SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452963|ref|YP_005240323.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452963|ref|YP_005240323.1|
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000000000729
Family TM1287-like 0.076
Further Details:      
 
Domain Number 2 Region: 228-276
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000291
Family AraC type transcriptional activator 0.032
Further Details:      
 
Weak hits

Sequence:  gi|378452963|ref|YP_005240323.1|
Domain Number - Region: 177-227
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000309
Family AraC type transcriptional activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378452963|ref|YP_005240323.1|
Sequence length 282
Comment transcriptional activator RhaR [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MANQLILLKKDFFTDEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRI
TRGDLFYIRAEDKHSYTSVNDLVLQNIIYCPERLKLNVNWQAMIPGFQGAQWHPHWRLGS
MGMNQARQVINQLEHESNGRDPLANEMAELLFGQLVMTLKRHRYATDDLPATSRETLLDK
LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHS
PLMISEISMQCGFEDSNYFSVVFTRETGMTPSQWRHLSNQSD
Download sequence
Identical sequences A0A0D6IQ91 A0A0F6B9M5 A0A0F7JDS9 A0A0M0Q2R8 A0A0R9Q5G7 A0A0U1IM33 A0A1R2JCY6 A0A221Z6B2 A0A249V4H5 A0A271D0X2 A0A2C6G0T0 A0A2D1XJI7 A0A2G1P715 A0A2I6PAK2 A9MZC9 B4SZZ4 B5BJG9 B5QWY5 G5NKR7 G5RN88 P40865 Q5PKG1 S4I2V5 V7UQB5
gi|194444761|ref|YP_002043270.1| gi|528821393|ref|YP_008362596.1| gi|16767315|ref|NP_462930.1| gi|482906599|ref|YP_007905159.1| gi|161617175|ref|YP_001591140.1| gi|378991331|ref|YP_005254495.1| NP_462930.1.58477 WP_000013290.1.100010 WP_000013290.1.100077 WP_000013290.1.100129 WP_000013290.1.100149 WP_000013290.1.100191 WP_000013290.1.100234 WP_000013290.1.100258 WP_000013290.1.100266 WP_000013290.1.100376 WP_000013290.1.100392 WP_000013290.1.100412 WP_000013290.1.100413 WP_000013290.1.100424 WP_000013290.1.100436 WP_000013290.1.100438 WP_000013290.1.100457 WP_000013290.1.100484 WP_000013290.1.100488 WP_000013290.1.100502 WP_000013290.1.100519 WP_000013290.1.100557 WP_000013290.1.100589 WP_000013290.1.100597 WP_000013290.1.100605 WP_000013290.1.100711 WP_000013290.1.10076 WP_000013290.1.100773 WP_000013290.1.100776 WP_000013290.1.100781 WP_000013290.1.100793 WP_000013290.1.10081 WP_000013290.1.100857 WP_000013290.1.100869 WP_000013290.1.100871 WP_000013290.1.100882 WP_000013290.1.100895 WP_000013290.1.100948 WP_000013290.1.101007 WP_000013290.1.101020 WP_000013290.1.101042 WP_000013290.1.101074 WP_000013290.1.101078 WP_000013290.1.101091 WP_000013290.1.101111 WP_000013290.1.101112 WP_000013290.1.101123 WP_000013290.1.101180 WP_000013290.1.101185 WP_000013290.1.101239 WP_000013290.1.101259 WP_000013290.1.101284 WP_000013290.1.101291 WP_000013290.1.101320 WP_000013290.1.101353 WP_000013290.1.101386 WP_000013290.1.101404 WP_000013290.1.101420 WP_000013290.1.101541 WP_000013290.1.101589 WP_000013290.1.101609 WP_000013290.1.101634 