SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452954|ref|YP_005240314.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452954|ref|YP_005240314.1|
Domain Number 1 Region: 65-184
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.54e-18
Family Probable transcriptional regulator VC1968, C-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000619
Family Probable transcriptional regulator VC1968, N-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378452954|ref|YP_005240314.1|
Sequence length 188
Comment hypothetical protein STM14_4861 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MNVGCFMTQPISVIARSLVRERQRTGLSLAEIARRAGIAKSTLSQLEAGNGNPSLETLWS
LCVALDIPFARLLEPQVQKTQVIRRGEGTKVVAEQAHYQAILLAACPPGARRDIYLLLTQ
PGADRISHPHPPGSVEHIIVTQGKALVGLTEAPEELAEGDYICYPGDQAHIFKALEPDTQ
AILVAEQN
Download sequence
Identical sequences A0A0F6B9L6 A0A0H2WU60 A0A0H3NI53 A0A1X2RMI4 A0A1X2UL21 A0A1X2Y1V5 A0A1Z3QDI7 A0A221YWP7 A0A221ZAC3 A0A232SAG4 A0A249V6N9 A0A265AYK4 A0A267SIL9 A0A271CHN9 A0A2C9P6I9 A0A2D0MHU9 A0A2D1XYQ2 A0A2D1YC94 A0A2H9YFA0 A0A2I6MFB4 A0A2I6MSP3 A0A2I6N6U6 A0A2I6NK20 A0A2I6NY15 A0A2I6PAY3 A0A2J5WNH4 Q8ZKS3
gi|378701901|ref|YP_005183859.1| gi|550903402|ref|YP_008672494.1| gi|197364817|ref|YP_002144454.1| gi|207859233|ref|YP_002245884.1| NP_462923.1.58477 WP_010989088.1.100002 WP_010989088.1.100007 WP_010989088.1.100010 WP_010989088.1.100031 WP_010989088.1.100077 WP_010989088.1.100115 WP_010989088.1.10013 WP_010989088.1.100137 WP_010989088.1.100149 WP_010989088.1.100165 WP_010989088.1.100191 WP_010989088.1.1002 WP_010989088.1.100234 WP_010989088.1.100258 WP_010989088.1.100266 WP_010989088.1.100288 WP_010989088.1.100376 WP_010989088.1.100392 WP_010989088.1.100412 WP_010989088.1.100413 WP_010989088.1.100424 WP_010989088.1.100432 WP_010989088.1.100436 WP_010989088.1.100438 WP_010989088.1.100457 WP_010989088.1.100472 WP_010989088.1.100484 WP_010989088.1.100488 WP_010989088.1.100521 WP_010989088.1.100557 WP_010989088.1.100584 WP_010989088.1.100589 WP_010989088.1.100597 WP_010989088.1.100605 WP_010989088.1.100642 WP_010989088.1.10065 WP_010989088.1.100650 WP_010989088.1.100707 WP_010989088.1.100721 WP_010989088.1.100730 WP_010989088.1.10074 WP_010989088.1.100750 WP_010989088.1.10076 WP_010989088.1.100773 WP_010989088.1.100776 WP_010989088.1.100781 WP_010989088.1.100790 WP_010989088.1.100793 WP_010989088.1.10081 WP_010989088.1.100814 WP_010989088.1.100857 WP_010989088.1.100865 WP_010989088.1.100869 WP_010989088.1.100870 WP_010989088.1.100871 WP_010989088.1.100882 WP_010989088.1.100886 WP_010989088.1.100895 WP_010989088.1.100932 WP_010989088.1.100944 WP_010989088.1.101007 WP_010989088.1.101020 WP_010989088.1.101042 WP_010989088.1.101074 WP_010989088.1.101078 WP_010989088.1.101091 WP_010989088.1.101094 WP_010989088.1.101111 WP_010989088.1.101112 WP_010989088.1.101123 WP_010989088.1.101126 WP_010989088.1.101147 WP_010989088.1.101180 WP_010989088.1.101185 WP_010989088.1.101223 WP_010989088.1.101239 WP_010989088.1.101259 WP_010989088.1.101284 WP_010989088.1.101291 WP_010989088.1.1013 WP_010989088.1.101320 WP_010989088.1.101353 WP_010989088.1.101386 WP_010989088.1.101404 WP_010989088.1.101420 WP_010989088.1.101425 WP_010989088.1.101454 WP_010989088.1.101473 WP_010989088.1.101519 WP_010989088.1.101520 WP_010989088.1.101541 WP_010989088.1.101589 WP_010989088.1.101609 WP_010989088.1.101612 WP_010989088.1.101634 WP_010989088.1.101636 WP_010989088.1.101639 WP_010989088.1.10164 WP_010989088.1.101666 WP_010989088.1.101674 WP_010989088.1.101707 WP_010989088.1.101724 WP_010989088.1.101734 WP_010989088.1.101740 WP_010989088.1.101741 WP_010989088.1.101759 WP_010989088.1.101776 WP_010989088.1.101815 WP_010989088.1.101832 WP_010989088.1.101839 WP_010989088.1.101841 WP_010989088.1.101878 WP_010989088.1.101904 WP_010989088.1.10191 WP_010989088.1.101917 WP_010989088.1.101949 WP_010989088.1.101953 WP_010989088.1.101975 WP_010989088.1.102009 WP_010989088.1.102103 WP_010989088.1.102111 WP_010989088.1.10220 WP_010989088.1.10231 WP_010989088.1.10237 WP_010989088.1.10266 WP_010989088.1.10276 WP_010989088.1.10293 WP_010989088.1.10300 WP_010989088.1.10310 WP_010989088.1.10394 WP_010989088.1.10429 WP_010989088.1.10439 WP_010989088.1.10463 WP_010989088.1.10465 WP_010989088.1.10498 WP_010989088.1.10507 WP_010989088.1.10521 WP_010989088.1.10562 WP_010989088.1.10566 WP_010989088.1.10568 WP_010989088.1.106 WP_010989088.1.10631 WP_010989088.1.10678 WP_010989088.1.10711 WP_010989088.1.10720 WP_010989088.1.10753 WP_010989088.1.10755 WP_010989088.1.10797 WP_010989088.1.10868 WP_010989088.1.10898 WP_010989088.1.10992 WP_010989088.1.11000 WP_010989088.1.11024 WP_010989088.1.11031 WP_010989088.1.11041 WP_010989088.1.11098 WP_010989088.1.1110 WP_010989088.1.11119 WP_010989088.1.11156 WP_010989088.1.11168 WP_010989088.1.11190 WP_010989088.1.11213 WP_010989088.1.11216 WP_010989088.1.11254 WP_010989088.1.11295 WP_010989088.1.113 WP_010989088.1.11304 WP_010989088.1.1135 WP_010989088.1.11362 WP_010989088.1.11369 WP_010989088.1.1137 WP_010989088.1.11405 WP_010989088.1.11444 WP_010989088.1.11455 WP_010989088.1.11458 WP_010989088.1.1150 WP_010989088.1.11511 WP_010989088.1.11518 WP_010989088.1.11526 WP_010989088.1.11528 WP_010989088.1.11532 WP_010989088.1.11543 WP_010989088.1.11544 WP_010989088.1.1156 WP_010989088.1.11565 WP_010989088.1.11588 WP_010989088.1.11621 WP_010989088.1.11677 WP_010989088.1.11681 WP_010989088.1.11687 WP_010989088.1.1169 WP_010989088.1.11735 WP_010989088.1.1174 WP_010989088.1.11763 WP_010989088.1.11772 WP_010989088.1.11810 WP_010989088.1.11824 WP_010989088.1.11834 WP_010989088.1.11841 WP_010989088.1.11868 WP_010989088.1.11875 WP_010989088.1.11897 WP_010989088.1.11900 WP_010989088.1.11936 WP_010989088.1.11964 WP_010989088.1.11978 WP_010989088.1.12007 WP_010989088.1.12017 WP_010989088.1.12025 WP_010989088.1.12027 WP_010989088.1.12059 WP_010989088.1.12063 WP_010989088.1.12106 WP_010989088.1.12114 WP_010989088.1.12144 WP_010989088.1.1215 WP_010989088.1.12159 WP_010989088.1.12160 WP_010989088.1.12168 WP_010989088.1.12210 WP_010989088.1.12244 WP_010989088.1.12308 WP_010989088.1.12340 WP_010989088.1.12351 WP_010989088.1.12370 WP_010989088.1.12374 WP_010989088.1.1239 WP_010989088.1.12396 WP_010989088.1.12397 WP_010989088.1.12456 WP_010989088.1.1246 WP_010989088.1.12472 WP_010989088.1.12484 WP_010989088.1.12485 WP_010989088.1.1250 WP_010989088.1.12546 WP_010989088.1.12568 WP_010989088.1.12569 WP_010989088.1.12584 WP_010989088.1.12585 WP_010989088.1.1264 WP_010989088.1.12650 WP_010989088.1.12696 WP_010989088.1.12701 WP_010989088.1.12718 WP_010989088.1.12728 WP_010989088.1.12864 WP_010989088.1.12865 WP_010989088.1.12879 WP_010989088.1.12936 WP_010989088.1.1299 WP_010989088.1.12995 WP_010989088.1.1300 WP_010989088.1.13027 WP_010989088.1.13076 WP_010989088.1.13101 WP_010989088.1.13102 WP_010989088.1.13106 WP_010989088.1.13130 WP_010989088.1.13207 WP_010989088.1.13247 WP_010989088.1.13262 WP_010989088.1.13274 WP_010989088.1.13334 WP_010989088.1.13367 WP_010989088.1.13391 WP_010989088.1.13414 WP_010989088.1.13446 WP_010989088.1.1346 WP_010989088.1.13488 WP_010989088.1.13509 WP_010989088.1.13528 WP_010989088.1.13543 WP_010989088.1.13573 WP_010989088.1.13602 WP_010989088.1.13625 WP_010989088.1.13661 WP_010989088.1.13669 WP_010989088.1.13677 WP_010989088.1.13691 WP_010989088.1.13741 WP_010989088.1.13750 WP_010989088.1.13764 WP_010989088.1.13799 WP_010989088.1.13819 WP_010989088.1.13827 WP_010989088.1.13829 WP_010989088.1.13848 WP_010989088.1.13857 WP_010989088.1.1387 WP_010989088.1.13908 WP_010989088.1.13932 WP_010989088.1.13967 WP_010989088.1.13968 WP_010989088.1.14001 WP_010989088.1.14011 WP_010989088.1.14050 WP_010989088.1.14056 WP_010989088.1.14111 WP_010989088.1.1412 WP_010989088.1.14151 WP_010989088.1.14239 WP_010989088.1.14286 WP_010989088.1.14320 WP_010989088.1.14369 WP_010989088.1.14379 WP_010989088.1.1440 WP_010989088.1.14406 WP_010989088.1.14410 WP_010989088.1.14436 WP_010989088.1.14446 WP_010989088.1.14458 WP_010989088.1.14466 WP_010989088.1.14495 WP_010989088.1.14505 WP_010989088.1.14516 WP_010989088.1.14519 WP_010989088.1.14524 WP_010989088.1.14528 WP_010989088.1.14554 WP_010989088.1.146 WP_010989088.1.14618 WP_010989088.1.14688 WP_010989088.1.14706 WP_010989088.1.14708 WP_010989088.1.14725 WP_010989088.1.14789 WP_010989088.1.14793 WP_010989088.1.14808 WP_010989088.1.14819 WP_010989088.1.14852 WP_010989088.1.14876 WP_010989088.1.14884 WP_010989088.1.1489 WP_010989088.1.14913 WP_010989088.1.14917 WP_010989088.1.14927 WP_010989088.1.14932 WP_010989088.1.14936 WP_010989088.1.14964 WP_010989088.1.15011 WP_010989088.1.15046 WP_010989088.1.15054 WP_010989088.1.15055 WP_010989088.1.15059 WP_010989088.1.15067 WP_010989088.1.15079 WP_010989088.1.15100 WP_010989088.1.15102 WP_010989088.1.15124 WP_010989088.1.15223 WP_010989088.1.15226 WP_010989088.1.15276 WP_010989088.1.15316 WP_010989088.1.15318 WP_010989088.1.15353 WP_010989088.1.15369 WP_010989088.1.1540 WP_010989088.1.15468 WP_010989088.1.15479 WP_010989088.1.15508 WP_010989088.1.15585 WP_010989088.1.15586 WP_010989088.1.15612 WP_010989088.1.15616 WP_010989088.1.15627 WP_010989088.1.15637 WP_010989088.1.15644 WP_010989088.1.1568 WP_010989088.1.15775 WP_010989088.1.15777 WP_010989088.1.15784 WP_010989088.1.15795 WP_010989088.1.158 WP_010989088.1.15830 WP_010989088.1.15835 WP_010989088.1.15862 WP_010989088.1.15881 WP_010989088.1.15909 WP_010989088.1.15910 WP_010989088.1.1592 WP_010989088.1.15922 WP_010989088.1.15938 WP_010989088.1.15978 WP_010989088.1.15986 WP_010989088.1.15995 WP_010989088.1.16000 WP_010989088.1.16004 WP_010989088.1.16006 WP_010989088.1.1601 WP_010989088.1.16028 WP_010989088.1.16032 WP_010989088.1.16047 WP_010989088.1.16052 WP_010989088.1.16062 WP_010989088.1.16063 WP_010989088.1.16103 WP_010989088.1.16125 WP_010989088.1.16158 WP_010989088.1.16166 WP_010989088.1.16172 WP_010989088.1.16201 WP_010989088.1.16226 WP_010989088.1.16233 WP_010989088.1.16244 WP_010989088.1.16273 WP_010989088.1.16284 WP_010989088.1.16328 WP_010989088.1.1635 WP_010989088.1.16361 WP_010989088.1.16363 WP_010989088.1.16365 WP_010989088.1.16366 WP_010989088.1.16394 WP_010989088.1.16453 WP_010989088.1.16468 WP_010989088.1.16474 WP_010989088.1.16508 WP_010989088.1.16525 WP_010989088.1.16551 WP_010989088.1.16565 WP_010989088.1.16581 WP_010989088.1.16614 WP_010989088.1.16650 WP_010989088.1.16656 WP_010989088.1.1668 WP_010989088.1.16686 WP_010989088.1.16691 WP_010989088.1.167 WP_010989088.1.16710 WP_010989088.1.16729 WP_010989088.1.16732 WP_010989088.1.16735 WP_010989088.1.16736 WP_010989088.1.16786 WP_010989088.1.16804 WP_010989088.1.16817 WP_010989088.1.16819 WP_010989088.1.16826 WP_010989088.1.16846 WP_010989088.1.16855 WP_010989088.1.16858 WP_010989088.1.16873 WP_010989088.1.1689 WP_010989088.1.16896 WP_010989088.1.16903 WP_010989088.1.16910 WP_010989088.1.16916 WP_010989088.1.16942 WP_010989088.1.16944 WP_010989088.1.16949 WP_010989088.1.16965 WP_010989088.1.16972 WP_010989088.1.16998 WP_010989088.1.1700 WP_010989088.1.17031 WP_010989088.1.17060 WP_010989088.1.17093 WP_010989088.1.17098 WP_010989088.1.17105 WP_010989088.1.17188 WP_010989088.1.17270 WP_010989088.1.17307 WP_010989088.1.1733 WP_010989088.1.1737 WP_010989088.1.17390 WP_010989088.1.174 WP_010989088.1.17439 WP_010989088.1.17480 WP_010989088.1.17482 WP_010989088.1.1749 WP_010989088.1.17504 WP_010989088.1.17525 WP_010989088.1.17546 WP_010989088.1.17560 WP_010989088.1.1757 WP_010989088.1.17583 WP_010989088.1.17629 WP_010989088.1.17693 WP_010989088.1.17702 WP_010989088.1.17703 WP_010989088.1.17705 WP_010989088.1.17732 WP_010989088.1.17743 WP_010989088.1.17747 WP_010989088.1.17755 WP_010989088.1.17758 WP_010989088.1.17865 WP_010989088.1.17886 WP_010989088.1.17891 WP_010989088.1.17901 WP_010989088.1.17914 WP_010989088.1.17919 WP_010989088.1.17936 WP_010989088.1.17949 WP_010989088.1.1798 WP_010989088.1.18019 WP_010989088.1.18022 WP_010989088.1.18056 WP_010989088.1.18061 WP_010989088.1.1807 WP_010989088.1.18089 WP_010989088.1.18092 WP_010989088.1.18103 WP_010989088.1.18109 WP_010989088.1.18111 WP_010989088.1.18122 WP_010989088.1.1814 WP_010989088.1.18149 WP_010989088.1.18163 WP_010989088.1.18178 WP_010989088.1.1818 WP_010989088.1.18192 WP_010989088.1.1825 WP_010989088.1.18254 WP_010989088.1.18265 WP_010989088.1.18267 WP_010989088.1.18277 WP_010989088.1.18282 WP_010989088.1.18355 WP_010989088.1.18365 WP_010989088.1.18384 