.5858 WP_000249972.1.58604 WP_000249972.1.58662 WP_000249972.1.58669 WP_000249972.1.58698 WP_000249972.1.58729 WP_000249972.1.58745 WP_000249972.1.58803 WP_000249972.1.58831 WP_000249972.1.58836 WP_000249972.1.5886 WP_000249972.1.58861 WP_000249972.1.58932 WP_000249972.1.59068 WP_000249972.1.59094 WP_000249972.1.59148 WP_000249972.1.59224 WP_000249972.1.59236 WP_000249972.1.59276 WP_000249972.1.59375 WP_000249972.1.59420 WP_000249972.1.59439 WP_000249972.1.59490 WP_000249972.1.59508 WP_000249972.1.59521 WP_000249972.1.59636 WP_000249972.1.59684 WP_000249972.1.59694 WP_000249972.1.59710 WP_000249972.1.59928 WP_000249972.1.5993 WP_000249972.1.60004 WP_000249972.1.60008 WP_000249972.1.60021 WP_000249972.1.60069 WP_000249972.1.60106 WP_000249972.1.60155 WP_000249972.1.60231 WP_000249972.1.60379 WP_000249972.1.60464 WP_000249972.1.60486 WP_000249972.1.6052 WP_000249972.1.60545 WP_000249972.1.60561 WP_000249972.1.60597 WP_000249972.1.60746 WP_000249972.1.60772 WP_000249972.1.60794 WP_000249972.1.60809 WP_000249972.1.60838 WP_000249972.1.60941 WP_000249972.1.61045 WP_000249972.1.61114 WP_000249972.1.61146 WP_000249972.1.61218 WP_000249972.1.61233 WP_000249972.1.6129 WP_000249972.1.61296 WP_000249972.1.61309 WP_000249972.1.61345 WP_000249972.1.61417 WP_000249972.1.6143 WP_000249972.1.61574 WP_000249972.1.61694 WP_000249972.1.61712 WP_000249972.1.61730 WP_000249972.1.61918 WP_000249972.1.61952 WP_000249972.1.62007 WP_000249972.1.62020 WP_000249972.1.62025 WP_000249972.1.62063 WP_000249972.1.62076 WP_000249972.1.6209 WP_000249972.1.6210 WP_000249972.1.62195 WP_000249972.1.62204 WP_000249972.1.62257 WP_000249972.1.62304 WP_000249972.1.62364 WP_000249972.1.62374 WP_000249972.1.62403 WP_000249972.1.62486 WP_000249972.1.6253 WP_000249972.1.62564 WP_000249972.1.62619 WP_000249972.1.62648 WP_000249972.1.62853 WP_000249972.1.62903 WP_000249972.1.62910 WP_000249972.1.62955 WP_000249972.1.63043 WP_000249972.1.63181 WP_000249972.1.63203 WP_000249972.1.63234 WP_000249972.1.63382 WP_000249972.1.63432 WP_000249972.1.63461 WP_000249972.1.63568 WP_000249972.1.63577 WP_000249972.1.63718 WP_000249972.1.63757 WP_000249972.1.63766 WP_000249972.1.63797 WP_000249972.1.63824 WP_000249972.1.63834 WP_000249972.1.63903 WP_000249972.1.63992 WP_000249972.1.64018 WP_000249972.1.64046 WP_000249972.1.64217 WP_000249972.1.6423 WP_000249972.1.64242 WP_000249972.1.64244 WP_000249972.1.64387 WP_000249972.1.64403 WP_000249972.1.64649 WP_000249972.1.64702 WP_000249972.1.64757 WP_000249972.1.64758 WP_000249972.1.64781 WP_000249972.1.64831 WP_000249972.1.64894 WP_000249972.1.64977 WP_000249972.1.65016 WP_000249972.1.65022 WP_000249972.1.65028 WP_000249972.1.65171 WP_000249972.1.65185 WP_000249972.1.65248 WP_000249972.1.65269 WP_000249972.1.6535 WP_000249972.1.65394 WP_000249972.1.65474 