WP_000013290.1.101674 WP_000013290.1.101707 WP_000013290.1.101724 WP_000013290.1.101734 WP_000013290.1.101741 WP_000013290.1.101815 WP_000013290.1.101832 WP_000013290.1.101841 WP_000013290.1.101878 WP_000013290.1.101904 WP_000013290.1.10191 WP_000013290.1.101917 WP_000013290.1.101953 WP_000013290.1.102009 WP_000013290.1.102103 WP_000013290.1.102111 WP_000013290.1.10220 WP_000013290.1.10237 WP_000013290.1.10266 WP_000013290.1.10300 WP_000013290.1.10429 WP_000013290.1.10439 WP_000013290.1.10463 WP_000013290.1.10465 WP_000013290.1.10498 WP_000013290.1.10521 WP_000013290.1.10631 WP_000013290.1.10675 WP_000013290.1.10678 WP_000013290.1.10753 WP_000013290.1.10755 WP_000013290.1.10868 WP_000013290.1.10898 WP_000013290.1.10992 WP_000013290.1.11000 WP_000013290.1.11024 WP_000013290.1.11031 WP_000013290.1.11098 WP_000013290.1.11119 WP_000013290.1.11168 WP_000013290.1.11190 WP_000013290.1.11216 WP_000013290.1.11254 WP_000013290.1.11295 WP_000013290.1.1135 WP_000013290.1.1137 WP_000013290.1.11405 WP_000013290.1.11455 WP_000013290.1.11458 WP_000013290.1.1150 WP_000013290.1.11518 WP_000013290.1.11526 WP_000013290.1.11528 WP_000013290.1.11532 WP_000013290.1.11543 WP_000013290.1.11544 WP_000013290.1.1156 WP_000013290.1.1169 WP_000013290.1.1174 WP_000013290.1.11763 WP_000013290.1.11772 WP_000013290.1.11810 WP_000013290.1.11824 WP_000013290.1.11841 WP_000013290.1.11865 WP_000013290.1.11875 WP_000013290.1.11897 WP_000013290.1.11900 WP_000013290.1.11936 WP_000013290.1.11978 WP_000013290.1.12025 WP_000013290.1.12027 WP_000013290.1.12106 WP_000013290.1.1215 WP_000013290.1.12160 WP_000013290.1.12168 WP_000013290.1.12210 WP_000013290.1.12308 WP_000013290.1.12340 WP_000013290.1.12351 WP_000013290.1.12370 WP_000013290.1.12374 WP_000013290.1.12397 WP_000013290.1.12456 WP_000013290.1.12484 WP_000013290.1.12485 WP_000013290.1.12546 WP_000013290.1.12568 WP_000013290.1.12569 WP_000013290.1.12585 WP_000013290.1.1264 WP_000013290.1.12696 WP_000013290.1.12718 WP_000013290.1.12728 WP_000013290.1.12865 WP_000013290.1.12879 WP_000013290.1.12936 WP_000013290.1.12995 WP_000013290.1.1300 WP_000013290.1.13027 WP_000013290.1.13076 WP_000013290.1.13102 WP_000013290.1.13106 WP_000013290.1.13130 WP_000013290.1.13247 WP_000013290.1.1326 WP_000013290.1.13262 WP_000013290.1.13274 WP_000013290.1.13311 WP_000013290.1.13334 WP_000013290.1.13367 WP_000013290.1.13391 WP_000013290.1.13414 WP_000013290.1.1346 WP_000013290.1.13488 WP_000013290.1.13509 WP_000013290.1.13573 WP_000013290.1.13602 WP_000013290.1.13625 WP_000013290.1.13669 WP_000013290.1.13741 WP_000013290.1.13750 WP_000013290.1.13819 WP_000013290.1.1387 WP_000013290.1.13908 WP_000013290.1.13932 WP_000013290.1.13967 WP_000013290.1.13968 WP_000013290.1.14001 WP_000013290.1.14041 WP_000013290.1.1412 WP_000013290.1.14151 WP_000013290.1.14320 WP_000013290.1.14379 WP_000013290.1.14406 WP_000013290.1.14410 WP_000013290.1.14446 WP_000013290.1.14466 WP_000013290.1.14519 WP_000013290.1.14524 