WP_010989088.1.18426 WP_010989088.1.18441 WP_010989088.1.18445 WP_010989088.1.18468 WP_010989088.1.18485 WP_010989088.1.18489 WP_010989088.1.18607 WP_010989088.1.18641 WP_010989088.1.18686 WP_010989088.1.18705 WP_010989088.1.18715 WP_010989088.1.18737 WP_010989088.1.18776 WP_010989088.1.18822 WP_010989088.1.18847 WP_010989088.1.18881 WP_010989088.1.18886 WP_010989088.1.18919 WP_010989088.1.18940 WP_010989088.1.18949 WP_010989088.1.1895 WP_010989088.1.18972 WP_010989088.1.19030 WP_010989088.1.19038 WP_010989088.1.19053 WP_010989088.1.19055 WP_010989088.1.19064 WP_010989088.1.19093 WP_010989088.1.19163 WP_010989088.1.19174 WP_010989088.1.19273 WP_010989088.1.19291 WP_010989088.1.19320 WP_010989088.1.1935 WP_010989088.1.19357 WP_010989088.1.19373 WP_010989088.1.1939 WP_010989088.1.19405 WP_010989088.1.19433 WP_010989088.1.19458 WP_010989088.1.19460 WP_010989088.1.19461 WP_010989088.1.19469 WP_010989088.1.1954 WP_010989088.1.1955 WP_010989088.1.19588 WP_010989088.1.19614 WP_010989088.1.19616 WP_010989088.1.19642 WP_010989088.1.19656 WP_010989088.1.19660 WP_010989088.1.1968 WP_010989088.1.19683 WP_010989088.1.19702 WP_010989088.1.19706 WP_010989088.1.19723 WP_010989088.1.19724 WP_010989088.1.19740 WP_010989088.1.19749 WP_010989088.1.19784 WP_010989088.1.19793 WP_010989088.1.19802 WP_010989088.1.19809 WP_010989088.1.19823 WP_010989088.1.19834 WP_010989088.1.19851 WP_010989088.1.19863 WP_010989088.1.19867 WP_010989088.1.19882 WP_010989088.1.19884 WP_010989088.1.1990 WP_010989088.1.19967 WP_010989088.1.19970 WP_010989088.1.19975 WP_010989088.1.1998 WP_010989088.1.19987 WP_010989088.1.20 WP_010989088.1.20023 WP_010989088.1.20034 WP_010989088.1.20081 WP_010989088.1.20086 WP_010989088.1.20089 WP_010989088.1.20091 WP_010989088.1.2010 WP_010989088.1.20119 WP_010989088.1.20212 WP_010989088.1.20218 WP_010989088.1.2026 WP_010989088.1.20261 WP_010989088.1.20266 WP_010989088.1.20271 WP_010989088.1.20330 WP_010989088.1.20349 WP_010989088.1.2036 WP_010989088.1.20362 WP_010989088.1.20364 WP_010989088.1.20376 WP_010989088.1.2041 WP_010989088.1.20415 WP_010989088.1.20418 WP_010989088.1.20437 WP_010989088.1.20443 WP_010989088.1.20446 WP_010989088.1.20488 WP_010989088.1.20503 WP_010989088.1.20525 WP_010989088.1.2054 WP_010989088.1.20553 WP_010989088.1.20564 WP_010989088.1.20573 WP_010989088.1.20614 WP_010989088.1.20626 WP_010989088.1.20631 WP_010989088.1.20646 WP_010989088.1.20700 WP_010989088.1.20721 WP_010989088.1.20787 WP_010989088.1.20789 WP_010989088.1.20795 WP_010989088.1.20810 WP_010989088.1.20839 WP_010989088.1.20862 WP_010989088.1.20886 WP_010989088.1.20894 WP_010989088.1.20900 WP_010989088.1.20908 WP_010989088.1.2091 WP_010989088.1.2101 WP_010989088.1.21049 WP_010989088.1.21075 WP_010989088.1.21079 WP_010989088.1.21086 WP_010989088.1.21089 WP_010989088.1.21103 WP_010989088.1.21136 WP_010989088.1.21146 WP_010989088.1.2116 WP_010989088.1.21165 WP_010989088.1.21181 WP_010989088.1.21194 WP_010989088.1.21202 WP_010989088.1.21241 WP_010989088.1.21245 WP_010989088.1.21246 WP_010989088.1.21269 WP_010989088.1.21286 WP_010989088.1.2130 WP_010989088.1.21309 WP_010989088.1.21326 WP_010989088.1.21332 WP_010989088.1.21351 WP_010989088.1.21362 WP_010989088.1.2139 WP_010989088.1.21399 WP_010989088.1.21400 WP_010989088.1.21404 WP_010989088.1.21423 WP_010989088.1.21443 WP_010989088.1.21453 WP_010989088.1.2146 WP_010989088.1.21473 WP_010989088.1.21497 WP_010989088.1.21499 WP_010989088.1.21534 WP_010989088.1.21548 WP_010989088.1.21603 WP_010989088.1.21681 WP_010989088.1.21692 WP_010989088.1.21715 WP_010989088.1.21728 WP_010989088.1.21750 WP_010989088.1.21751 WP_010989088.1.21757 WP_010989088.1.21825 WP_010989088.1.21845 WP_010989088.1.21877 WP_010989088.1.21886 WP_010989088.1.21909 WP_010989088.1.21910 WP_010989088.1.21940 WP_010989088.1.21950 WP_010989088.1.21981 WP_010989088.1.21991 WP_010989088.1.22019 WP_010989088.1.22024 WP_010989088.1.22030 WP_010989088.1.2205 WP_010989088.1.22051 WP_010989088.1.22062 WP_010989088.1.22067 WP_010989088.1.22069 WP_010989088.1.22096 WP_010989088.1.22117 WP_010989088.1.22136 WP_010989088.1.22158 WP_010989088.1.22162 WP_010989088.1.22169 WP_010989088.1.22205 WP_010989088.1.2221 WP_010989088.1.22235 WP_010989088.1.2224 WP_010989088.1.22240 WP_010989088.1.22270 WP_010989088.1.22296 WP_010989088.1.22315 WP_010989088.1.22323 WP_010989088.1.22337 WP_010989088.1.22346 WP_010989088.1.2235 WP_010989088.1.22379 WP_010989088.1.22388 WP_010989088.1.22427 WP_010989088.1.22449 WP_010989088.1.22451 WP_010989088.1.22453 WP_010989088.1.22454 WP_010989088.1.2246 WP_010989088.1.22485 WP_010989088.1.22537 WP_010989088.1.22565 WP_010989088.1.22566 WP_010989088.1.22575 WP_010989088.1.22582 WP_010989088.1.22595 WP_010989088.1.22604 WP_010989088.1.22605 WP_010989088.1.22620 WP_010989088.1.22623 WP_010989088.1.22676 WP_010989088.1.22692 WP_010989088.1.22758 WP_010989088.1.22760 WP_010989088.1.22845 WP_010989088.1.22855 WP_010989088.1.22857 WP_010989088.1.22864 WP_010989088.1.22870 WP_010989088.1.22880 WP_010989088.1.22902 WP_010989088.1.22947 WP_010989088.1.22966 WP_010989088.1.22979 WP_010989088.1.23010 WP_010989088.1.23053 WP_010989088.1.23080 WP_010989088.1.23102 WP_010989088.1.23114 WP_010989088.1.2314 WP_010989088.1.23148 WP_010989088.1.23169 WP_010989088.1.23175 WP_010989088.1.23192 WP_010989088.1.23201 WP_010989088.1.2324 WP_010989088.1.23246 WP_010989088.1.23258 WP_010989088.1.23259 WP_010989088.1.23274 WP_010989088.1.23279 WP_010989088.1.23309 WP_010989088.1.23311 WP_010989088.1.23329 WP_010989088.1.23343 WP_010989088.1.23379 WP_010989088.1.23409 WP_010989088.1.2342 WP_010989088.1.23442 WP_010989088.1.23460 WP_010989088.1.23466 WP_010989088.1.23472 WP_010989088.1.23482 WP_010989088.1.23485 WP_010989088.1.235 WP_010989088.1.23500 WP_010989088.1.23503 WP_010989088.1.23509 WP_010989088.1.23513 WP_010989088.1.23529 WP_010989088.1.2358 WP_010989088.1.23587 WP_010989088.1.23621 WP_010989088.1.23629 WP_010989088.1.23631 WP_010989088.1.23634 WP_010989088.1.23639 WP_010989088.1.2364 WP_010989088.1.23643 WP_010989088.1.23646 WP_010989088.1.23670 WP_010989088.1.23675 WP_010989088.1.23685 WP_010989088.1.237 WP_010989088.1.23707 WP_010989088.1.23720 WP_010989088.1.23746 WP_010989088.1.23755 WP_010989088.1.2376 WP_010989088.1.2380 WP_010989088.1.23819 WP_010989088.1.23932 WP_010989088.1.23959 WP_010989088.1.24017 WP_010989088.1.24082 WP_010989088.1.24145 WP_010989088.1.24158 WP_010989088.1.24206 WP_010989088.1.24214 WP_010989088.1.24250 WP_010989088.1.24259 WP_010989088.1.24297 WP_010989088.1.24303 WP_010989088.1.24308 WP_010989088.1.24325 WP_010989088.1.24361 WP_010989088.1.24376 WP_010989088.1.24392 WP_010989088.1.24394 WP_010989088.1.24408 WP_010989088.1.24409 WP_010989088.1.24412 WP_010989088.1.24419 WP_010989088.1.24444 WP_010989088.1.24494 WP_010989088.1.24521 WP_010989088.1.24555 WP_010989088.1.24567 WP_010989088.1.24578 WP_010989088.1.2467 WP_010989088.1.24673 WP_010989088.1.24686 WP_010989088.1.24689 WP_010989088.1.24696 WP_010989088.1.24723 WP_010989088.1.24727 WP_010989088.1.24737 WP_010989088.1.24779 WP_010989088.1.24837 WP_010989088.1.24839 WP_010989088.1.24873 WP_010989088.1.24901 WP_010989088.1.24944 WP_010989088.1.24995 WP_010989088.1.25008 WP_010989088.1.25015 WP_010989088.1.25036 WP_010989088.1.25064 WP_010989088.1.25072 WP_010989088.1.25119 WP_010989088.1.25130 WP_010989088.1.25159 WP_010989088.1.25175 WP_010989088.1.25205 WP_010989088.1.25206 WP_010989088.1.25217 WP_010989088.1.25229 WP_010989088.1.2525 WP_010989088.1.25297 WP_010989088.1.25354 WP_010989088.1.25397 WP_010989088.1.25405 WP_010989088.1.25426 WP_010989088.1.25454 WP_010989088.1.25493 WP_010989088.1.25514 WP_010989088.1.25546 WP_010989088.1.25564 WP_010989088.1.25596 WP_010989088.1.25618 WP_010989088.1.25668 WP_010989088.1.25690 WP_010989088.1.2570 WP_010989088.1.25700 WP_010989088.1.25703 WP_010989088.1.25740 WP_010989088.1.25780 WP_010989088.1.25809 WP_010989088.1.2581 WP_010989088.1.25814 WP_010989088.1.25846 WP_010989088.1.25928 WP_010989088.1.25932 WP_010989088.1.25951 WP_010989088.1.25988 WP_010989088.1.26030 WP_010989088.1.26075 WP_010989088.1.26083 WP_010989088.1.26093 WP_010989088.1.26122 WP_010989088.1.26123 WP_010989088.1.26129 WP_010989088.1.26194 WP_010989088.1.26199 WP_010989088.1.26213 WP_010989088.1.26224 WP_010989088.1.26282 WP_010989088.1.26311 WP_010989088.1.26319 WP_010989088.1.2634 WP_010989088.1.26384 WP_010989088.1.26429 WP_010989088.1.26440 WP_010989088.1.26441 WP_010989088.1.26493 WP_010989088.1.26512 WP_010989088.1.26551 WP_010989088.1.26563 WP_010989088.1.26567 WP_010989088.1.2660 WP_010989088.1.26646 WP_010989088.1.26687 WP_010989088.1.26709 WP_010989088.1.2672 WP_010989088.1.26741 WP_010989088.1.26750 WP_010989088.1.26758 WP_010989088.1.26794 WP_010989088.1.26833 WP_010989088.1.26882 WP_010989088.1.26883 WP_010989088.1.26892 WP_010989088.1.26919 WP_010989088.1.26924 WP_010989088.1.26936 WP_010989088.1.26980 WP_010989088.1.27010 WP_010989088.1.27051 WP_010989088.1.27072 WP_010989088.1.27084 WP_010989088.1.27122 WP_010989088.1.27169 WP_010989088.1.27173 WP_010989088.1.272 WP_010989088.1.27206 WP_010989088.1.27223 WP_010989088.1.2723 WP_010989088.1.27255 WP_010989088.1.27272 WP_010989088.1.27279 WP_010989088.1.27314 WP_010989088.1.27342 WP_010989088.1.27383 WP_010989088.1.27423 WP_010989088.1.27452 WP_010989088.1.27513 WP_010989088.1.27522 WP_010989088.1.27523 WP_010989088.1.27535 WP_010989088.1.27544 WP_010989088.1.27547 WP_010989088.1.27556 WP_010989088.1.27561 WP_010989088.1.27616 WP_010989088.1.2763 WP_010989088.1.27632 WP_010989088.1.27638 WP_010989088.1.27655 WP_010989088.1.27658 WP_010989088.1.27665 WP_010989088.1.27679 WP_010989088.1.27707 WP_010989088.1.27713 WP_010989088.1.27755 WP_010989088.1.27761 WP_010989088.1.2777 WP_010989088.1.27776 WP_010989088.1.27798 WP_010989088.1.27800 WP_010989088.1.27815 WP_010989088.1.27833 WP_010989088.1.27857 WP_010989088.1.27883 WP_010989088.1.27892 WP_010989088.1.27969 WP_010989088.1.27977 WP_010989088.1.27995 WP_010989088.1.27997 WP_010989088.1.28002 WP_010989088.1.28032 WP_010989088.1.28037 WP_010989088.1.28056 WP_010989088.1.2806 WP_010989088.1.28073 WP_010989088.1.28094 WP_010989088.1.28126 WP_010989088.1.28139 WP_010989088.1.28170 WP_010989088.1.28174 WP_010989088.1.28200 WP_010989088.1.28225 WP_010989088.1.28232 WP_010989088.1.28233 WP_010989088.1.28235 WP_010989088.1.2825 WP_010989088.1.28267 WP_010989088.1.2829 WP_010989088.1.28301 WP_010989088.1.28302 WP_010989088.1.28303 WP_010989088.1.2835 WP_010989088.1.28370 WP_010989088.1.28393 WP_010989088.1.28462 WP_010989088.1.28504 WP_010989088.1.28514 WP_010989088.1.2853 WP_010989088.1.28538 WP_010989088.1.28570 WP_010989088.1.28575 WP_010989088.1.28620 WP_010989088.1.28625 WP_010989088.1.28655 WP_010989088.1.28673 WP_010989088.1.28694 WP_010989088.1.287 WP_010989088.1.28773 WP_010989088.1.28775 WP_010989088.1.2879 WP_010989088.1.28811 WP_010989088.1.28830 WP_010989088.1.2890 WP_010989088.1.28902 WP_010989088.1.28938 WP_010989088.1.28946 WP_010989088.1.28948 WP_010989088.1.28963 WP_010989088.1.28977 WP_010989088.1.29006 WP_010989088.1.29010 WP_010989088.1.29099 WP_010989088.1.2910 WP_010989088.1.29113 WP_010989088.1.29130 WP_010989088.1.29168 WP_010989088.1.29174 WP_010989088.1.29190 WP_010989088.1.29218 WP_010989088.1.2924 WP_010989088.1.29255 WP_010989088.1.29265 WP_010989088.1.2932 WP_010989088.1.29349 WP_010989088.1.29379 WP_010989088.1.29422 WP_010989088.1.29436 WP_010989088.1.29454 WP_010989088.1.29509 WP_010989088.1.29530 WP_010989088.1.29576 WP_010989088.1.29588 WP_010989088.1.29593 WP_010989088.1.29601 WP_010989088.1.29606 WP_010989088.1.29615 WP_010989088.1.29619 WP_010989088.1.29682 WP_010989088.1.29704 WP_010989088.1.29711 WP_010989088.1.29732 WP_010989088.1.29768 WP_010989088.1.29774 WP_010989088.1.29775 WP_010989088.1.29827 WP_010989088.1.2984 WP_010989088.1.29845 WP_010989088.1.29898 WP_010989088.1.29923 WP_010989088.1.29969 WP_010989088.1.29990 WP_010989088.1.30006 WP_010989088.1.30018 WP_010989088.1.30022 WP_010989088.1.30027 WP_010989088.1.3005 WP_010989088.1.30059 WP_010989088.1.30086 WP_010989088.1.30093 WP_010989088.1.30165 WP_010989088.1.3017 WP_010989088.1.30170 WP_010989088.1.30179 WP_010989088.1.30180 WP_010989088.1.30195 WP_010989088.1.30202 WP_010989088.1.30210 WP_010989088.1.30213 WP_010989088.1.30225 WP_010989088.1.30238 WP_010989088.1.30246 