WP_000249972.1.65475 WP_000249972.1.65558 WP_000249972.1.6560 WP_000249972.1.65633 WP_000249972.1.6565 WP_000249972.1.65696 WP_000249972.1.65818 WP_000249972.1.65838 WP_000249972.1.65876 WP_000249972.1.65940 WP_000249972.1.65945 WP_000249972.1.65968 WP_000249972.1.66049 WP_000249972.1.66167 WP_000249972.1.6630 WP_000249972.1.66314 WP_000249972.1.66330 WP_000249972.1.66358 WP_000249972.1.66362 WP_000249972.1.6638 WP_000249972.1.66462 WP_000249972.1.6647 WP_000249972.1.66534 WP_000249972.1.66678 WP_000249972.1.66698 WP_000249972.1.6680 WP_000249972.1.66807 WP_000249972.1.66820 WP_000249972.1.66834 WP_000249972.1.66876 WP_000249972.1.6692 WP_000249972.1.66962 WP_000249972.1.67037 WP_000249972.1.67100 WP_000249972.1.67181 WP_000249972.1.67184 WP_000249972.1.67228 WP_000249972.1.67235 WP_000249972.1.67347 WP_000249972.1.67374 WP_000249972.1.6739 WP_000249972.1.67465 WP_000249972.1.67552 WP_000249972.1.67603 WP_000249972.1.67637 WP_000249972.1.67825 WP_000249972.1.67829 WP_000249972.1.67977 WP_000249972.1.68073 WP_000249972.1.68115 WP_000249972.1.68201 WP_000249972.1.68206 WP_000249972.1.68210 WP_000249972.1.6827 WP_000249972.1.68401 WP_000249972.1.68477 WP_000249972.1.68478 WP_000249972.1.6849 WP_000249972.1.68547 WP_000249972.1.68589 WP_000249972.1.68591 WP_000249972.1.68655 WP_000249972.1.68778 WP_000249972.1.68787 WP_000249972.1.68818 WP_000249972.1.68928 WP_000249972.1.68975 WP_000249972.1.69001 WP_000249972.1.69006 WP_000249972.1.69011 WP_000249972.1.6904 WP_000249972.1.6913 WP_000249972.1.69146 WP_000249972.1.69151 WP_000249972.1.69255 WP_000249972.1.69288 WP_000249972.1.69359 WP_000249972.1.69433 WP_000249972.1.69515 WP_000249972.1.6954 WP_000249972.1.69597 WP_000249972.1.69644 WP_000249972.1.69704 WP_000249972.1.69758 WP_000249972.1.69839 WP_000249972.1.69890 WP_000249972.1.69982 WP_000249972.1.7010 WP_000249972.1.7014 WP_000249972.1.7021 WP_000249972.1.70241 WP_000249972.1.70248 WP_000249972.1.70269 WP_000249972.1.70326 WP_000249972.1.70485 WP_000249972.1.70523 WP_000249972.1.70547 WP_000249972.1.7060 WP_000249972.1.70643 WP_000249972.1.70662 WP_000249972.1.70683 WP_000249972.1.70732 WP_000249972.1.70792 WP_000249972.1.70914 WP_000249972.1.70922 WP_000249972.1.70948 WP_000249972.1.70959 WP_000249972.1.70969 WP_000249972.1.71010 WP_000249972.1.71023 WP_000249972.1.7110 WP_000249972.1.71116 WP_000249972.1.71146 WP_000249972.1.71171 WP_000249972.1.71188 WP_000249972.1.71202 WP_000249972.1.71248 WP_000249972.1.71306 WP_000249972.1.71337 WP_000249972.1.7134 WP_000249972.1.71363 WP_000249972.1.71368 WP_000249972.1.71378 WP_000249972.1.71401 WP_000249972.1.71418 WP_000249972.1.71636 WP_000249972.1.71656 WP_000249972.1.71702 WP_000249972.1.71750 WP_000249972.1.71798 WP_000249972.1.71845 WP_000249972.1.71848 WP_000249972.1.71908 