WP_000013290.1.14554 WP_000013290.1.146 WP_000013290.1.14706 WP_000013290.1.14708 WP_000013290.1.14725 WP_000013290.1.14737 WP_000013290.1.14789 WP_000013290.1.14793 WP_000013290.1.14819 WP_000013290.1.14852 WP_000013290.1.14913 WP_000013290.1.14932 WP_000013290.1.15011 WP_000013290.1.15055 WP_000013290.1.15059 WP_000013290.1.15067 WP_000013290.1.15079 WP_000013290.1.15100 WP_000013290.1.15102 WP_000013290.1.15124 WP_000013290.1.15223 WP_000013290.1.15226 WP_000013290.1.15276 WP_000013290.1.15316 WP_000013290.1.15318 WP_000013290.1.15369 WP_000013290.1.1540 WP_000013290.1.15483 WP_000013290.1.15508 WP_000013290.1.1551 WP_000013290.1.15585 WP_000013290.1.15586 WP_000013290.1.15625 WP_000013290.1.15644 WP_000013290.1.1568 WP_000013290.1.15708 WP_000013290.1.15775 WP_000013290.1.15777 WP_000013290.1.15784 WP_000013290.1.158 WP_000013290.1.15830 WP_000013290.1.15881 WP_000013290.1.15909 WP_000013290.1.1592 WP_000013290.1.15938 WP_000013290.1.1601 WP_000013290.1.16062 WP_000013290.1.16063 WP_000013290.1.16103 WP_000013290.1.16166 WP_000013290.1.16172 WP_000013290.1.16226 WP_000013290.1.16233 WP_000013290.1.16244 WP_000013290.1.16284 WP_000013290.1.16328 WP_000013290.1.16331 WP_000013290.1.1635 WP_000013290.1.16363 WP_000013290.1.16365 WP_000013290.1.16366 WP_000013290.1.16394 WP_000013290.1.16453 WP_000013290.1.16468 WP_000013290.1.16474 WP_000013290.1.16508 WP_000013290.1.16565 WP_000013290.1.16581 WP_000013290.1.16614 WP_000013290.1.16650 WP_000013290.1.1668 WP_000013290.1.16686 WP_000013290.1.16691 WP_000013290.1.167 WP_000013290.1.16710 WP_000013290.1.16729 WP_000013290.1.16732 WP_000013290.1.16735 WP_000013290.1.16736 WP_000013290.1.16786 WP_000013290.1.16858 WP_000013290.1.1689 WP_000013290.1.16896 WP_000013290.1.16916 WP_000013290.1.16941 WP_000013290.1.16949 WP_000013290.1.16965 WP_000013290.1.16972 WP_000013290.1.1700 WP_000013290.1.17060 WP_000013290.1.17096 WP_000013290.1.17098 WP_000013290.1.17105 WP_000013290.1.17285 WP_000013290.1.17307 WP_000013290.1.1733 WP_000013290.1.174 WP_000013290.1.17439 WP_000013290.1.17447 WP_000013290.1.17480 WP_000013290.1.17482 WP_000013290.1.17504 WP_000013290.1.17525 WP_000013290.1.17546 WP_000013290.1.17560 WP_000013290.1.17583 WP_000013290.1.17629 WP_000013290.1.17693 WP_000013290.1.17702 WP_000013290.1.17703 WP_000013290.1.17705 WP_000013290.1.17732 WP_000013290.1.17747 WP_000013290.1.17755 WP_000013290.1.17865 WP_000013290.1.17886 WP_000013290.1.17901 WP_000013290.1.17914 WP_000013290.1.17936 WP_000013290.1.17991 WP_000013290.1.18019 WP_000013290.1.18056 WP_000013290.1.18061 WP_000013290.1.1807 WP_000013290.1.18089 WP_000013290.1.18092 WP_000013290.1.18111 WP_000013290.1.18149 WP_000013290.1.18163 WP_000013290.1.18192 WP_000013290.1.18249 WP_000013290.1.18265 WP_000013290.1.18267 WP_000013290.1.18281 WP_000013290.1.18282 WP_000013290.1.18355 WP_000013290.1.18384 WP_000013290.1.18468 WP_000013290.1.18607 WP_000013290.1.18641 