WP_010989088.1.30278 WP_010989088.1.30331 WP_010989088.1.30356 WP_010989088.1.30386 WP_010989088.1.30389 WP_010989088.1.30425 WP_010989088.1.30437 WP_010989088.1.30469 WP_010989088.1.30492 WP_010989088.1.30505 WP_010989088.1.30507 WP_010989088.1.30535 WP_010989088.1.30547 WP_010989088.1.30548 WP_010989088.1.30555 WP_010989088.1.30573 WP_010989088.1.30589 WP_010989088.1.30602 WP_010989088.1.30619 WP_010989088.1.30627 WP_010989088.1.30635 WP_010989088.1.3066 WP_010989088.1.3068 WP_010989088.1.30696 WP_010989088.1.30752 WP_010989088.1.3076 WP_010989088.1.30794 WP_010989088.1.3080 WP_010989088.1.30802 WP_010989088.1.30803 WP_010989088.1.30819 WP_010989088.1.30823 WP_010989088.1.30835 WP_010989088.1.3089 WP_010989088.1.3095 WP_010989088.1.30951 WP_010989088.1.30968 WP_010989088.1.30972 WP_010989088.1.31 WP_010989088.1.31001 WP_010989088.1.31011 WP_010989088.1.31042 WP_010989088.1.31069 WP_010989088.1.31086 WP_010989088.1.31092 WP_010989088.1.31107 WP_010989088.1.31111 WP_010989088.1.31122 WP_010989088.1.3113 WP_010989088.1.3114 WP_010989088.1.31155 WP_010989088.1.31156 WP_010989088.1.31167 WP_010989088.1.31185 WP_010989088.1.3119 WP_010989088.1.31190 WP_010989088.1.31195 WP_010989088.1.31196 WP_010989088.1.31198 WP_010989088.1.31214 WP_010989088.1.31219 WP_010989088.1.31222 WP_010989088.1.3124 WP_010989088.1.31251 WP_010989088.1.31262 WP_010989088.1.31272 WP_010989088.1.31281 WP_010989088.1.31335 WP_010989088.1.31362 WP_010989088.1.31435 WP_010989088.1.31451 WP_010989088.1.31504 WP_010989088.1.31515 WP_010989088.1.31546 WP_010989088.1.31578 WP_010989088.1.31585 WP_010989088.1.31658 WP_010989088.1.31665 WP_010989088.1.3167 WP_010989088.1.31720 WP_010989088.1.31725 WP_010989088.1.31762 WP_010989088.1.31782 WP_010989088.1.31845 WP_010989088.1.3185 WP_010989088.1.31854 WP_010989088.1.31895 WP_010989088.1.31901 WP_010989088.1.31927 WP_010989088.1.31940 WP_010989088.1.31952 WP_010989088.1.31967 WP_010989088.1.31972 WP_010989088.1.32006 WP_010989088.1.32038 WP_010989088.1.32054 WP_010989088.1.32056 WP_010989088.1.32109 WP_010989088.1.32116 WP_010989088.1.32170 WP_010989088.1.32192 WP_010989088.1.32204 WP_010989088.1.32206 WP_010989088.1.32252 WP_010989088.1.32260 WP_010989088.1.32274 WP_010989088.1.32275 WP_010989088.1.32277 WP_010989088.1.32309 WP_010989088.1.32368 WP_010989088.1.32408 WP_010989088.1.32423 WP_010989088.1.32424 WP_010989088.1.32434 WP_010989088.1.32438 WP_010989088.1.32459 WP_010989088.1.32491 WP_010989088.1.32493 WP_010989088.1.32515 WP_010989088.1.32519 WP_010989088.1.32527 WP_010989088.1.32545 WP_010989088.1.32629 WP_010989088.1.32660 WP_010989088.1.32668 WP_010989088.1.32702 WP_010989088.1.32714 WP_010989088.1.32740 WP_010989088.1.32747 WP_010989088.1.32750 WP_010989088.1.3278 WP_010989088.1.32786 WP_010989088.1.32804 WP_010989088.1.32832 WP_010989088.1.32860 WP_010989088.1.32881 WP_010989088.1.32899 WP_010989088.1.329 WP_010989088.1.32900 WP_010989088.1.32902 WP_010989088.1.32907 WP_010989088.1.32930 WP_010989088.1.32961 WP_010989088.1.32977 WP_010989088.1.33010 WP_010989088.1.33030 WP_010989088.1.3304 WP_010989088.1.33078 WP_010989088.1.3310 WP_010989088.1.33106 WP_010989088.1.33114 WP_010989088.1.33127 WP_010989088.1.33143 WP_010989088.1.33144 WP_010989088.1.33160 WP_010989088.1.33248 WP_010989088.1.33253 WP_010989088.1.33261 WP_010989088.1.33270 WP_010989088.1.333 WP_010989088.1.33392 WP_010989088.1.33409 WP_010989088.1.33420 WP_010989088.1.33486 WP_010989088.1.33492 WP_010989088.1.33499 WP_010989088.1.335 WP_010989088.1.33504 WP_010989088.1.33553 WP_010989088.1.3356 WP_010989088.1.33580 WP_010989088.1.33586 WP_010989088.1.33592 WP_010989088.1.33609 WP_010989088.1.33629 WP_010989088.1.3364 WP_010989088.1.33659 WP_010989088.1.33693 WP_010989088.1.33825 WP_010989088.1.33865 WP_010989088.1.33870 WP_010989088.1.33894 WP_010989088.1.3394 WP_010989088.1.3395 WP_010989088.1.3396 WP_010989088.1.33986 WP_010989088.1.34022 WP_010989088.1.34043 WP_010989088.1.34075 WP_010989088.1.34081 WP_010989088.1.34084 WP_010989088.1.34091 WP_010989088.1.34107 WP_010989088.1.34126 WP_010989088.1.34179 WP_010989088.1.34184 WP_010989088.1.34185 WP_010989088.1.34257 WP_010989088.1.34259 WP_010989088.1.34279 WP_010989088.1.34292 WP_010989088.1.34304 WP_010989088.1.34319 WP_010989088.1.34330 WP_010989088.1.3438 WP_010989088.1.34417 WP_010989088.1.34424 WP_010989088.1.34431 WP_010989088.1.3445 WP_010989088.1.34453 WP_010989088.1.34454 WP_010989088.1.34458 WP_010989088.1.34496 WP_010989088.1.34610 WP_010989088.1.34614 WP_010989088.1.34647 WP_010989088.1.34659 WP_010989088.1.34667 WP_010989088.1.34703 WP_010989088.1.34704 WP_010989088.1.34707 WP_010989088.1.34711 WP_010989088.1.34745 WP_010989088.1.3476 WP_010989088.1.34801 WP_010989088.1.34820 WP_010989088.1.34854 WP_010989088.1.34856 WP_010989088.1.34881 WP_010989088.1.3489 WP_010989088.1.34972 WP_010989088.1.34975 WP_010989088.1.34977 WP_010989088.1.35045 WP_010989088.1.35125 WP_010989088.1.35129 WP_010989088.1.35184 WP_010989088.1.35193 WP_010989088.1.35294 WP_010989088.1.35298 WP_010989088.1.35321 WP_010989088.1.35331 WP_010989088.1.35404 WP_010989088.1.35408 WP_010989088.1.3541 WP_010989088.1.35429 WP_010989088.1.35446 WP_010989088.1.35460 WP_010989088.1.35463 WP_010989088.1.35494 WP_010989088.1.35503 WP_010989088.1.35507 WP_010989088.1.35509 WP_010989088.1.3556 WP_010989088.1.35563 WP_010989088.1.35570 WP_010989088.1.35590 WP_010989088.1.35594 WP_010989088.1.35624 WP_010989088.1.35648 WP_010989088.1.3566 WP_010989088.1.35777 WP_010989088.1.35809 WP_010989088.1.35835 WP_010989088.1.35868 WP_010989088.1.35887 WP_010989088.1.35892 WP_010989088.1.35936 WP_010989088.1.35940 WP_010989088.1.35961 WP_010989088.1.35993 WP_010989088.1.36003 WP_010989088.1.3601 WP_010989088.1.36011 WP_010989088.1.36017 WP_010989088.1.36037 WP_010989088.1.36057 WP_010989088.1.36063 WP_010989088.1.3610 WP_010989088.1.36172 WP_010989088.1.36229 WP_010989088.1.36232 WP_010989088.1.36236 WP_010989088.1.36286 WP_010989088.1.36409 WP_010989088.1.36425 WP_010989088.1.36445 WP_010989088.1.36512 WP_010989088.1.36542 WP_010989088.1.36547 WP_010989088.1.36564 WP_010989088.1.36584 WP_010989088.1.36586 WP_010989088.1.36592 WP_010989088.1.36609 WP_010989088.1.36652 WP_010989088.1.36685 WP_010989088.1.36690 WP_010989088.1.3670 WP_010989088.1.36705 WP_010989088.1.36721 WP_010989088.1.36764 WP_010989088.1.36765 WP_010989088.1.36792 WP_010989088.1.36839 WP_010989088.1.36875 WP_010989088.1.36885 WP_010989088.1.36889 WP_010989088.1.36899 WP_010989088.1.36918 WP_010989088.1.36931 WP_010989088.1.36948 WP_010989088.1.36949 WP_010989088.1.36978 WP_010989088.1.37013 WP_010989088.1.37021 WP_010989088.1.37028 WP_010989088.1.37029 WP_010989088.1.37063 WP_010989088.1.37073 WP_010989088.1.37100 WP_010989088.1.37111 WP_010989088.1.37112 WP_010989088.1.37114 WP_010989088.1.37147 WP_010989088.1.37158 WP_010989088.1.37190 WP_010989088.1.37191 WP_010989088.1.37256 WP_010989088.1.3726 WP_010989088.1.37267 WP_010989088.1.3728 WP_010989088.1.37293 WP_010989088.1.37297 WP_010989088.1.37320 WP_010989088.1.3734 WP_010989088.1.37351 WP_010989088.1.37363 WP_010989088.1.37370 WP_010989088.1.37376 WP_010989088.1.37405 WP_010989088.1.3744 WP_010989088.1.37478 WP_010989088.1.3748 WP_010989088.1.37498 WP_010989088.1.37504 WP_010989088.1.3751 WP_010989088.1.37521 WP_010989088.1.3756 WP_010989088.1.37610 WP_010989088.1.37618 WP_010989088.1.37666 WP_010989088.1.37687 WP_010989088.1.3771 WP_010989088.1.3778 WP_010989088.1.37808 WP_010989088.1.37848 WP_010989088.1.37864 WP_010989088.1.3790 WP_010989088.1.37965 WP_010989088.1.37968 WP_010989088.1.37978 WP_010989088.1.38001 WP_010989088.1.38037 WP_010989088.1.38047 WP_010989088.1.38055 WP_010989088.1.38113 WP_010989088.1.38125 WP_010989088.1.38145 WP_010989088.1.38273 WP_010989088.1.3828 WP_010989088.1.383 WP_010989088.1.38322 WP_010989088.1.38341 WP_010989088.1.38344 WP_010989088.1.38349 WP_010989088.1.38393 WP_010989088.1.38408 WP_010989088.1.38452 WP_010989088.1.3848 WP_010989088.1.38512 WP_010989088.1.38569 WP_010989088.1.38609 WP_010989088.1.38613 WP_010989088.1.38620 WP_010989088.1.38622 WP_010989088.1.38673 WP_010989088.1.3869 WP_010989088.1.38693 WP_010989088.1.38740 WP_010989088.1.38773 WP_010989088.1.38781 WP_010989088.1.38830 WP_010989088.1.38857 WP_010989088.1.38881 WP_010989088.1.38882 WP_010989088.1.38895 WP_010989088.1.38898 WP_010989088.1.3891 WP_010989088.1.38913 WP_010989088.1.38942 WP_010989088.1.38995 WP_010989088.1.39003 WP_010989088.1.39048 WP_010989088.1.39055 WP_010989088.1.39065 WP_010989088.1.39075 WP_010989088.1.39082 WP_010989088.1.39112 WP_010989088.1.39113 WP_010989088.1.39128 WP_010989088.1.39136 WP_010989088.1.39140 WP_010989088.1.39146 WP_010989088.1.39183 WP_010989088.1.39197 WP_010989088.1.39229 WP_010989088.1.39265 WP_010989088.1.39275 WP_010989088.1.39311 WP_010989088.1.39312 WP_010989088.1.39385 WP_010989088.1.39395 WP_010989088.1.39405 WP_010989088.1.39420 WP_010989088.1.39449 WP_010989088.1.39466 WP_010989088.1.39471 WP_010989088.1.39497 WP_010989088.1.39503 WP_010989088.1.39512 WP_010989088.1.39553 WP_010989088.1.39556 WP_010989088.1.39576 WP_010989088.1.39609 WP_010989088.1.39629 WP_010989088.1.39632 WP_010989088.1.39722 WP_010989088.1.39723 WP_010989088.1.39724 WP_010989088.1.39763 WP_010989088.1.39808 WP_010989088.1.39862 WP_010989088.1.39921 WP_010989088.1.39923 WP_010989088.1.39953 WP_010989088.1.40008 WP_010989088.1.40017 WP_010989088.1.40025 WP_010989088.1.40031 WP_010989088.1.40072 WP_010989088.1.40073 WP_010989088.1.40081 WP_010989088.1.4011 WP_010989088.1.40111 WP_010989088.1.40155 WP_010989088.1.40158 WP_010989088.1.40170 WP_010989088.1.40171 WP_010989088.1.40208 WP_010989088.1.40229 WP_010989088.1.40240 WP_010989088.1.40254 WP_010989088.1.40257 WP_010989088.1.40258 WP_010989088.1.40259 WP_010989088.1.40292 WP_010989088.1.40305 WP_010989088.1.40307 WP_010989088.1.40311 WP_010989088.1.40341 WP_010989088.1.40374 WP_010989088.1.40380 WP_010989088.1.40395 WP_010989088.1.40414 WP_010989088.1.40465 WP_010989088.1.40492 WP_010989088.1.40493 WP_010989088.1.40508 WP_010989088.1.40528 WP_010989088.1.40533 WP_010989088.1.40577 WP_010989088.1.40605 WP_010989088.1.40622 WP_010989088.1.40648 WP_010989088.1.40688 WP_010989088.1.40693 WP_010989088.1.40695 WP_010989088.1.40710 WP_010989088.1.40722 WP_010989088.1.40745 WP_010989088.1.4075 WP_010989088.1.40771 WP_010989088.1.40788 WP_010989088.1.40849 WP_010989088.1.4087 WP_010989088.1.40877 WP_010989088.1.4088 WP_010989088.1.40910 WP_010989088.1.40930 WP_010989088.1.40935 WP_010989088.1.40973 WP_010989088.1.40979 WP_010989088.1.40996 WP_010989088.1.41017 WP_010989088.1.41018 WP_010989088.1.41048 WP_010989088.1.41050 WP_010989088.1.41086 WP_010989088.1.4109 WP_010989088.1.41091 WP_010989088.1.41116 WP_010989088.1.41128 WP_010989088.1.41192 WP_010989088.1.41225 WP_010989088.1.41226 WP_010989088.1.41265 WP_010989088.1.41277 WP_010989088.1.41279 WP_010989088.1.41299 WP_010989088.1.41308 WP_010989088.1.41310 WP_010989088.1.41345 WP_010989088.1.41375 WP_010989088.1.41427 WP_010989088.1.41438 WP_010989088.1.41440 WP_010989088.1.41468 WP_010989088.1.41516 WP_010989088.1.41528 WP_010989088.1.41554 WP_010989088.1.41572 WP_010989088.1.41591 WP_010989088.1.41610 WP_010989088.1.41628 WP_010989088.1.41662 WP_010989088.1.41688 WP_010989088.1.41690 WP_010989088.1.41708 WP_010989088.1.41724 WP_010989088.1.41735 WP_010989088.1.41761 WP_010989088.1.4178 WP_010989088.1.41789 WP_010989088.1.41799 WP_010989088.1.41802 WP_010989088.1.4184 WP_010989088.1.41859 WP_010989088.1.41862 WP_010989088.1.41877 WP_010989088.1.41882 WP_010989088.1.41897 WP_010989088.1.41904 WP_010989088.1.41911 WP_010989088.1.41931 WP_010989088.1.41938 WP_010989088.1.41949 WP_010989088.1.41978 WP_010989088.1.41985 WP_010989088.1.41998 WP_010989088.1.42009 WP_010989088.1.42098 WP_010989088.1.42104 WP_010989088.1.42109 WP_010989088.1.42136 WP_010989088.1.42156 WP_010989088.1.422 WP_010989088.1.4222 WP_010989088.1.42238 WP_010989088.1.42243 WP_010989088.1.42244 WP_010989088.1.42248 WP_010989088.1.42263 WP_010989088.1.42276 WP_010989088.1.4229 WP_010989088.1.42320 WP_010989088.1.42322 WP_010989088.1.42328 WP_010989088.1.42342 WP_010989088.1.42356 WP_010989088.1.42372 WP_010989088.1.4239 WP_010989088.1.42392 WP_010989088.1.42404 WP_010989088.1.42422 WP_010989088.1.42433 WP_010989088.1.42444 WP_010989088.1.42453 WP_010989088.1.42489 