WP_000249972.1.71952 WP_000249972.1.71973 WP_000249972.1.72068 WP_000249972.1.72105 WP_000249972.1.72121 WP_000249972.1.72188 WP_000249972.1.72203 WP_000249972.1.72254 WP_000249972.1.72281 WP_000249972.1.72307 WP_000249972.1.72403 WP_000249972.1.72412 WP_000249972.1.72594 WP_000249972.1.72689 WP_000249972.1.72728 WP_000249972.1.72797 WP_000249972.1.72843 WP_000249972.1.72887 WP_000249972.1.72946 WP_000249972.1.72975 WP_000249972.1.73102 WP_000249972.1.73125 WP_000249972.1.73144 WP_000249972.1.7315 WP_000249972.1.7334 WP_000249972.1.73362 WP_000249972.1.73377 WP_000249972.1.73379 WP_000249972.1.73461 WP_000249972.1.73512 WP_000249972.1.7356 WP_000249972.1.73617 WP_000249972.1.73669 WP_000249972.1.73753 WP_000249972.1.73758 WP_000249972.1.73794 WP_000249972.1.73847 WP_000249972.1.73924 WP_000249972.1.73956 WP_000249972.1.73958 WP_000249972.1.74029 WP_000249972.1.74049 WP_000249972.1.74181 WP_000249972.1.74191 WP_000249972.1.7433 WP_000249972.1.74379 WP_000249972.1.74402 WP_000249972.1.74410 WP_000249972.1.745 WP_000249972.1.74529 WP_000249972.1.74545 WP_000249972.1.74620 WP_000249972.1.74741 WP_000249972.1.74807 WP_000249972.1.7491 WP_000249972.1.74996 WP_000249972.1.75129 WP_000249972.1.75187 WP_000249972.1.75334 WP_000249972.1.75362 WP_000249972.1.75371 WP_000249972.1.75385 WP_000249972.1.75664 WP_000249972.1.75703 WP_000249972.1.75760 WP_000249972.1.75764 WP_000249972.1.75793 WP_000249972.1.75837 WP_000249972.1.75873 WP_000249972.1.75874 WP_000249972.1.75884 WP_000249972.1.76020 WP_000249972.1.76024 WP_000249972.1.76102 WP_000249972.1.76115 WP_000249972.1.76162 WP_000249972.1.76170 WP_000249972.1.76186 WP_000249972.1.76208 WP_000249972.1.7629 WP_000249972.1.76327 WP_000249972.1.7633 WP_000249972.1.76445 WP_000249972.1.76471 WP_000249972.1.7660 WP_000249972.1.76673 WP_000249972.1.76721 WP_000249972.1.76738 WP_000249972.1.76760 WP_000249972.1.76875 WP_000249972.1.76899 WP_000249972.1.77038 WP_000249972.1.77047 WP_000249972.1.7712 WP_000249972.1.77180 WP_000249972.1.77244 WP_000249972.1.77267 WP_000249972.1.77292 WP_000249972.1.77349 WP_000249972.1.77514 WP_000249972.1.77529 WP_000249972.1.77543 WP_000249972.1.77549 WP_000249972.1.77565 WP_000249972.1.77575 WP_000249972.1.77653 WP_000249972.1.77710 WP_000249972.1.7784 WP_000249972.1.77851 WP_000249972.1.77960 WP_000249972.1.78033 WP_000249972.1.78076 WP_000249972.1.78096 WP_000249972.1.78100 WP_000249972.1.78352 WP_000249972.1.78372 WP_000249972.1.78383 WP_000249972.1.78495 WP_000249972.1.78602 WP_000249972.1.78735 WP_000249972.1.78802 WP_000249972.1.78830 WP_000249972.1.78835 WP_000249972.1.78871 WP_000249972.1.78874 WP_000249972.1.78913 WP_000249972.1.78918 WP_000249972.1.78928 WP_000249972.1.78930 WP_000249972.1.78959 WP_000249972.1.79167 WP_000249972.1.79297 WP_000249972.1.79335 