WP_010989088.1.42491 WP_010989088.1.4257 WP_010989088.1.42595 WP_010989088.1.42605 WP_010989088.1.42655 WP_010989088.1.42666 WP_010989088.1.42675 WP_010989088.1.42676 WP_010989088.1.42683 WP_010989088.1.42685 WP_010989088.1.42707 WP_010989088.1.42734 WP_010989088.1.4276 WP_010989088.1.42767 WP_010989088.1.42794 WP_010989088.1.42861 WP_010989088.1.42864 WP_010989088.1.4288 WP_010989088.1.4289 WP_010989088.1.42892 WP_010989088.1.42923 WP_010989088.1.42932 WP_010989088.1.42957 WP_010989088.1.42978 WP_010989088.1.42981 WP_010989088.1.43018 WP_010989088.1.43041 WP_010989088.1.43077 WP_010989088.1.43086 WP_010989088.1.43089 WP_010989088.1.43126 WP_010989088.1.43149 WP_010989088.1.43160 WP_010989088.1.43201 WP_010989088.1.43244 WP_010989088.1.43258 WP_010989088.1.43272 WP_010989088.1.43276 WP_010989088.1.43299 WP_010989088.1.43312 WP_010989088.1.43334 WP_010989088.1.43339 WP_010989088.1.43351 WP_010989088.1.43371 WP_010989088.1.43437 WP_010989088.1.43438 WP_010989088.1.4344 WP_010989088.1.43441 WP_010989088.1.43476 WP_010989088.1.43508 WP_010989088.1.43520 WP_010989088.1.43522 WP_010989088.1.43528 WP_010989088.1.43535 WP_010989088.1.43606 WP_010989088.1.43613 WP_010989088.1.43654 WP_010989088.1.43668 WP_010989088.1.43676 WP_010989088.1.43685 WP_010989088.1.43710 WP_010989088.1.43711 WP_010989088.1.4373 WP_010989088.1.43763 WP_010989088.1.43778 WP_010989088.1.43782 WP_010989088.1.43785 WP_010989088.1.43828 WP_010989088.1.43839 WP_010989088.1.43864 WP_010989088.1.43873 WP_010989088.1.43886 WP_010989088.1.43951 WP_010989088.1.43954 WP_010989088.1.44005 WP_010989088.1.44010 WP_010989088.1.4404 WP_010989088.1.44043 WP_010989088.1.44063 WP_010989088.1.44099 WP_010989088.1.44113 WP_010989088.1.44121 WP_010989088.1.44144 WP_010989088.1.44187 WP_010989088.1.44191 WP_010989088.1.4422 WP_010989088.1.4423 WP_010989088.1.44250 WP_010989088.1.44291 WP_010989088.1.44300 WP_010989088.1.44310 WP_010989088.1.44337 WP_010989088.1.44339 WP_010989088.1.44359 WP_010989088.1.44380 WP_010989088.1.44386 WP_010989088.1.4440 WP_010989088.1.44433 WP_010989088.1.44443 WP_010989088.1.44453 WP_010989088.1.44474 WP_010989088.1.44479 WP_010989088.1.44549 WP_010989088.1.44593 WP_010989088.1.44606 WP_010989088.1.44607 WP_010989088.1.44633 WP_010989088.1.44636 WP_010989088.1.44640 WP_010989088.1.4467 WP_010989088.1.44678 WP_010989088.1.44687 WP_010989088.1.44702 WP_010989088.1.44705 WP_010989088.1.44747 WP_010989088.1.44791 WP_010989088.1.44795 WP_010989088.1.44831 WP_010989088.1.44833 WP_010989088.1.4485 WP_010989088.1.44877 WP_010989088.1.44887 WP_010989088.1.449 WP_010989088.1.44927 WP_010989088.1.44933 WP_010989088.1.44943 WP_010989088.1.44950 WP_010989088.1.44966 WP_010989088.1.44971 WP_010989088.1.44978 WP_010989088.1.44985 WP_010989088.1.44996 WP_010989088.1.44997 WP_010989088.1.44998 WP_010989088.1.4500 WP_010989088.1.45027 WP_010989088.1.45038 WP_010989088.1.45045 WP_010989088.1.4505 WP_010989088.1.45067 WP_010989088.1.45074 WP_010989088.1.45079 WP_010989088.1.45098 WP_010989088.1.45123 WP_010989088.1.45134 WP_010989088.1.45138 WP_010989088.1.45145 WP_010989088.1.45154 WP_010989088.1.45173 WP_010989088.1.45177 WP_010989088.1.45184 WP_010989088.1.45229 WP_010989088.1.45251 WP_010989088.1.45259 WP_010989088.1.45268 WP_010989088.1.45302 WP_010989088.1.4531 WP_010989088.1.45322 WP_010989088.1.45344 WP_010989088.1.45349 WP_010989088.1.45351 WP_010989088.1.45365 WP_010989088.1.4540 WP_010989088.1.45432 WP_010989088.1.45434 WP_010989088.1.45462 WP_010989088.1.45468 WP_010989088.1.45535 WP_010989088.1.45549 WP_010989088.1.45550 WP_010989088.1.45566 WP_010989088.1.45569 WP_010989088.1.45571 WP_010989088.1.45582 WP_010989088.1.45583 WP_010989088.1.45585 WP_010989088.1.45622 WP_010989088.1.45660 WP_010989088.1.45690 WP_010989088.1.45781 WP_010989088.1.45797 WP_010989088.1.458 WP_010989088.1.45844 WP_010989088.1.45848 WP_010989088.1.45906 WP_010989088.1.45918 WP_010989088.1.45973 WP_010989088.1.45984 WP_010989088.1.46011 WP_010989088.1.46028 WP_010989088.1.46069 WP_010989088.1.46091 WP_010989088.1.46112 WP_010989088.1.46124 WP_010989088.1.46173 WP_010989088.1.46174 WP_010989088.1.46187 WP_010989088.1.46203 WP_010989088.1.46205 WP_010989088.1.46215 WP_010989088.1.46232 WP_010989088.1.46243 WP_010989088.1.46278 WP_010989088.1.46286 WP_010989088.1.46299 WP_010989088.1.46303 WP_010989088.1.46323 WP_010989088.1.46345 WP_010989088.1.46358 WP_010989088.1.46406 WP_010989088.1.46434 WP_010989088.1.46444 WP_010989088.1.46499 WP_010989088.1.46572 WP_010989088.1.46574 WP_010989088.1.46578 WP_010989088.1.46595 WP_010989088.1.46620 WP_010989088.1.46637 WP_010989088.1.46666 WP_010989088.1.46675 WP_010989088.1.46689 WP_010989088.1.46693 WP_010989088.1.4671 WP_010989088.1.46726 WP_010989088.1.46732 WP_010989088.1.4674 WP_010989088.1.46749 WP_010989088.1.46803 WP_010989088.1.46804 WP_010989088.1.4686 WP_010989088.1.46930 WP_010989088.1.46967 WP_010989088.1.46976 WP_010989088.1.47008 WP_010989088.1.47014 WP_010989088.1.47023 WP_010989088.1.47057 WP_010989088.1.47061 WP_010989088.1.47067 WP_010989088.1.47110 WP_010989088.1.47214 WP_010989088.1.47243 WP_010989088.1.47257 WP_010989088.1.47389 WP_010989088.1.47429 WP_010989088.1.47442 WP_010989088.1.47448 WP_010989088.1.47460 WP_010989088.1.4747 WP_010989088.1.47472 WP_010989088.1.47478 WP_010989088.1.47482 WP_010989088.1.47492 WP_010989088.1.47506 WP_010989088.1.47507 WP_010989088.1.47542 WP_010989088.1.47567 WP_010989088.1.47576 WP_010989088.1.47579 WP_010989088.1.4758 WP_010989088.1.47587 WP_010989088.1.47614 WP_010989088.1.47621 WP_010989088.1.47649 WP_010989088.1.47660 WP_010989088.1.4769 WP_010989088.1.4770 WP_010989088.1.4775 WP_010989088.1.47767 WP_010989088.1.47799 WP_010989088.1.47814 WP_010989088.1.47817 WP_010989088.1.47829 WP_010989088.1.47849 WP_010989088.1.47850 WP_010989088.1.47875 WP_010989088.1.47902 WP_010989088.1.47911 WP_010989088.1.47928 WP_010989088.1.4795 WP_010989088.1.47988 WP_010989088.1.47992 WP_010989088.1.48124 WP_010989088.1.48132 WP_010989088.1.48134 WP_010989088.1.48209 WP_010989088.1.48215 WP_010989088.1.48218 WP_010989088.1.48242 WP_010989088.1.48244 WP_010989088.1.48247 WP_010989088.1.48253 WP_010989088.1.48262 WP_010989088.1.483 WP_010989088.1.48367 WP_010989088.1.48377 WP_010989088.1.4839 WP_010989088.1.48399 WP_010989088.1.48455 WP_010989088.1.48493 WP_010989088.1.48510 WP_010989088.1.4853 WP_010989088.1.48570 WP_010989088.1.48751 WP_010989088.1.48755 WP_010989088.1.48768 WP_010989088.1.48774 WP_010989088.1.48788 WP_010989088.1.48797 WP_010989088.1.48841 WP_010989088.1.4885 WP_010989088.1.48855 WP_010989088.1.48876 WP_010989088.1.48886 WP_010989088.1.48894 WP_010989088.1.48896 WP_010989088.1.48908 WP_010989088.1.48918 WP_010989088.1.48919 WP_010989088.1.48931 WP_010989088.1.48985 WP_010989088.1.49005 WP_010989088.1.49012 WP_010989088.1.49084 WP_010989088.1.49090 WP_010989088.1.49113 WP_010989088.1.49155 WP_010989088.1.49162 WP_010989088.1.49175 WP_010989088.1.49204 WP_010989088.1.49214 WP_010989088.1.49239 WP_010989088.1.49256 WP_010989088.1.49262 WP_010989088.1.49276 WP_010989088.1.49290 WP_010989088.1.49304 WP_010989088.1.49311 WP_010989088.1.49334 WP_010989088.1.49340 WP_010989088.1.49358 WP_010989088.1.49366 WP_010989088.1.49375 WP_010989088.1.49430 WP_010989088.1.49443 WP_010989088.1.49472 WP_010989088.1.49490 WP_010989088.1.49494 WP_010989088.1.49515 WP_010989088.1.49550 WP_010989088.1.49572 WP_010989088.1.49574 WP_010989088.1.49590 WP_010989088.1.49595 WP_010989088.1.49626 WP_010989088.1.49630 WP_010989088.1.49647 WP_010989088.1.49650 WP_010989088.1.49686 WP_010989088.1.49770 WP_010989088.1.49780 WP_010989088.1.4979 WP_010989088.1.49790 WP_010989088.1.49803 WP_010989088.1.49805 WP_010989088.1.49848 WP_010989088.1.49929 WP_010989088.1.50 WP_010989088.1.50003 WP_010989088.1.50080 WP_010989088.1.50128 WP_010989088.1.50153 WP_010989088.1.50161 WP_010989088.1.50198 WP_010989088.1.50211 WP_010989088.1.50238 WP_010989088.1.50239 WP_010989088.1.50251 WP_010989088.1.50285 WP_010989088.1.50332 WP_010989088.1.50349 WP_010989088.1.50374 WP_010989088.1.50376 WP_010989088.1.50386 WP_010989088.1.50389 WP_010989088.1.50404 WP_010989088.1.50413 WP_010989088.1.50449 WP_010989088.1.50469 WP_010989088.1.50480 WP_010989088.1.50497 WP_010989088.1.50517 WP_010989088.1.50529 WP_010989088.1.50563 WP_010989088.1.50565 WP_010989088.1.50576 WP_010989088.1.5058 WP_010989088.1.50593 WP_010989088.1.50652 WP_010989088.1.50676 WP_010989088.1.50684 WP_010989088.1.50750 WP_010989088.1.50769 WP_010989088.1.50774 WP_010989088.1.50777 WP_010989088.1.50782 WP_010989088.1.50800 WP_010989088.1.50804 WP_010989088.1.50808 WP_010989088.1.50811 WP_010989088.1.5088 WP_010989088.1.50882 WP_010989088.1.50893 WP_010989088.1.50908 WP_010989088.1.50918 WP_010989088.1.50941 WP_010989088.1.50954 WP_010989088.1.50960 WP_010989088.1.50999 WP_010989088.1.51014 WP_010989088.1.51022 WP_010989088.1.51025 WP_010989088.1.51066 WP_010989088.1.51117 WP_010989088.1.51131 WP_010989088.1.5114 WP_010989088.1.51178 WP_010989088.1.51179 WP_010989088.1.51182 WP_010989088.1.51186 WP_010989088.1.51224 WP_010989088.1.5125 WP_010989088.1.51285 WP_010989088.1.51308 WP_010989088.1.51331 WP_010989088.1.51338 WP_010989088.1.51356 WP_010989088.1.5138 WP_010989088.1.51394 WP_010989088.1.51412 WP_010989088.1.51414 WP_010989088.1.51451 WP_010989088.1.51487 WP_010989088.1.51488 WP_010989088.1.51502 WP_010989088.1.51506 WP_010989088.1.51514 WP_010989088.1.51518 WP_010989088.1.51613 WP_010989088.1.51615 WP_010989088.1.51634 WP_010989088.1.51642 WP_010989088.1.51649 WP_010989088.1.51686 WP_010989088.1.51700 WP_010989088.1.51704 WP_010989088.1.51756 WP_010989088.1.51764 WP_010989088.1.51810 WP_010989088.1.51831 WP_010989088.1.5185 WP_010989088.1.51868 WP_010989088.1.51888 WP_010989088.1.51900 WP_010989088.1.51910 WP_010989088.1.51911 WP_010989088.1.51914 WP_010989088.1.51930 WP_010989088.1.51932 WP_010989088.1.51989 WP_010989088.1.51994 WP_010989088.1.520 WP_010989088.1.52047 WP_010989088.1.52101 WP_010989088.1.5211 WP_010989088.1.52121 WP_010989088.1.52123 WP_010989088.1.52148 WP_010989088.1.52156 WP_010989088.1.5216 WP_010989088.1.52161 WP_010989088.1.52170 WP_010989088.1.52255 WP_010989088.1.52301 WP_010989088.1.52321 WP_010989088.1.52336 WP_010989088.1.52346 WP_010989088.1.52353 WP_010989088.1.52356 WP_010989088.1.52361 WP_010989088.1.52438 WP_010989088.1.52446 WP_010989088.1.52456 WP_010989088.1.52527 WP_010989088.1.52528 WP_010989088.1.52582 WP_010989088.1.52586 WP_010989088.1.52608 WP_010989088.1.52637 WP_010989088.1.52653 WP_010989088.1.52656 WP_010989088.1.52675 WP_010989088.1.52692 WP_010989088.1.5273 WP_010989088.1.52738 WP_010989088.1.52743 WP_010989088.1.52744 WP_010989088.1.52748 WP_010989088.1.52824 WP_010989088.1.52833 WP_010989088.1.52851 WP_010989088.1.52857 WP_010989088.1.52858 WP_010989088.1.52866 WP_010989088.1.52898 WP_010989088.1.52915 WP_010989088.1.52924 WP_010989088.1.52949 WP_010989088.1.52985 WP_010989088.1.5301 WP_010989088.1.53100 WP_010989088.1.53107 WP_010989088.1.53119 WP_010989088.1.5313 WP_010989088.1.53158 WP_010989088.1.5316 WP_010989088.1.53179 WP_010989088.1.53190 WP_010989088.1.53198 WP_010989088.1.53203 WP_010989088.1.53234 WP_010989088.1.53272 WP_010989088.1.53274 WP_010989088.1.53286 WP_010989088.1.53315 WP_010989088.1.53316 WP_010989088.1.53328 WP_010989088.1.5333 WP_010989088.1.53362 WP_010989088.1.53385 WP_010989088.1.53406 WP_010989088.1.53436 WP_010989088.1.53454 WP_010989088.1.53466 WP_010989088.1.53529 WP_010989088.1.53534 WP_010989088.1.53543 WP_010989088.1.53567 WP_010989088.1.53664 WP_010989088.1.53675 WP_010989088.1.53696 WP_010989088.1.53757 WP_010989088.1.53772 WP_010989088.1.53778 WP_010989088.1.53781 WP_010989088.1.53790 WP_010989088.1.53812 WP_010989088.1.53814 WP_010989088.1.53896 WP_010989088.1.53905 WP_010989088.1.5392 WP_010989088.1.53935 WP_010989088.1.53961 WP_010989088.1.54033 WP_010989088.1.54068 WP_010989088.1.54075 WP_010989088.1.54085 WP_010989088.1.54136 WP_010989088.1.5415 WP_010989088.1.54159 WP_010989088.1.54196 WP_010989088.1.542 WP_010989088.1.54209 WP_010989088.1.54271 WP_010989088.1.54273 WP_010989088.1.54274 WP_010989088.1.54283 WP_010989088.1.54319 WP_010989088.1.54324 WP_010989088.1.54333 WP_010989088.1.54340 WP_010989088.1.54364 WP_010989088.1.54366 WP_010989088.1.54400 WP_010989088.1.54500 WP_010989088.1.54522 WP_010989088.1.54526 WP_010989088.1.54558 WP_010989088.1.5456 WP_010989088.1.54569 WP_010989088.1.5459 WP_010989088.1.54607 WP_010989088.1.54615 WP_010989088.1.5462 WP_010989088.1.54644 WP_010989088.1.54662 WP_010989088.1.54694 WP_010989088.1.54722 WP_010989088.1.54749 WP_010989088.1.54764 WP_010989088.1.54774 WP_010989088.1.54814 WP_010989088.1.54822 WP_010989088.1.54833 WP_010989088.1.54845 WP_010989088.1.5485 WP_010989088.1.54877 WP_010989088.1.5493 WP_010989088.1.54936 WP_010989088.1.54984 WP_010989088.1.54992 WP_010989088.1.55008 WP_010989088.1.55073 WP_010989088.1.55152 WP_010989088.1.55156 WP_010989088.1.55166 WP_010989088.1.55178 WP_010989088.1.55200 WP_010989088.1.55224 WP_010989088.1.5523 WP_010989088.1.5525 WP_010989088.1.5527 WP_010989088.1.55285 WP_010989088.1.55294 WP_010989088.1.55325 WP_010989088.1.55361 WP_010989088.1.55430 WP_010989088.1.55461 WP_010989088.1.55475 WP_010989088.1.55477 WP_010989088.1.55496 WP_010989088.1.55500 WP_010989088.1.5552 WP_010989088.1.55528 WP_010989088.1.55545 WP_010989088.1.5555 WP_010989088.1.55554 WP_010989088.1.55557 WP_010989088.1.55559 WP_010989088.1.5560 WP_010989088.1.55614 WP_010989088.1.55623 WP_010989088.1.55640 WP_010989088.1.55647 WP_010989088.1.55672 WP_010989088.1.55706 WP_010989088.1.55718 WP_010989088.1.5572 WP_010989088.1.55743 WP_010989088.1.55768 WP_010989088.1.5577 WP_010989088.1.55782 WP_010989088.1.55796 WP_010989088.1.55803 WP_010989088.1.55923 WP_010989088.1.55948 WP_010989088.1.55973 WP_010989088.1.55993 WP_010989088.1.55995 WP_010989088.1.56002 WP_010989088.1.56004 WP_010989088.1.56012 WP_010989088.1.56026 WP_010989088.1.56059 WP_010989088.1.56070 WP_010989088.1.56082 WP_010989088.1.56097 WP_010989088.1.56100 WP_010989088.1.56105 WP_010989088.1.56130 WP_010989088.1.56152 WP_010989088.1.56235 WP_010989088.1.56238 WP_010989088.1.56244 WP_010989088.1.56261 WP_010989088.1.56263 WP_010989088.1.56286 WP_010989088.1.56303 WP_010989088.1.56304 WP_010989088.1.56305 WP_010989088.1.5633 WP_010989088.1.56354 WP_010989088.1.56368 WP_010989088.1.56370 WP_010989088.1.56374 WP_010989088.1.56385 WP_010989088.1.56389 WP_010989088.1.56396 WP_010989088.1.56414 WP_010989088.1.56420 WP_010989088.1.56438 WP_010989088.1.56468 WP_010989088.1.56512 WP_010989088.1.56559 WP_010989088.1.56560 WP_010989088.1.56597 WP_010989088.1.56601 WP_010989088.1.56614 WP_010989088.1.56615 WP_010989088.1.56642 WP_010989088.1.56647 WP_010989088.1.56651 WP_010989088.1.56660 WP_010989088.1.56671 WP_010989088.1.5668 WP_010989088.1.56682 WP_010989088.1.56791 WP_010989088.1.56824 WP_010989088.1.56851 WP_010989088.1.56853 WP_010989088.1.56861 WP_010989088.1.56875 WP_010989088.1.56877 WP_010989088.1.56893 WP_010989088.1.56898 WP_010989088.1.56905 WP_010989088.1.56942 WP_010989088.1.56950 WP_010989088.1.57000 WP_010989088.1.57026 WP_010989088.1.57039 WP_010989088.1.57056 WP_010989088.1.57076 WP_010989088.1.57084 WP_010989088.1.5711 WP_010989088.1.57125 WP_010989088.1.57143 WP_010989088.1.57168 WP_010989088.1.57187 WP_010989088.1.57232 WP_010989088.1.57233 WP_010989088.1.57244 WP_010989088.1.57246 WP_010989088.1.57296 WP_010989088.1.57307 WP_010989088.1.57344 WP_010989088.1.57356 WP_010989088.1.57362 WP_010989088.1.57377 WP_010989088.1.57399 WP_010989088.1.57418 WP_010989088.1.57433 WP_010989088.1.57494 WP_010989088.1.57495 WP_010989088.1.57510 WP_010989088.1.57515 WP_010989088.1.57521 WP_010989088.1.57529 WP_010989088.1.5753 WP_010989088.1.57534 WP_010989088.1.57555 WP_010989088.1.57559 WP_010989088.1.57576 WP_010989088.1.57601 WP_010989088.1.57607 WP_010989088.1.5761 WP_010989088.1.57631 WP_010989088.1.57709 WP_010989088.1.57710 WP_010989088.1.57735 WP_010989088.1.5774 WP_010989088.1.57763 WP_010989088.1.57781 WP_010989088.1.57797 WP_010989088.1.5781 WP_010989088.1.57835 WP_010989088.1.57857 WP_010989088.1.57862 WP_010989088.1.57890 WP_010989088.1.57891 WP_010989088.1.57893 WP_010989088.1.57902 WP_010989088.1.57978 WP_010989088.1.5801 WP_010989088.1.58040 WP_010989088.1.58041 WP_010989088.1.58090 WP_010989088.1.58131 WP_010989088.1.58144 WP_010989088.1.58153 WP_010989088.1.58157 WP_010989088.1.58239 WP_010989088.1.58251 WP_010989088.1.5828 WP_010989088.1.58290 WP_010989088.1.58357 WP_010989088.1.58358 WP_010989088.1.58372 WP_010989088.1.58407 WP_010989088.1.58416 WP_010989088.1.58442 WP_010989088.1.58443 WP_010989088.1.58451 WP_010989088.1.5846 WP_010989088.1.58467 WP_010989088.1.58486 WP_010989088.1.58489 WP_010989088.1.5854 WP_010989088.1.58548 WP_010989088.1.58564 WP_010989088.1.5858 WP_010989088.1.58604 WP_010989088.1.58648 WP_010989088.1.58662 WP_010989088.1.58669 WP_010989088.1.58675 WP_010989088.1.58698 WP_010989088.1.587 WP_010989088.1.58729 WP_010989088.1.58744 WP_010989088.1.58745 WP_010989088.1.5878 WP_010989088.1.58803 WP_010989088.1.58831 WP_010989088.1.58834 WP_010989088.1.58836 WP_010989088.1.5886 WP_010989088.1.58861 WP_010989088.1.58884 WP_010989088.1.58926 WP_010989088.1.59006 WP_010989088.1.59012 WP_010989088.1.59068 WP_010989088.1.59084 WP_010989088.1.59094 WP_010989088.1.59097 WP_010989088.1.59125 WP_010989088.1.59136 WP_010989088.1.59142 WP_010989088.1.59148 WP_010989088.1.59163 WP_010989088.1.59236 WP_010989088.1.59276 WP_010989088.1.5929 WP_010989088.1.59294 WP_010989088.1.59336 WP_010989088.1.59375 WP_010989088.1.59381 WP_010989088.1.59412 WP_010989088.1.59420 WP_010989088.1.59427 WP_010989088.1.59439 WP_010989088.1.59458 WP_010989088.1.59486 WP_010989088.1.59490 WP_010989088.1.59508 WP_010989088.1.59512 WP_010989088.1.59521 WP_010989088.1.5953 WP_010989088.1.59538 WP_010989088.1.59548 WP_010989088.1.59562 WP_010989088.1.59587 WP_010989088.1.59604 WP_010989088.1.59641 WP_010989088.1.59646 WP_010989088.1.59684 WP_010989088.1.59694 WP_010989088.1.59709 WP_010989088.1.59710 WP_010989088.1.59755 WP_010989088.1.59771 WP_010989088.1.5979 WP_010989088.1.59830 WP_010989088.1.59848 WP_010989088.1.59933 WP_010989088.1.59953 WP_010989088.1.59979 WP_010989088.1.60008 WP_010989088.1.60015 WP_010989088.1.60021 WP_010989088.1.60052 WP_010989088.1.60069 WP_010989088.1.60106 WP_010989088.1.60126 WP_010989088.1.60137 WP_010989088.1.60140 WP_010989088.1.60155 WP_010989088.1.60209 WP_010989088.1.60213 WP_010989088.1.60226 WP_010989088.1.60231 WP_010989088.1.60285 WP_010989088.1.60320 WP_010989088.1.6033 WP_010989088.1.60330 WP_010989088.1.60370 WP_010989088.1.60379 WP_010989088.1.60425 WP_010989088.1.60464 WP_010989088.1.60469 WP_010989088.1.60486 WP_010989088.1.60503 WP_010989088.1.60507 WP_010989088.1.6052 WP_010989088.1.60545 WP_010989088.1.60560 WP_010989088.1.60561 WP_010989088.1.60597 WP_010989088.1.60608 WP_010989088.1.60622 WP_010989088.1.60643 WP_010989088.1.60713 WP_010989088.1.60760 WP_010989088.1.60772 WP_010989088.1.60794 WP_010989088.1.608 WP_010989088.1.60809 WP_010989088.1.60855 WP_010989088.1.6086 WP_010989088.1.60863 WP_010989088.1.60866 WP_010989088.1.60874 WP_010989088.1.60897 WP_010989088.1.6090 WP_010989088.1.60919 WP_010989088.1.60926 WP_010989088.1.60941 WP_010989088.1.60976 WP_010989088.1.60988 WP_010989088.1.60990 WP_010989088.1.61045 WP_010989088.1.61078 WP_010989088.1.6108 WP_010989088.1.61087 WP_010989088.1.6114 WP_010989088.1.61146 WP_010989088.1.61184 WP_010989088.1.61201 WP_010989088.1.61218 WP_010989088.1.61232 WP_010989088.1.6129 WP_010989088.1.61296 WP_010989088.1.61309 WP_010989088.1.61345 WP_010989088.1.61356 WP_010989088.1.61381 WP_010989088.1.61417 WP_010989088.1.6143 WP_010989088.1.61434 WP_010989088.1.61497 WP_010989088.1.61501 WP_010989088.1.61509 WP_010989088.1.61519 WP_010989088.1.61574 WP_010989088.1.61582 WP_010989088.1.61594 WP_010989088.1.61595 WP_010989088.1.61609 WP_010989088.1.6164 WP_010989088.1.61662 WP_010989088.1.61667 WP_010989088.1.61671 WP_010989088.1.61694 WP_010989088.1.61712 WP_010989088.1.61714 WP_010989088.1.61730 WP_010989088.1.61732 WP_010989088.1.61743 WP_010989088.1.61857 WP_010989088.1.6190 WP_010989088.1.61908 WP_010989088.1.61918 WP_010989088.1.61922 WP_010989088.1.61924 WP_010989088.1.61952 WP_010989088.1.61968 WP_010989088.1.62007 WP_010989088.1.62020 WP_010989088.1.62025 WP_010989088.1.62063 WP_010989088.1.62076 WP_010989088.1.6209 WP_010989088.1.62108 WP_010989088.1.62120 WP_010989088.1.62122 WP_010989088.1.62142 WP_010989088.1.62144 WP_010989088.1.62158 WP_010989088.1.62184 WP_010989088.1.62195 WP_010989088.1.62201 WP_010989088.1.62204 WP_010989088.1.62210 WP_010989088.1.62219 WP_010989088.1.62222 WP_010989088.1.62241 WP_010989088.1.62257 WP_010989088.1.62271 WP_010989088.1.62304 WP_010989088.1.62310 WP_010989088.1.62339 WP_010989088.1.62344 WP_010989088.1.62361 WP_010989088.1.62374 WP_010989088.1.62403 WP_010989088.1.62404 WP_010989088.1.62412 WP_010989088.1.62486 WP_010989088.1.62504 WP_010989088.1.62522 WP_010989088.1.6253 WP_010989088.1.62564 WP_010989088.1.62570 WP_010989088.1.62619 WP_010989088.1.62648 WP_010989088.1.62677 WP_010989088.1.62693 WP_010989088.1.627 WP_010989088.1.62725 WP_010989088.1.62745 WP_010989088.1.62757 WP_010989088.1.62798 WP_010989088.1.62828 WP_010989088.1.62853 WP_010989088.1.62903 WP_010989088.1.62910 WP_010989088.1.6292 WP_010989088.1.62955 WP_010989088.1.62976 WP_010989088.1.62983 WP_010989088.1.62988 WP_010989088.1.63045 WP_010989088.1.63063 WP_010989088.1.63102 WP_010989088.1.63118 WP_010989088.1.63129 WP_010989088.1.63135 WP_010989088.1.63150 WP_010989088.1.63155 WP_010989088.1.63181 WP_010989088.1.63186 WP_010989088.1.63203 WP_010989088.1.63229 WP_010989088.1.63243 WP_010989088.1.63250 WP_010989088.1.63256 WP_010989088.1.63290 WP_010989088.1.63358 WP_010989088.1.63382 WP_010989088.1.63422 WP_010989088.1.63432 WP_010989088.1.63455 WP_010989088.1.63461 WP_010989088.1.63479 WP_010989088.1.63497 WP_010989088.1.63499 WP_010989088.1.63509 WP_010989088.1.63513 WP_010989088.1.63525 WP_010989088.1.63529 WP_010989088.1.63532 WP_010989088.1.63568 WP_010989088.1.6357 WP_010989088.1.63577 WP_010989088.1.63585 WP_010989088.1.63603 WP_010989088.1.63633 WP_010989088.1.63664 WP_010989088.1.6367 WP_010989088.1.63677 WP_010989088.1.63690 WP_010989088.1.6370 WP_010989088.1.63718 WP_010989088.1.63731 WP_010989088.1.63748 WP_010989088.1.6375 WP_010989088.1.63757 WP_010989088.1.63766 WP_010989088.1.63781 WP_010989088.1.63782 WP_010989088.1.63797 WP_010989088.1.63831 WP_010989088.1.63834 WP_010989088.1.63851 WP_010989088.1.63860 WP_010989088.1.63863 WP_010989088.1.63864 WP_010989088.1.63866 WP_010989088.1.63903 WP_010989088.1.63912 WP_010989088.1.63934 WP_010989088.1.63958 WP_010989088.1.63977 WP_010989088.1.6399 WP_010989088.1.64007 WP_010989088.1.64010 WP_010989088.1.64018 WP_010989088.1.64034 WP_010989088.1.64046 WP_010989088.1.64072 WP_010989088.1.64085 WP_010989088.1.64109 WP_010989088.1.64157 WP_010989088.1.64208 WP_010989088.1.64229 WP_010989088.1.6423 WP_010989088.1.64244 WP_010989088.1.64266 WP_010989088.1.64294 WP_010989088.1.64350 WP_010989088.1.6437 WP_010989088.1.64374 WP_010989088.1.64385 WP_010989088.1.64387 WP_010989088.1.64389 WP_010989088.1.64403 WP_010989088.1.64462 WP_010989088.1.64500 WP_010989088.1.6451 WP_010989088.1.64597 WP_010989088.1.64645 WP_010989088.1.64649 WP_010989088.1.64667 WP_010989088.1.64674 WP_010989088.1.64690 WP_010989088.1.64702 WP_010989088.1.64711 WP_010989088.1.64757 WP_010989088.1.64758 WP_010989088.1.64771 WP_010989088.1.64781 WP_010989088.1.64798 WP_010989088.1.64831 WP_010989088.1.6489 WP_010989088.1.64894 WP_010989088.1.64919 WP_010989088.1.64920 WP_010989088.1.64944 WP_010989088.1.64972 WP_010989088.1.64977 WP_010989088.1.65011 WP_010989088.1.65016 WP_010989088.1.65018 WP_010989088.1.65022 WP_010989088.1.65027 WP_010989088.1.65028 WP_010989088.1.65052 WP_010989088.1.65163 WP_010989088.1.65168 WP_010989088.1.65171 WP_010989088.1.65185 WP_010989088.1.65238 WP_010989088.1.65248 WP_010989088.1.6525 WP_010989088.1.65269 WP_010989088.1.65295 WP_010989088.1.65348 WP_010989088.1.6535 WP_010989088.1.65357 WP_010989088.1.65363 WP_010989088.1.65394 WP_010989088.1.65437 WP_010989088.1.65474 WP_010989088.1.65475 WP_010989088.1.6550 WP_010989088.1.65508 WP_010989088.1.65558 WP_010989088.1.65572 WP_010989088.1.6560 WP_010989088.1.65601 WP_010989088.1.6561 WP_010989088.1.65633 WP_010989088.1.6565 WP_010989088.1.65687 WP_010989088.1.65696 WP_010989088.1.65698 WP_010989088.1.6572 WP_010989088.1.6575 WP_010989088.1.65771 WP_010989088.1.65782 WP_010989088.1.65790 WP_010989088.1.65795 WP_010989088.1.65818 WP_010989088.1.65849 WP_010989088.1.65876 