WP_000249972.1.79462 WP_000249972.1.79472 WP_000249972.1.79490 WP_000249972.1.79495 WP_000249972.1.79529 WP_000249972.1.79531 WP_000249972.1.79570 WP_000249972.1.7964 WP_000249972.1.79642 WP_000249972.1.79659 WP_000249972.1.79668 WP_000249972.1.79708 WP_000249972.1.79734 WP_000249972.1.79892 WP_000249972.1.79929 WP_000249972.1.79977 WP_000249972.1.80045 WP_000249972.1.80077 WP_000249972.1.80137 WP_000249972.1.80250 WP_000249972.1.80293 WP_000249972.1.80296 WP_000249972.1.80366 WP_000249972.1.80586 WP_000249972.1.80629 WP_000249972.1.80725 WP_000249972.1.80741 WP_000249972.1.80780 WP_000249972.1.80831 WP_000249972.1.80850 WP_000249972.1.80857 WP_000249972.1.80881 WP_000249972.1.80959 WP_000249972.1.8096 WP_000249972.1.81041 WP_000249972.1.81069 WP_000249972.1.81084 WP_000249972.1.81107 WP_000249972.1.81149 WP_000249972.1.81175 WP_000249972.1.8119 WP_000249972.1.81193 WP_000249972.1.81275 WP_000249972.1.81302 WP_000249972.1.81305 WP_000249972.1.81320 WP_000249972.1.81328 WP_000249972.1.81354 WP_000249972.1.81425 WP_000249972.1.81528 WP_000249972.1.81568 WP_000249972.1.81667 WP_000249972.1.81735 WP_000249972.1.81750 WP_000249972.1.81760 WP_000249972.1.81785 WP_000249972.1.81798 WP_000249972.1.81902 WP_000249972.1.8196 WP_000249972.1.81965 WP_000249972.1.82192 WP_000249972.1.82232 WP_000249972.1.82337 WP_000249972.1.82395 WP_000249972.1.82464 WP_000249972.1.82503 WP_000249972.1.82515 WP_000249972.1.82530 WP_000249972.1.82570 WP_000249972.1.82648 WP_000249972.1.82676 WP_000249972.1.82692 WP_000249972.1.82761 WP_000249972.1.82843 WP_000249972.1.82895 WP_000249972.1.83061 WP_000249972.1.83092 WP_000249972.1.8322 WP_000249972.1.83280 WP_000249972.1.83301 WP_000249972.1.83305 WP_000249972.1.83360 WP_000249972.1.83413 WP_000249972.1.83491 WP_000249972.1.8354 WP_000249972.1.83759 WP_000249972.1.83760 WP_000249972.1.83806 WP_000249972.1.83979 WP_000249972.1.83995 WP_000249972.1.84103 WP_000249972.1.84283 WP_000249972.1.84291 WP_000249972.1.84397 WP_000249972.1.8441 WP_000249972.1.84532 WP_000249972.1.84554 WP_000249972.1.84659 WP_000249972.1.84814 WP_000249972.1.84872 WP_000249972.1.84879 WP_000249972.1.84899 WP_000249972.1.8497 WP_000249972.1.85014 WP_000249972.1.85040 WP_000249972.1.85120 WP_000249972.1.85126 WP_000249972.1.85134 WP_000249972.1.85147 WP_000249972.1.85180 WP_000249972.1.85192 WP_000249972.1.8545 WP_000249972.1.85483 WP_000249972.1.8552 WP_000249972.1.85541 WP_000249972.1.8556 WP_000249972.1.85568 WP_000249972.1.85617 WP_000249972.1.85663 WP_000249972.1.85671 WP_000249972.1.85672 WP_000249972.1.85723 WP_000249972.1.85777 WP_000249972.1.85784 WP_000249972.1.85886 WP_000249972.1.85900 WP_000249972.1.85904 WP_000249972.1.8591 WP_000249972.1.85943 WP_000249972.1.85976 WP_000249972.1.86010 WP_000249972.1.86017 WP_000249972.1.86043 WP_000249972.1.86120 WP_000249972.1.86173 WP_000249972.1.86259 WP_000249972.1.86306 WP_000249972.1.86316 WP_000249972.1.86356 WP_000249972.1.86450 WP_000249972.1.86466 WP_000249972.1.86469 WP_000249972.1.86588 WP_000249972.1.86634 WP_000249972.1.86661 WP_000249972.1.8671 WP_000249972.1.8672 WP_000249972.1.86895 WP_000249972.1.86982 WP_000249972.1.87095 WP_000249972.1.87220 WP_000249972.1.87276 WP_000249972.1.87323 WP_000249972.1.8736 WP_000249972.1.87376 WP_000249972.1.87460 WP_000249972.1.87552 WP_000249972.1.87626 WP_000249972.1.87651 WP_000249972.1.87695 WP_000249972.1.87891 WP_000249972.1.87899 WP_000249972.1.8792 WP_000249972.1.87945 WP_000249972.1.87999 WP_000249972.1.88014 WP_000249972.1.88019 WP_000249972.1.88073 WP_000249972.1.8809 WP_000249972.1.88092 WP_000249972.1.88291 WP_000249972.1.88293 WP_000249972.1.88303 WP_000249972.1.88703 WP_000249972.1.88817 WP_000249972.1.88902 WP_000249972.1.8891 WP_000249972.1.88942 WP_000249972.1.88957 WP_000249972.1.88980 WP_000249972.1.88981 WP_000249972.1.89008 WP_000249972.1.89114 WP_000249972.1.89116 WP_000249972.1.89119 WP_000249972.1.89138 WP_000249972.1.89304 WP_000249972.1.89462 WP_000249972.1.89570 WP_000249972.1.89580 WP_000249972.1.89622 WP_000249972.1.89657 WP_000249972.1.89659 WP_000249972.1.89764 WP_000249972.1.89765 WP_000249972.1.89817 WP_000249972.1.8996 WP_000249972.1.90084 WP_000249972.1.90097 WP_000249972.1.90108 WP_000249972.1.90193 WP_000249972.1.90248 WP_000249972.1.90252 WP_000249972.1.90453 WP_000249972.1.90585 WP_000249972.1.90641 WP_000249972.1.90701 WP_000249972.1.90734 WP_000249972.1.90866 WP_000249972.1.91003 WP_000249972.1.91042 WP_000249972.1.91049 WP_000249972.1.91056 WP_000249972.1.91069 WP_000249972.1.91278 WP_000249972.1.91282 WP_000249972.1.91312 WP_000249972.1.91331 WP_000249972.1.91453 WP_000249972.1.91493 WP_000249972.1.91512 WP_000249972.1.91564 WP_000249972.1.91621 WP_000249972.1.91655 WP_000249972.1.9166 WP_000249972.1.91724 WP_000249972.1.91732 WP_000249972.1.91788 WP_000249972.1.91903 WP_000249972.1.91984 WP_000249972.1.92013 WP_000249972.1.92047 WP_000249972.1.92067 WP_000249972.1.92093 WP_000249972.1.92165 WP_000249972.1.92183 WP_000249972.1.92310 WP_000249972.1.92375 WP_000249972.1.92399 WP_000249972.1.92439 WP_000249972.1.92443 WP_000249972.1.92482 WP_000249972.1.92531 WP_000249972.1.92562 WP_000249972.1.92646 WP_000249972.1.92669 WP_000249972.1.92671 WP_000249972.1.92738 WP_000249972.1.92786 WP_000249972.1.92842 WP_000249972.1.92893 WP_000249972.1.92936 WP_000249972.1.92939 WP_000249972.1.92988 WP_000249972.1.93059 WP_000249972.1.93101 WP_000249972.1.93118 WP_000249972.1.93136 WP_000249972.1.93155 WP_000249972.1.93339 WP_000249972.1.93365 WP_000249972.1.93543 WP_000249972.1.93596 WP_000249972.1.93656 WP_000249972.1.93662 WP_000249972.1.937 