WP_010989088.1.65881 WP_010989088.1.65883 WP_010989088.1.65901 WP_010989088.1.6594 WP_010989088.1.65940 WP_010989088.1.65945 WP_010989088.1.6595 WP_010989088.1.65956 WP_010989088.1.65968 WP_010989088.1.66049 WP_010989088.1.66074 WP_010989088.1.66082 WP_010989088.1.66085 WP_010989088.1.66129 WP_010989088.1.66171 WP_010989088.1.66235 WP_010989088.1.66270 WP_010989088.1.66272 WP_010989088.1.6630 WP_010989088.1.66314 WP_010989088.1.66315 WP_010989088.1.66330 WP_010989088.1.66358 WP_010989088.1.66362 WP_010989088.1.66368 WP_010989088.1.6638 WP_010989088.1.66385 WP_010989088.1.6640 WP_010989088.1.66400 WP_010989088.1.66428 WP_010989088.1.66446 WP_010989088.1.66462 WP_010989088.1.6647 WP_010989088.1.66492 WP_010989088.1.66539 WP_010989088.1.66600 WP_010989088.1.66630 WP_010989088.1.66678 WP_010989088.1.66698 WP_010989088.1.66733 WP_010989088.1.66779 WP_010989088.1.6680 WP_010989088.1.66800 WP_010989088.1.66807 WP_010989088.1.66824 WP_010989088.1.66825 WP_010989088.1.66834 WP_010989088.1.66876 WP_010989088.1.66901 WP_010989088.1.66959 WP_010989088.1.66962 WP_010989088.1.67 WP_010989088.1.67037 WP_010989088.1.67045 WP_010989088.1.67075 WP_010989088.1.6710 WP_010989088.1.67100 WP_010989088.1.67173 WP_010989088.1.67175 WP_010989088.1.67181 WP_010989088.1.67228 WP_010989088.1.67235 WP_010989088.1.67268 WP_010989088.1.67279 WP_010989088.1.67288 WP_010989088.1.67347 WP_010989088.1.6739 WP_010989088.1.67405 WP_010989088.1.67424 WP_010989088.1.67465 WP_010989088.1.67552 WP_010989088.1.6760 WP_010989088.1.67617 WP_010989088.1.67633 WP_010989088.1.67637 WP_010989088.1.67682 WP_010989088.1.67705 WP_010989088.1.67707 WP_010989088.1.67731 WP_010989088.1.67772 WP_010989088.1.67803 WP_010989088.1.67814 WP_010989088.1.6782 WP_010989088.1.67825 WP_010989088.1.67827 WP_010989088.1.67829 WP_010989088.1.6785 WP_010989088.1.67887 WP_010989088.1.67905 WP_010989088.1.67924 WP_010989088.1.67932 WP_010989088.1.67942 WP_010989088.1.67969 WP_010989088.1.67970 WP_010989088.1.67977 WP_010989088.1.67988 WP_010989088.1.68036 WP_010989088.1.68073 WP_010989088.1.68075 WP_010989088.1.6809 WP_010989088.1.68115 WP_010989088.1.68140 WP_010989088.1.68147 WP_010989088.1.68159 WP_010989088.1.68167 WP_010989088.1.68201 WP_010989088.1.68206 WP_010989088.1.68210 WP_010989088.1.6827 WP_010989088.1.68275 WP_010989088.1.6833 WP_010989088.1.68401 WP_010989088.1.68477 WP_010989088.1.68478 WP_010989088.1.6849 WP_010989088.1.685 WP_010989088.1.68532 WP_010989088.1.68547 WP_010989088.1.6857 WP_010989088.1.6858 WP_010989088.1.68589 WP_010989088.1.68591 WP_010989088.1.68629 WP_010989088.1.68652 WP_010989088.1.68655 WP_010989088.1.68656 WP_010989088.1.68658 WP_010989088.1.68677 WP_010989088.1.68690 WP_010989088.1.6875 WP_010989088.1.68778 WP_010989088.1.68787 WP_010989088.1.6879 WP_010989088.1.68816 WP_010989088.1.6882 WP_010989088.1.68893 WP_010989088.1.68894 WP_010989088.1.68895 WP_010989088.1.68928 WP_010989088.1.68958 WP_010989088.1.68966 WP_010989088.1.68975 WP_010989088.1.68999 WP_010989088.1.69001 WP_010989088.1.69006 WP_010989088.1.69011 WP_010989088.1.69029 WP_010989088.1.6904 WP_010989088.1.69058 WP_010989088.1.6907 WP_010989088.1.69080 WP_010989088.1.69086 WP_010989088.1.6913 WP_010989088.1.69131 WP_010989088.1.69139 WP_010989088.1.69146 WP_010989088.1.69151 WP_010989088.1.69236 WP_010989088.1.69255 WP_010989088.1.69273 WP_010989088.1.69296 WP_010989088.1.69320 WP_010989088.1.69346 WP_010989088.1.69357 WP_010989088.1.69359 WP_010989088.1.69371 WP_010989088.1.69385 WP_010989088.1.69397 WP_010989088.1.69433 WP_010989088.1.69465 WP_010989088.1.69485 WP_010989088.1.69515 WP_010989088.1.6954 WP_010989088.1.69554 WP_010989088.1.69564 WP_010989088.1.69575 WP_010989088.1.69588 WP_010989088.1.69592 WP_010989088.1.69597 WP_010989088.1.69616 WP_010989088.1.69636 WP_010989088.1.69644 WP_010989088.1.69696 WP_010989088.1.69704 WP_010989088.1.69710 WP_010989088.1.69754 WP_010989088.1.69758 WP_010989088.1.69760 WP_010989088.1.69767 WP_010989088.1.69785 WP_010989088.1.69787 WP_010989088.1.69790 WP_010989088.1.69807 WP_010989088.1.69808 WP_010989088.1.69817 WP_010989088.1.69839 WP_010989088.1.69848 WP_010989088.1.69965 WP_010989088.1.69975 WP_010989088.1.69977 WP_010989088.1.69982 WP_010989088.1.70003 WP_010989088.1.70028 WP_010989088.1.70047 WP_010989088.1.70087 WP_010989088.1.70088 WP_010989088.1.7010 WP_010989088.1.7016 WP_010989088.1.70169 WP_010989088.1.70183 WP_010989088.1.7021 WP_010989088.1.70241 WP_010989088.1.70248 WP_010989088.1.70269 WP_010989088.1.70272 WP_010989088.1.70281 WP_010989088.1.70289 WP_010989088.1.70290 WP_010989088.1.70321 WP_010989088.1.70327 WP_010989088.1.70355 WP_010989088.1.7044 WP_010989088.1.70440 WP_010989088.1.70447 WP_010989088.1.70485 WP_010989088.1.70488 WP_010989088.1.70491 WP_010989088.1.70531 WP_010989088.1.7055 WP_010989088.1.70580 WP_010989088.1.70596 WP_010989088.1.7060 WP_010989088.1.70643 WP_010989088.1.70644 WP_010989088.1.70662 WP_010989088.1.70678 WP_010989088.1.70683 WP_010989088.1.70685 WP_010989088.1.70712 WP_010989088.1.70732 WP_010989088.1.70733 WP_010989088.1.70761 WP_010989088.1.70785 WP_010989088.1.70792 WP_010989088.1.70797 WP_010989088.1.70837 WP_010989088.1.70869 WP_010989088.1.70883 WP_010989088.1.70899 WP_010989088.1.70914 WP_010989088.1.70922 WP_010989088.1.70929 WP_010989088.1.7093 WP_010989088.1.70948 WP_010989088.1.70959 WP_010989088.1.70969 WP_010989088.1.70971 WP_010989088.1.70985 WP_010989088.1.70986 WP_010989088.1.71010 WP_010989088.1.71023 WP_010989088.1.71069 WP_010989088.1.7110 WP_010989088.1.71116 WP_010989088.1.71120 WP_010989088.1.71146 WP_010989088.1.71165 WP_010989088.1.71171 WP_010989088.1.71172 WP_010989088.1.71184 WP_010989088.1.71188 WP_010989088.1.71201 WP_010989088.1.71202 WP_010989088.1.71243 WP_010989088.1.71248 WP_010989088.1.71268 WP_010989088.1.71299 WP_010989088.1.71305 WP_010989088.1.71306 WP_010989088.1.71337 WP_010989088.1.7134 WP_010989088.1.71363 WP_010989088.1.71368 WP_010989088.1.71378 WP_010989088.1.714 WP_010989088.1.71401 WP_010989088.1.71418 WP_010989088.1.7142 WP_010989088.1.71446 WP_010989088.1.71450 WP_010989088.1.71452 WP_010989088.1.71481 WP_010989088.1.71583 WP_010989088.1.71600 WP_010989088.1.71626 WP_010989088.1.71636 WP_010989088.1.71649 WP_010989088.1.71656 WP_010989088.1.71667 WP_010989088.1.71691 WP_010989088.1.71702 WP_010989088.1.7174 WP_010989088.1.71746 WP_010989088.1.71750 WP_010989088.1.71756 WP_010989088.1.71798 WP_010989088.1.71845 WP_010989088.1.71848 WP_010989088.1.71881 WP_010989088.1.71908 WP_010989088.1.71923 WP_010989088.1.71929 WP_010989088.1.71941 WP_010989088.1.71952 WP_010989088.1.71973 WP_010989088.1.71979 WP_010989088.1.71984 WP_010989088.1.720 WP_010989088.1.72068 WP_010989088.1.72100 WP_010989088.1.72105 WP_010989088.1.72107 WP_010989088.1.72119 WP_010989088.1.72121 WP_010989088.1.72188 WP_010989088.1.72190 WP_010989088.1.72203 WP_010989088.1.72220 WP_010989088.1.72221 WP_010989088.1.72226 WP_010989088.1.72234 WP_010989088.1.72243 WP_010989088.1.72254 WP_010989088.1.72277 WP_010989088.1.72281 WP_010989088.1.72283 WP_010989088.1.72300 WP_010989088.1.72325 WP_010989088.1.72339 WP_010989088.1.72351 WP_010989088.1.72372 WP_010989088.1.72376 WP_010989088.1.72382 WP_010989088.1.72403 WP_010989088.1.72412 WP_010989088.1.7243 WP_010989088.1.72532 WP_010989088.1.72594 WP_010989088.1.72602 WP_010989088.1.72629 WP_010989088.1.72642 WP_010989088.1.72671 WP_010989088.1.72689 WP_010989088.1.72716 WP_010989088.1.72718 WP_010989088.1.72728 WP_010989088.1.72793 WP_010989088.1.72797 WP_010989088.1.72827 WP_010989088.1.72843 WP_010989088.1.72850 WP_010989088.1.72865 WP_010989088.1.72871 WP_010989088.1.72872 WP_010989088.1.72887 WP_010989088.1.72892 WP_010989088.1.72894 WP_010989088.1.72897 WP_010989088.1.72944 WP_010989088.1.72946 WP_010989088.1.7295 WP_010989088.1.72968 WP_010989088.1.72975 WP_010989088.1.7304 WP_010989088.1.73062 WP_010989088.1.73068 WP_010989088.1.73102 WP_010989088.1.73125 WP_010989088.1.7315 WP_010989088.1.7316 WP_010989088.1.73200 WP_010989088.1.73328 WP_010989088.1.73338 WP_010989088.1.7334 WP_010989088.1.73362 WP_010989088.1.73377 WP_010989088.1.73379 WP_010989088.1.7341 WP_010989088.1.73461 WP_010989088.1.73481 WP_010989088.1.73535 WP_010989088.1.7356 WP_010989088.1.73561 WP_010989088.1.73581 WP_010989088.1.73596 WP_010989088.1.73617 WP_010989088.1.73667 WP_010989088.1.73669 WP_010989088.1.73701 WP_010989088.1.73708 WP_010989088.1.7374 WP_010989088.1.73753 WP_010989088.1.73758 WP_010989088.1.73794 WP_010989088.1.73804 WP_010989088.1.73831 WP_010989088.1.73847 WP_010989088.1.7386 WP_010989088.1.7387 WP_010989088.1.73901 WP_010989088.1.73924 WP_010989088.1.73926 WP_010989088.1.73956 WP_010989088.1.73958 WP_010989088.1.73965 WP_010989088.1.74028 WP_010989088.1.74029 WP_010989088.1.74040 WP_010989088.1.74049 WP_010989088.1.7405 WP_010989088.1.74089 WP_010989088.1.74117 WP_010989088.1.74174 WP_010989088.1.74181 WP_010989088.1.74191 WP_010989088.1.74207 WP_010989088.1.74228 WP_010989088.1.74248 WP_010989088.1.743 WP_010989088.1.74300 WP_010989088.1.7433 WP_010989088.1.74410 WP_010989088.1.74414 WP_010989088.1.74418 WP_010989088.1.74422 WP_010989088.1.74428 WP_010989088.1.7444 WP_010989088.1.74454 WP_010989088.1.74466 WP_010989088.1.74469 WP_010989088.1.74481 WP_010989088.1.745 WP_010989088.1.74500 WP_010989088.1.74529 WP_010989088.1.74545 WP_010989088.1.74570 WP_010989088.1.74578 WP_010989088.1.7458 WP_010989088.1.74620 WP_010989088.1.74632 WP_010989088.1.74639 WP_010989088.1.74644 WP_010989088.1.74661 WP_010989088.1.74702 WP_010989088.1.74741 WP_010989088.1.74745 WP_010989088.1.74806 WP_010989088.1.74826 WP_010989088.1.74876 WP_010989088.1.74884 WP_010989088.1.7491 WP_010989088.1.74946 WP_010989088.1.74972 WP_010989088.1.74992 WP_010989088.1.75009 WP_010989088.1.75051 WP_010989088.1.75056 WP_010989088.1.75058 WP_010989088.1.75114 WP_010989088.1.75129 WP_010989088.1.75134 WP_010989088.1.75148 WP_010989088.1.75159 WP_010989088.1.75168 WP_010989088.1.75180 WP_010989088.1.75187 WP_010989088.1.75288 WP_010989088.1.75301 WP_010989088.1.7531 WP_010989088.1.75334 WP_010989088.1.75362 WP_010989088.1.75371 WP_010989088.1.75385 WP_010989088.1.75392 WP_010989088.1.75400 WP_010989088.1.75402 WP_010989088.1.7543 WP_010989088.1.75450 WP_010989088.1.75494 WP_010989088.1.7558 WP_010989088.1.75585 WP_010989088.1.75607 WP_010989088.1.75609 WP_010989088.1.75626 WP_010989088.1.75664 WP_010989088.1.75703 WP_010989088.1.75716 WP_010989088.1.75740 WP_010989088.1.75751 WP_010989088.1.75760 WP_010989088.1.75764 WP_010989088.1.75794 WP_010989088.1.75810 WP_010989088.1.75828 WP_010989088.1.75837 WP_010989088.1.75863 WP_010989088.1.75873 WP_010989088.1.75874 WP_010989088.1.75884 WP_010989088.1.75902 WP_010989088.1.75932 WP_010989088.1.75945 WP_010989088.1.75957 WP_010989088.1.76 WP_010989088.1.76020 WP_010989088.1.76024 WP_010989088.1.76055 WP_010989088.1.76097 WP_010989088.1.76102 WP_010989088.1.76108 WP_010989088.1.76115 WP_010989088.1.76137 WP_010989088.1.76156 WP_010989088.1.76162 WP_010989088.1.76164 WP_010989088.1.76170 WP_010989088.1.76186 WP_010989088.1.76197 WP_010989088.1.76252 WP_010989088.1.7629 WP_010989088.1.76301 WP_010989088.1.76327 WP_010989088.1.7634 WP_010989088.1.76345 WP_010989088.1.76346 WP_010989088.1.76364 WP_010989088.1.76434 WP_010989088.1.76445 WP_010989088.1.76451 WP_010989088.1.76471 WP_010989088.1.76495 WP_010989088.1.76529 WP_010989088.1.76532 WP_010989088.1.76548 WP_010989088.1.7655 WP_010989088.1.76576 WP_010989088.1.7660 WP_010989088.1.76611 WP_010989088.1.76673 WP_010989088.1.76706 WP_010989088.1.7672 WP_010989088.1.76721 WP_010989088.1.76724 WP_010989088.1.76756 WP_010989088.1.76760 WP_010989088.1.76776 WP_010989088.1.76799 WP_010989088.1.76806 WP_010989088.1.7684 WP_010989088.1.76866 WP_010989088.1.76875 WP_010989088.1.76880 WP_010989088.1.76899 WP_010989088.1.76913 WP_010989088.1.76968 WP_010989088.1.77017 WP_010989088.1.77033 WP_010989088.1.77038 WP_010989088.1.77047 WP_010989088.1.77067 WP_010989088.1.77080 WP_010989088.1.7712 WP_010989088.1.77177 WP_010989088.1.77180 WP_010989088.1.77184 WP_010989088.1.77193 WP_010989088.1.77241 WP_010989088.1.77244 WP_010989088.1.77267 WP_010989088.1.77271 WP_010989088.1.77292 WP_010989088.1.77306 WP_010989088.1.77313 WP_010989088.1.77349 WP_010989088.1.77356 WP_010989088.1.77390 WP_010989088.1.77414 WP_010989088.1.77431 WP_010989088.1.77436 