WP_000249972.1.93705 WP_000249972.1.93761 WP_000249972.1.93804 WP_000249972.1.9389 WP_000249972.1.93937 WP_000249972.1.93956 WP_000249972.1.93986 WP_000249972.1.93994 WP_000249972.1.94071 WP_000249972.1.94072 WP_000249972.1.94168 WP_000249972.1.94181 WP_000249972.1.94198 WP_000249972.1.94352 WP_000249972.1.94354 WP_000249972.1.94380 WP_000249972.1.94458 WP_000249972.1.94584 WP_000249972.1.94655 WP_000249972.1.94669 WP_000249972.1.94674 WP_000249972.1.94785 WP_000249972.1.94817 WP_000249972.1.94862 WP_000249972.1.94967 WP_000249972.1.94987 WP_000249972.1.9503 WP_000249972.1.95051 WP_000249972.1.95085 WP_000249972.1.95133 WP_000249972.1.9516 WP_000249972.1.95235 WP_000249972.1.95248 WP_000249972.1.95277 WP_000249972.1.95282 WP_000249972.1.95289 WP_000249972.1.95388 WP_000249972.1.95630 WP_000249972.1.95670 WP_000249972.1.95691 WP_000249972.1.95840 WP_000249972.1.95911 WP_000249972.1.95939 WP_000249972.1.96004 WP_000249972.1.96045 WP_000249972.1.9609 WP_000249972.1.96139 WP_000249972.1.96141 WP_000249972.1.96162 WP_000249972.1.9628 WP_000249972.1.96317 WP_000249972.1.96343 WP_000249972.1.9644 WP_000249972.1.96469 WP_000249972.1.96500 WP_000249972.1.96533 WP_000249972.1.96555 WP_000249972.1.96563 WP_000249972.1.96590 WP_000249972.1.96600 WP_000249972.1.96731 WP_000249972.1.9674 WP_000249972.1.96771 WP_000249972.1.96798 WP_000249972.1.96902 WP_000249972.1.97047 WP_000249972.1.97143 WP_000249972.1.97145 WP_000249972.1.97224 WP_000249972.1.97297 WP_000249972.1.97318 WP_000249972.1.97369 WP_000249972.1.97477 WP_000249972.1.97487 WP_000249972.1.97534 WP_000249972.1.97613 WP_000249972.1.97620 WP_000249972.1.97631 WP_000249972.1.97691 WP_000249972.1.97732 WP_000249972.1.97736 WP_000249972.1.9775 WP_000249972.1.97800 WP_000249972.1.97846 WP_000249972.1.97907 WP_000249972.1.9799 WP_000249972.1.98006 WP_000249972.1.98019 WP_000249972.1.98022 WP_000249972.1.9805 WP_000249972.1.9811 WP_000249972.1.98110 WP_000249972.1.98146 WP_000249972.1.98170 WP_000249972.1.98219 WP_000249972.1.9826 WP_000249972.1.9841 WP_000249972.1.98446 WP_000249972.1.98483 WP_000249972.1.98513 WP_000249972.1.98531 WP_000249972.1.98577 WP_000249972.1.98676 WP_000249972.1.98677 WP_000249972.1.98779 WP_000249972.1.98843 WP_000249972.1.98931 WP_000249972.1.9898 WP_000249972.1.99073 WP_000249972.1.99098 WP_000249972.1.99184 WP_000249972.1.99267 WP_000249972.1.99276 WP_000249972.1.99370 WP_000249972.1.99426 WP_000249972.1.99469 WP_000249972.1.99531 WP_000249972.1.99626 WP_000249972.1.99646 WP_000249972.1.99657 WP_000249972.1.99660 WP_000249972.1.99712 WP_000249972.1.99725 WP_000249972.1.99858 WP_000249972.1.99889 WP_000249972.1.99958 gi|378452903|ref|YP_005240263.1| gi|528821442|ref|YP_008362645.1| gi|526218174|ref|YP_008263272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]