WP_010989088.1.77440 WP_010989088.1.77475 WP_010989088.1.77496 WP_010989088.1.77514 WP_010989088.1.77529 WP_010989088.1.77549 WP_010989088.1.77555 WP_010989088.1.77575 WP_010989088.1.77596 WP_010989088.1.77629 WP_010989088.1.77646 WP_010989088.1.77653 WP_010989088.1.77692 WP_010989088.1.77710 WP_010989088.1.77729 WP_010989088.1.77754 WP_010989088.1.7782 WP_010989088.1.7784 WP_010989088.1.77846 WP_010989088.1.77851 WP_010989088.1.77871 WP_010989088.1.77898 WP_010989088.1.77918 WP_010989088.1.7792 WP_010989088.1.7793 WP_010989088.1.77951 WP_010989088.1.77960 WP_010989088.1.77971 WP_010989088.1.77983 WP_010989088.1.77987 WP_010989088.1.77989 WP_010989088.1.78 WP_010989088.1.78016 WP_010989088.1.7802 WP_010989088.1.78026 WP_010989088.1.78033 WP_010989088.1.78051 WP_010989088.1.78053 WP_010989088.1.78076 WP_010989088.1.78096 WP_010989088.1.78100 WP_010989088.1.78110 WP_010989088.1.78120 WP_010989088.1.7814 WP_010989088.1.78168 WP_010989088.1.78170 WP_010989088.1.78180 WP_010989088.1.78201 WP_010989088.1.78245 WP_010989088.1.78259 WP_010989088.1.78301 WP_010989088.1.78339 WP_010989088.1.78352 WP_010989088.1.78366 WP_010989088.1.78372 WP_010989088.1.78383 WP_010989088.1.78407 WP_010989088.1.78443 WP_010989088.1.78495 WP_010989088.1.78496 WP_010989088.1.78501 WP_010989088.1.78502 WP_010989088.1.78603 WP_010989088.1.7861 WP_010989088.1.78618 WP_010989088.1.78632 WP_010989088.1.78658 WP_010989088.1.78673 WP_010989088.1.78697 WP_010989088.1.78715 WP_010989088.1.78734 WP_010989088.1.78738 WP_010989088.1.7877 WP_010989088.1.78771 WP_010989088.1.78789 WP_010989088.1.78802 WP_010989088.1.78815 WP_010989088.1.78830 WP_010989088.1.78838 WP_010989088.1.78862 WP_010989088.1.78871 WP_010989088.1.78874 WP_010989088.1.78877 WP_010989088.1.78881 WP_010989088.1.78896 WP_010989088.1.7891 WP_010989088.1.78913 WP_010989088.1.78918 WP_010989088.1.78928 WP_010989088.1.7893 WP_010989088.1.78930 WP_010989088.1.78951 WP_010989088.1.78959 WP_010989088.1.79011 WP_010989088.1.79032 WP_010989088.1.79081 WP_010989088.1.79099 WP_010989088.1.79140 WP_010989088.1.79151 WP_010989088.1.79167 WP_010989088.1.79203 WP_010989088.1.79235 WP_010989088.1.79289 WP_010989088.1.79302 WP_010989088.1.79335 WP_010989088.1.79370 WP_010989088.1.794 WP_010989088.1.79427 WP_010989088.1.79462 WP_010989088.1.79466 WP_010989088.1.79468 WP_010989088.1.79472 WP_010989088.1.79490 WP_010989088.1.79495 WP_010989088.1.79529 WP_010989088.1.79531 WP_010989088.1.79570 WP_010989088.1.79580 WP_010989088.1.79586 WP_010989088.1.79635 WP_010989088.1.7964 WP_010989088.1.79642 WP_010989088.1.79645 WP_010989088.1.79659 WP_010989088.1.79668 WP_010989088.1.79708 WP_010989088.1.7972 WP_010989088.1.79734 WP_010989088.1.79738 WP_010989088.1.7979 WP_010989088.1.7982 WP_010989088.1.79832 WP_010989088.1.79845 WP_010989088.1.79867 WP_010989088.1.79892 WP_010989088.1.7991 WP_010989088.1.79910 WP_010989088.1.79914 WP_010989088.1.79934 WP_010989088.1.7994 WP_010989088.1.79942 WP_010989088.1.79945 WP_010989088.1.79966 WP_010989088.1.79974 WP_010989088.1.79977 WP_010989088.1.79996 WP_010989088.1.80045 WP_010989088.1.80077 WP_010989088.1.80137 WP_010989088.1.80149 WP_010989088.1.80182 WP_010989088.1.80229 WP_010989088.1.8024 WP_010989088.1.80249 WP_010989088.1.80250 WP_010989088.1.80254 WP_010989088.1.80293 WP_010989088.1.80296 WP_010989088.1.80307 WP_010989088.1.80333 WP_010989088.1.80366 WP_010989088.1.80380 WP_010989088.1.80441 WP_010989088.1.80443 WP_010989088.1.80448 WP_010989088.1.80473 WP_010989088.1.80479 WP_010989088.1.80480 WP_010989088.1.80496 WP_010989088.1.80529 WP_010989088.1.80542 WP_010989088.1.80586 WP_010989088.1.80609 WP_010989088.1.80629 WP_010989088.1.80638 WP_010989088.1.80651 WP_010989088.1.80667 WP_010989088.1.80674 WP_010989088.1.80707 WP_010989088.1.80723 WP_010989088.1.80725 WP_010989088.1.80741 WP_010989088.1.80750 WP_010989088.1.80757 WP_010989088.1.80760 WP_010989088.1.80780 WP_010989088.1.80819 WP_010989088.1.80827 WP_010989088.1.80831 WP_010989088.1.80840 WP_010989088.1.80850 WP_010989088.1.80857 WP_010989088.1.80868 WP_010989088.1.80874 WP_010989088.1.80876 WP_010989088.1.80881 WP_010989088.1.80913 WP_010989088.1.80927 WP_010989088.1.80939 WP_010989088.1.80941 WP_010989088.1.80959 WP_010989088.1.8096 WP_010989088.1.80973 WP_010989088.1.81037 WP_010989088.1.81041 WP_010989088.1.8106 WP_010989088.1.81062 WP_010989088.1.81067 WP_010989088.1.81069 WP_010989088.1.81084 WP_010989088.1.81109 WP_010989088.1.81110 WP_010989088.1.81118 WP_010989088.1.81149 WP_010989088.1.81175 WP_010989088.1.8119 WP_010989088.1.81193 WP_010989088.1.81197 WP_010989088.1.81225 WP_010989088.1.81231 WP_010989088.1.8127 WP_010989088.1.81275 WP_010989088.1.8130 WP_010989088.1.81302 WP_010989088.1.81305 WP_010989088.1.81320 WP_010989088.1.81321 WP_010989088.1.81328 WP_010989088.1.8134 WP_010989088.1.81354 WP_010989088.1.81388 WP_010989088.1.81404 WP_010989088.1.81409 WP_010989088.1.81410 WP_010989088.1.81425 WP_010989088.1.81472 WP_010989088.1.81504 WP_010989088.1.81528 WP_010989088.1.81548 WP_010989088.1.81568 WP_010989088.1.81668 WP_010989088.1.8168 WP_010989088.1.81727 WP_010989088.1.81735 WP_010989088.1.81736 WP_010989088.1.81743 WP_010989088.1.81746 WP_010989088.1.81750 WP_010989088.1.81760 WP_010989088.1.81768 WP_010989088.1.81785 WP_010989088.1.81795 WP_010989088.1.81798 WP_010989088.1.81902 WP_010989088.1.81941 WP_010989088.1.8196 WP_010989088.1.81965 WP_010989088.1.81974 WP_010989088.1.81977 WP_010989088.1.81995 WP_010989088.1.82037 WP_010989088.1.82099 WP_010989088.1.82141 WP_010989088.1.82144 WP_010989088.1.82149 WP_010989088.1.82192 WP_010989088.1.82232 WP_010989088.1.82258 WP_010989088.1.82269 WP_010989088.1.82337 WP_010989088.1.82347 WP_010989088.1.8236 WP_010989088.1.82369 WP_010989088.1.82395 WP_010989088.1.82401 WP_010989088.1.82420 WP_010989088.1.82434 WP_010989088.1.82464 WP_010989088.1.8247 WP_010989088.1.82474 WP_010989088.1.82479 WP_010989088.1.82503 WP_010989088.1.82515 WP_010989088.1.82529 WP_010989088.1.82530 WP_010989088.1.82569 WP_010989088.1.82570 WP_010989088.1.82584 WP_010989088.1.82636 WP_010989088.1.82648 WP_010989088.1.82676 WP_010989088.1.82692 WP_010989088.1.82761 WP_010989088.1.82763 WP_010989088.1.8282 WP_010989088.1.82841 WP_010989088.1.82843 WP_010989088.1.82886 WP_010989088.1.82908 WP_010989088.1.82937 WP_010989088.1.82944 WP_010989088.1.82946 WP_010989088.1.82956 WP_010989088.1.82964 WP_010989088.1.83005 WP_010989088.1.83006 WP_010989088.1.83092 WP_010989088.1.83119 WP_010989088.1.83128 WP_010989088.1.83139 WP_010989088.1.83163 WP_010989088.1.83204 WP_010989088.1.8322 WP_010989088.1.83221 WP_010989088.1.83252 WP_010989088.1.83258 WP_010989088.1.83280 WP_010989088.1.83301 WP_010989088.1.83305 WP_010989088.1.83331 WP_010989088.1.83354 WP_010989088.1.83356 WP_010989088.1.83360 WP_010989088.1.83365 WP_010989088.1.83378 WP_010989088.1.83382 WP_010989088.1.83407 WP_010989088.1.83413 WP_010989088.1.83491 WP_010989088.1.83516 WP_010989088.1.83523 WP_010989088.1.8354 WP_010989088.1.83558 WP_010989088.1.83572 WP_010989088.1.83598 WP_010989088.1.83650 WP_010989088.1.83651 WP_010989088.1.83710 WP_010989088.1.83721 WP_010989088.1.83739 WP_010989088.1.83760 WP_010989088.1.83806 WP_010989088.1.83854 WP_010989088.1.83897 WP_010989088.1.83960 WP_010989088.1.83979 WP_010989088.1.8399 WP_010989088.1.84000 WP_010989088.1.84001 WP_010989088.1.84011 WP_010989088.1.84031 WP_010989088.1.84075 WP_010989088.1.84077 WP_010989088.1.84083 WP_010989088.1.84086 WP_010989088.1.84100 WP_010989088.1.84103 WP_010989088.1.84106 WP_010989088.1.84115 WP_010989088.1.84154 WP_010989088.1.84168 WP_010989088.1.84179 WP_010989088.1.84198 WP_010989088.1.84205 WP_010989088.1.84209 WP_010989088.1.84283 WP_010989088.1.84291 WP_010989088.1.84300 WP_010989088.1.84355 WP_010989088.1.84359 WP_010989088.1.84373 WP_010989088.1.84392 WP_010989088.1.84397 WP_010989088.1.84403 WP_010989088.1.8441 WP_010989088.1.84459 WP_010989088.1.84461 WP_010989088.1.84475 WP_010989088.1.84497 WP_010989088.1.84515 WP_010989088.1.84532 WP_010989088.1.84551 WP_010989088.1.84554 WP_010989088.1.84572 WP_010989088.1.84598 WP_010989088.1.84644 WP_010989088.1.84659 WP_010989088.1.84683 WP_010989088.1.84693 WP_010989088.1.84711 WP_010989088.1.84721 WP_010989088.1.84745 WP_010989088.1.84814 WP_010989088.1.84860 WP_010989088.1.84872 WP_010989088.1.84876 WP_010989088.1.84879 WP_010989088.1.84899 WP_010989088.1.849 WP_010989088.1.8497 WP_010989088.1.84983 WP_010989088.1.85014 WP_010989088.1.85040 WP_010989088.1.85079 WP_010989088.1.85094 WP_010989088.1.85134 WP_010989088.1.85147 WP_010989088.1.85178 WP_010989088.1.85180 WP_010989088.1.85190 WP_010989088.1.85192 WP_010989088.1.85217 WP_010989088.1.8526 WP_010989088.1.85271 WP_010989088.1.85301 WP_010989088.1.8533 WP_010989088.1.8537 WP_010989088.1.85408 WP_010989088.1.85433 WP_010989088.1.8545 WP_010989088.1.85456 WP_010989088.1.85469 WP_010989088.1.85481 WP_010989088.1.85483 WP_010989088.1.85541 WP_010989088.1.8556 WP_010989088.1.85568 WP_010989088.1.85615 WP_010989088.1.85617 WP_010989088.1.85654 WP_010989088.1.85663 WP_010989088.1.85671 WP_010989088.1.85672 WP_010989088.1.85675 WP_010989088.1.85723 WP_010989088.1.85742 WP_010989088.1.85759 WP_010989088.1.85777 WP_010989088.1.85780 WP_010989088.1.85784 WP_010989088.1.85797 WP_010989088.1.85854 WP_010989088.1.85855 WP_010989088.1.85864 WP_010989088.1.85886 WP_010989088.1.85900 WP_010989088.1.85904 WP_010989088.1.8591 WP_010989088.1.85943 WP_010989088.1.85976 WP_010989088.1.85982 WP_010989088.1.86007 WP_010989088.1.86010 WP_010989088.1.86017 WP_010989088.1.86043 WP_010989088.1.86092 WP_010989088.1.86126 WP_010989088.1.86138 WP_010989088.1.86157 WP_010989088.1.8616 WP_010989088.1.86173 WP_010989088.1.86206 WP_010989088.1.86224 WP_010989088.1.86240 WP_010989088.1.86259 WP_010989088.1.86284 WP_010989088.1.86285 WP_010989088.1.86306 WP_010989088.1.86310 WP_010989088.1.86335 WP_010989088.1.86347 WP_010989088.1.86356 WP_010989088.1.86380 WP_010989088.1.86389 WP_010989088.1.86442 WP_010989088.1.86450 WP_010989088.1.86453 WP_010989088.1.86466 WP_010989088.1.86469 WP_010989088.1.8647 WP_010989088.1.86514 WP_010989088.1.86580 WP_010989088.1.86588 WP_010989088.1.86593 WP_010989088.1.86601 WP_010989088.1.86610 WP_010989088.1.86634 WP_010989088.1.86656 WP_010989088.1.86658 WP_010989088.1.86661 WP_010989088.1.86676 WP_010989088.1.86699 WP_010989088.1.8671 WP_010989088.1.8672 WP_010989088.1.86735 WP_010989088.1.86744 WP_010989088.1.8678 WP_010989088.1.86807 WP_010989088.1.86810 WP_010989088.1.8684 WP_010989088.1.86859 WP_010989088.1.86860 WP_010989088.1.86895 WP_010989088.1.86902 WP_010989088.1.86906 WP_010989088.1.8691 WP_010989088.1.86915 WP_010989088.1.87038 WP_010989088.1.87051 WP_010989088.1.87095 WP_010989088.1.87143 WP_010989088.1.87148 WP_010989088.1.87187 WP_010989088.1.8722 WP_010989088.1.87220 WP_010989088.1.87265 WP_010989088.1.87276 WP_010989088.1.87282 WP_010989088.1.87283 WP_010989088.1.87323 WP_010989088.1.8736 WP_010989088.1.87365 WP_010989088.1.87376 WP_010989088.1.87460 WP_010989088.1.87484 WP_010989088.1.87493 WP_010989088.1.87500 WP_010989088.1.87552 WP_010989088.1.87583 WP_010989088.1.87584 WP_010989088.1.87618 WP_010989088.1.87626 WP_010989088.1.87651 WP_010989088.1.8767 WP_010989088.1.87687 WP_010989088.1.87695 WP_010989088.1.87712 WP_010989088.1.87779 WP_010989088.1.87813 WP_010989088.1.87875 WP_010989088.1.87891 WP_010989088.1.87899 WP_010989088.1.8792 WP_010989088.1.87933 WP_010989088.1.87936 WP_010989088.1.87945 WP_010989088.1.87999 WP_010989088.1.8800 WP_010989088.1.88014 WP_010989088.1.88019 WP_010989088.1.88052 WP_010989088.1.88073 WP_010989088.1.8809 WP_010989088.1.88092 WP_010989088.1.88136 WP_010989088.1.88165 WP_010989088.1.88174 WP_010989088.1.88185 WP_010989088.1.88214 WP_010989088.1.88222 WP_010989088.1.88244 WP_010989088.1.88264 WP_010989088.1.88275 WP_010989088.1.88291 WP_010989088.1.88293 WP_010989088.1.88303 WP_010989088.1.88356 WP_010989088.1.8837 WP_010989088.1.88393 WP_010989088.1.88423 WP_010989088.1.88474 WP_010989088.1.88483 WP_010989088.1.8849 WP_010989088.1.88508 WP_010989088.1.88597 WP_010989088.1.88609 WP_010989088.1.88620 WP_010989088.1.88624 WP_010989088.1.88651 WP_010989088.1.88675 WP_010989088.1.88683 WP_010989088.1.88698 WP_010989088.1.88703 WP_010989088.1.88731 WP_010989088.1.88762 WP_010989088.1.88776 WP_010989088.1.88792 WP_010989088.1.88817 WP_010989088.1.88845 WP_010989088.1.88902 WP_010989088.1.8891 WP_010989088.1.88942 WP_010989088.1.88957 WP_010989088.1.88966 WP_010989088.1.88967 WP_010989088.1.88968 WP_010989088.1.88970 WP_010989088.1.88980 WP_010989088.1.88981 WP_010989088.1.88995 WP_010989088.1.88998 WP_010989088.1.89008 WP_010989088.1.89054 WP_010989088.1.89114 WP_010989088.1.89116 WP_010989088.1.89119 WP_010989088.1.89120 WP_010989088.1.89138 WP_010989088.1.89174 WP_010989088.1.89177 WP_010989088.1.89188 WP_010989088.1.89215 WP_010989088.1.89221 WP_010989088.1.89291 WP_010989088.1.89304 WP_010989088.1.89311 WP_010989088.1.89354 WP_010989088.1.89362 WP_010989088.1.89408 WP_010989088.1.89425 WP_010989088.1.89452 WP_010989088.1.89462 WP_010989088.1.89512 WP_010989088.1.89527 WP_010989088.1.89570 WP_010989088.1.8958 WP_010989088.1.89604 WP_010989088.1.89606 WP_010989088.1.8961 WP_010989088.1.89622 WP_010989088.1.89632 WP_010989088.1.89634 WP_010989088.1.89647 WP_010989088.1.89657 WP_010989088.1.89659 WP_010989088.1.89680 WP_010989088.1.89746 WP_010989088.1.89764 WP_010989088.1.89765 WP_010989088.1.89777 WP_010989088.1.89789 WP_010989088.1.89815 WP_010989088.1.89817 WP_010989088.1.89832 WP_010989088.1.89870 WP_010989088.1.89902 WP_010989088.1.89914 WP_010989088.1.8996 WP_010989088.1.89965 WP_010989088.1.89975 WP_010989088.1.9002 WP_010989088.1.9003 WP_010989088.1.90033 WP_010989088.1.90084 WP_010989088.1.90097 WP_010989088.1.90193 WP_010989088.1.90211 WP_010989088.1.90220 WP_010989088.1.90252 WP_010989088.1.90293 WP_010989088.1.90311 WP_010989088.1.90348 WP_010989088.1.90363 WP_010989088.1.90417 WP_010989088.1.90421 WP_010989088.1.90440 WP_010989088.1.90453 WP_010989088.1.90458 WP_010989088.1.90472 WP_010989088.1.90521 WP_010989088.1.90522 WP_010989088.1.90540 WP_010989088.1.90557 WP_010989088.1.90563 WP_010989088.1.90566 WP_010989088.1.90585 WP_010989088.1.90620 WP_010989088.1.9064 WP_010989088.1.90641 WP_010989088.1.90686 WP_010989088.1.90734 WP_010989088.1.90748 WP_010989088.1.90759 WP_010989088.1.90792 WP_010989088.1.90814 WP_010989088.1.90859 WP_010989088.1.90876 WP_010989088.1.90878 WP_010989088.1.9089 WP_010989088.1.9093 WP_010989088.1.90959 WP_010989088.1.90973 WP_010989088.1.90983 WP_010989088.1.90984 WP_010989088.1.90991 WP_010989088.1.91003 WP_010989088.1.91049 WP_010989088.1.91056 WP_010989088.1.91069 WP_010989088.1.91107 WP_010989088.1.91156 WP_010989088.1.91179 WP_010989088.1.91189 WP_010989088.1.91215 WP_010989088.1.91278 WP_010989088.1.91282 WP_010989088.1.9131 WP_010989088.1.91312 WP_010989088.1.91331 WP_010989088.1.91334 WP_010989088.1.9137 WP_010989088.1.91372 WP_010989088.1.91381 WP_010989088.1.91405 WP_010989088.1.91424 WP_010989088.1.91459 WP_010989088.1.91470 WP_010989088.1.91474 WP_010989088.1.91493 WP_010989088.1.91505 WP_010989088.1.91512 WP_010989088.1.91524 WP_010989088.1.91528 WP_010989088.1.91536 WP_010989088.1.91564 WP_010989088.1.91580 WP_010989088.1.91621 WP_010989088.1.91625 WP_010989088.1.91628 WP_010989088.1.91655 WP_010989088.1.9166 WP_010989088.1.91702 WP_010989088.1.91724 WP_010989088.1.91732 WP_010989088.1.91736 WP_010989088.1.91742 WP_010989088.1.91772 WP_010989088.1.91776 WP_010989088.1.91788 WP_010989088.1.91795 WP_010989088.1.91806 WP_010989088.1.91864 WP_010989088.1.91880 WP_010989088.1.91898 WP_010989088.1.91903 WP_010989088.1.91904 WP_010989088.1.91914 WP_010989088.1.91974 WP_010989088.1.91984 WP_010989088.1.92013 WP_010989088.1.92039 WP_010989088.1.92044 WP_010989088.1.92060 WP_010989088.1.92067 WP_010989088.1.92068 WP_010989088.1.92082 WP_010989088.1.92093 WP_010989088.1.92099 WP_010989088.1.92108 WP_010989088.1.92122 WP_010989088.1.92129 WP_010989088.1.92165 WP_010989088.1.92171 WP_010989088.1.92183 WP_010989088.1.92208 WP_010989088.1.92213 WP_010989088.1.9222 WP_010989088.1.92268 WP_010989088.1.92270 WP_010989088.1.92299 WP_010989088.1.92310 WP_010989088.1.92318 WP_010989088.1.92375 WP_010989088.1.92394 WP_010989088.1.92399 WP_010989088.1.92408 WP_010989088.1.92411 WP_010989088.1.92443 WP_010989088.1.92452 WP_010989088.1.92482 WP_010989088.1.92529 WP_010989088.1.9253 WP_010989088.1.92531 WP_010989088.1.92557 WP_010989088.1.92562 WP_010989088.1.92575 WP_010989088.1.92628 WP_010989088.1.92646 WP_010989088.1.92659 WP_010989088.1.92669 WP_010989088.1.92671 WP_010989088.1.92729 WP_010989088.1.92738 WP_010989088.1.92758 WP_010989088.1.92786 WP_010989088.1.92806 WP_010989088.1.92827 WP_010989088.1.92832 WP_010989088.1.92836 WP_010989088.1.92843 WP_010989088.1.92875 WP_010989088.1.92879 WP_010989088.1.92890 WP_010989088.1.92893 WP_010989088.1.92895 WP_010989088.1.92926 WP_010989088.1.92929 WP_010989088.1.92936 WP_010989088.1.92939 WP_010989088.1.92947 WP_010989088.1.92975 WP_010989088.1.92988 WP_010989088.1.93059 WP_010989088.1.93061 WP_010989088.1.93076 WP_010989088.1.93086 WP_010989088.1.93101 WP_010989088.1.93118 WP_010989088.1.93136 WP_010989088.1.93155 WP_010989088.1.93213 WP_010989088.1.93215 WP_010989088.1.93275 WP_010989088.1.93322 WP_010989088.1.93339 WP_010989088.1.93350 WP_010989088.1.93365 WP_010989088.1.93376 WP_010989088.1.93524 WP_010989088.1.93543 WP_010989088.1.93577 WP_010989088.1.93604 WP_010989088.1.93648 WP_010989088.1.93650 WP_010989088.1.93656 WP_010989088.1.93662 WP_010989088.1.93671 WP_010989088.1.93691 WP_010989088.1.937 WP_010989088.1.93705 WP_010989088.1.93741 WP_010989088.1.93767 WP_010989088.1.9380 WP_010989088.1.93803 WP_010989088.1.93804 WP_010989088.1.93809 WP_010989088.1.93837 WP_010989088.1.9389 WP_010989088.1.93937 WP_010989088.1.93956 WP_010989088.1.93986 WP_010989088.1.93994 WP_010989088.1.94039 WP_010989088.1.94056 WP_010989088.1.94064 WP_010989088.1.94070 WP_010989088.1.94071 WP_010989088.1.94072 WP_010989088.1.94132 WP_010989088.1.94162 WP_010989088.1.94167 WP_010989088.1.94168 WP_010989088.1.94181 WP_010989088.1.94198 WP_010989088.1.9432 WP_010989088.1.94352 WP_010989088.1.94354 WP_010989088.1.94379 WP_010989088.1.94380 WP_010989088.1.94383 WP_010989088.1.9440 WP_010989088.1.94412 WP_010989088.1.94458 WP_010989088.1.94473 WP_010989088.1.94557 WP_010989088.1.94562 WP_010989088.1.94565 WP_010989088.1.94584 WP_010989088.1.94588 WP_010989088.1.94598 WP_010989088.1.94622 WP_010989088.1.9463 WP_010989088.1.94649 WP_010989088.1.94655 WP_010989088.1.94669 WP_010989088.1.94670 WP_010989088.1.94674 WP_010989088.1.94717 WP_010989088.1.94722 WP_010989088.1.94785 WP_010989088.1.94796 WP_010989088.1.9481 WP_010989088.1.94835 WP_010989088.1.94849 WP_010989088.1.94862 WP_010989088.1.94947 WP_010989088.1.94959 WP_010989088.1.94967 WP_010989088.1.94982 WP_010989088.1.94983 WP_010989088.1.94986 WP_010989088.1.94987 WP_010989088.1.9503 WP_010989088.1.95051 WP_010989088.1.95085 WP_010989088.1.95094 WP_010989088.1.95121 WP_010989088.1.95133 WP_010989088.1.95136 WP_010989088.1.95152 WP_010989088.1.95171 WP_010989088.1.95235 WP_010989088.1.95248 WP_010989088.1.95249 WP_010989088.1.9527 WP_010989088.1.95277 WP_010989088.1.95282 WP_010989088.1.95289 WP_010989088.1.95298 WP_010989088.1.9530 WP_010989088.1.95320 WP_010989088.1.95388 WP_010989088.1.95404 WP_010989088.1.95434 WP_010989088.1.95447 WP_010989088.1.95456 WP_010989088.1.95465 WP_010989088.1.95546 WP_010989088.1.95579 WP_010989088.1.95607 WP_010989088.1.95623 WP_010989088.1.95630 WP_010989088.1.95641 WP_010989088.1.95656 WP_010989088.1.95670 WP_010989088.1.95691 WP_010989088.1.95701 WP_010989088.1.95703 WP_010989088.1.95729 WP_010989088.1.9574 WP_010989088.1.95744 WP_010989088.1.95757 WP_010989088.1.95805 WP_010989088.1.95826 WP_010989088.1.95840 WP_010989088.1.9586 WP_010989088.1.95866 WP_010989088.1.95901 WP_010989088.1.95911 WP_010989088.1.95939 WP_010989088.1.95940 WP_010989088.1.95963 WP_010989088.1.96004 WP_010989088.1.96042 WP_010989088.1.96045 WP_010989088.1.9609 WP_010989088.1.96107 WP_010989088.1.96139 WP_010989088.1.96162 WP_010989088.1.96172 WP_010989088.1.96190 WP_010989088.1.96203 WP_010989088.1.96206 WP_010989088.1.9624 WP_010989088.1.96260 WP_010989088.1.9627 WP_010989088.1.9628 WP_010989088.1.96317 WP_010989088.1.96335 WP_010989088.1.96343 WP_010989088.1.96348 WP_010989088.1.96349 WP_010989088.1.96380 WP_010989088.1.96404 WP_010989088.1.96429 WP_010989088.1.9644 WP_010989088.1.96469 WP_010989088.1.96490 WP_010989088.1.96497 WP_010989088.1.96500 WP_010989088.1.96521 WP_010989088.1.96533 WP_010989088.1.96537 WP_010989088.1.96555 WP_010989088.1.96563 WP_010989088.1.96588 WP_010989088.1.96590 WP_010989088.1.96600 WP_010989088.1.96640 WP_010989088.1.96642 WP_010989088.1.96662 WP_010989088.1.96721 WP_010989088.1.96731 WP_010989088.1.96732 WP_010989088.1.96735 WP_010989088.1.9674 WP_010989088.1.96758 WP_010989088.1.96761 WP_010989088.1.96771 WP_010989088.1.96810 WP_010989088.1.9686 WP_010989088.1.96876 WP_010989088.1.96890 WP_010989088.1.96902 WP_010989088.1.96917 WP_010989088.1.96993 WP_010989088.1.97005 WP_010989088.1.97015 WP_010989088.1.97043 WP_010989088.1.97047 WP_010989088.1.97089 WP_010989088.1.97103 WP_010989088.1.97109 WP_010989088.1.97143 WP_010989088.1.97145 WP_010989088.1.97185 WP_010989088.1.97190 WP_010989088.1.97224 WP_010989088.1.97297 WP_010989088.1.97318 WP_010989088.1.97322 WP_010989088.1.97328 WP_010989088.1.97337 WP_010989088.1.97368 WP_010989088.1.97369 WP_010989088.1.97386 WP_010989088.1.97413 WP_010989088.1.97477 WP_010989088.1.97480 WP_010989088.1.97487 WP_010989088.1.97496 WP_010989088.1.97534 WP_010989088.1.97547 WP_010989088.1.97594 WP_010989088.1.97597 WP_010989088.1.97613 WP_010989088.1.97620 WP_010989088.1.97626 WP_010989088.1.97628 WP_010989088.1.97631 WP_010989088.1.97640 WP_010989088.1.97648 WP_010989088.1.97656 WP_010989088.1.97691 WP_010989088.1.97693 WP_010989088.1.97704 WP_010989088.1.97725 WP_010989088.1.97726 WP_010989088.1.97727 WP_010989088.1.97732 WP_010989088.1.97736 WP_010989088.1.9774 WP_010989088.1.9775 WP_010989088.1.97768 WP_010989088.1.97772 WP_010989088.1.97846 WP_010989088.1.97873 WP_010989088.1.9793 WP_010989088.1.97981 WP_010989088.1.97983 WP_010989088.1.9799 WP_010989088.1.97991 WP_010989088.1.98006 WP_010989088.1.98019 WP_010989088.1.98022 WP_010989088.1.9805 WP_010989088.1.98107 WP_010989088.1.9811 WP_010989088.1.98110 WP_010989088.1.98119 WP_010989088.1.98124 WP_010989088.1.98146 WP_010989088.1.98170 WP_010989088.1.98201 WP_010989088.1.98219 WP_010989088.1.98250 WP_010989088.1.9826 WP_010989088.1.98314 WP_010989088.1.98338 WP_010989088.1.98392 WP_010989088.1.98402 WP_010989088.1.9841 WP_010989088.1.98438 WP_010989088.1.98440 WP_010989088.1.98446 WP_010989088.1.98472 WP_010989088.1.98495 WP_010989088.1.98531 WP_010989088.1.98551 WP_010989088.1.98570 WP_010989088.1.98577 WP_010989088.1.98608 WP_010989088.1.98627 WP_010989088.1.9863 WP_010989088.1.98634 WP_010989088.1.98676 WP_010989088.1.98677 WP_010989088.1.98726 WP_010989088.1.98751 WP_010989088.1.98760 WP_010989088.1.98779 WP_010989088.1.98843 WP_010989088.1.9887 WP_010989088.1.98899 WP_010989088.1.98931 WP_010989088.1.98947 WP_010989088.1.9898 WP_010989088.1.9899 WP_010989088.1.99040 WP_010989088.1.99057 WP_010989088.1.99071 WP_010989088.1.99072 WP_010989088.1.99073 WP_010989088.1.99083 WP_010989088.1.99097 WP_010989088.1.99098 WP_010989088.1.99107 WP_010989088.1.99164 WP_010989088.1.99184 WP_010989088.1.9919 WP_010989088.1.99197 WP_010989088.1.99198 WP_010989088.1.99215 WP_010989088.1.99219 WP_010989088.1.99255 WP_010989088.1.99267 WP_010989088.1.99276 WP_010989088.1.99278 WP_010989088.1.99327 WP_010989088.1.99339 WP_010989088.1.99370 WP_010989088.1.99426 WP_010989088.1.99456 WP_010989088.1.99490 WP_010989088.1.99493 WP_010989088.1.99531 WP_010989088.1.9954 WP_010989088.1.99561 WP_010989088.1.99613 WP_010989088.1.99626 WP_010989088.1.99630 WP_010989088.1.99646 WP_010989088.1.99657 WP_010989088.1.99660 WP_010989088.1.99712 WP_010989088.1.99747 WP_010989088.1.99783 WP_010989088.1.99813 WP_010989088.1.99824 WP_010989088.1.99858 WP_010989088.1.99889 WP_010989088.1.99924 WP_010989088.1.99958 WP_010989088.1.99961 gi|378452954|ref|YP_005240314.1| gi|378447380|ref|YP_005235012.1| AE006468|CDS_4252841-4253407 AM933172|CDS_4121623-4122189 CP000026|CDS_4030878-4031444 CP001363|CDS_4266425-4266991 FM200053|CDS_4026562-4027128 FN424405|CDS_4275596-4276162 gi|56415888|ref|YP_152963.1| gi|378991324|ref|YP_005254488.1| 295319.SPA3885 550537.SEN3833 554290.SSPA3613 99287.STM4042A gi|16767308|ref|NP_462923.1| gi|549726569|ref|YP_008646759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]