WP_000013290.1.18686 WP_000013290.1.18692 WP_000013290.1.18705 WP_000013290.1.18715 WP_000013290.1.18737 WP_000013290.1.18776 WP_000013290.1.18822 WP_000013290.1.18847 WP_000013290.1.18881 WP_000013290.1.18886 WP_000013290.1.18940 WP_000013290.1.18949 WP_000013290.1.1895 WP_000013290.1.1897 WP_000013290.1.19030 WP_000013290.1.19053 WP_000013290.1.19055 WP_000013290.1.19093 WP_000013290.1.19240 WP_000013290.1.19320 WP_000013290.1.19357 WP_000013290.1.19373 WP_000013290.1.19433 WP_000013290.1.19458 WP_000013290.1.19460 WP_000013290.1.19461 WP_000013290.1.1955 WP_000013290.1.19614 WP_000013290.1.19642 WP_000013290.1.19656 WP_000013290.1.19702 WP_000013290.1.19706 WP_000013290.1.19723 WP_000013290.1.19724 WP_000013290.1.19784 WP_000013290.1.19809 WP_000013290.1.19823 WP_000013290.1.19834 WP_000013290.1.19882 WP_000013290.1.1990 WP_000013290.1.1998 WP_000013290.1.20 WP_000013290.1.2010 WP_000013290.1.20212 WP_000013290.1.20261 WP_000013290.1.20266 WP_000013290.1.20271 WP_000013290.1.20330 WP_000013290.1.2036 WP_000013290.1.20362 WP_000013290.1.20391 WP_000013290.1.2041 WP_000013290.1.20418 WP_000013290.1.20425 WP_000013290.1.20437 WP_000013290.1.20443 WP_000013290.1.20503 WP_000013290.1.20525 WP_000013290.1.2054 WP_000013290.1.20553 WP_000013290.1.20564 WP_000013290.1.20573 WP_000013290.1.20626 WP_000013290.1.20631 WP_000013290.1.20646 WP_000013290.1.20695 WP_000013290.1.20839 WP_000013290.1.20886 WP_000013290.1.2101 WP_000013290.1.21049 WP_000013290.1.2107 WP_000013290.1.21079 WP_000013290.1.21086 WP_000013290.1.21089 WP_000013290.1.21103 WP_000013290.1.21146 WP_000013290.1.2116 WP_000013290.1.21165 WP_000013290.1.21194 WP_000013290.1.21202 WP_000013290.1.21241 WP_000013290.1.21245 WP_000013290.1.21246 WP_000013290.1.21269 WP_000013290.1.21309 WP_000013290.1.21326 WP_000013290.1.21332 WP_000013290.1.2139 WP_000013290.1.21400 WP_000013290.1.21453 WP_000013290.1.21497 WP_000013290.1.21499 WP_000013290.1.21534 WP_000013290.1.21548 WP_000013290.1.21603 WP_000013290.1.21681 WP_000013290.1.21692 WP_000013290.1.21715 WP_000013290.1.21750 WP_000013290.1.21751 WP_000013290.1.21757 WP_000013290.1.21792 WP_000013290.1.21825 WP_000013290.1.21886 WP_000013290.1.21909 WP_000013290.1.21950 WP_000013290.1.21981 WP_000013290.1.22024 WP_000013290.1.2205 WP_000013290.1.22051 WP_000013290.1.22062 WP_000013290.1.22067 WP_000013290.1.22096 WP_000013290.1.22136 WP_000013290.1.22158 WP_000013290.1.22162 WP_000013290.1.22169 WP_000013290.1.2221 WP_000013290.1.22240 WP_000013290.1.22296 WP_000013290.1.22315 WP_000013290.1.22323 WP_000013290.1.22337 WP_000013290.1.22346 WP_000013290.1.2235 WP_000013290.1.22379 WP_000013290.1.22427 WP_000013290.1.22449 WP_000013290.1.22451 WP_000013290.1.22453 WP_000013290.1.22454 WP_000013290.1.2246 WP_000013290.1.22460 WP_000013290.1.22485 WP_000013290.1.22514 WP_000013290.1.22537 WP_000013290.1.22566 WP_000013290.1.22582 WP_000013290.1.22595 WP_000013290.1.22604 WP_000013290.1.22605 WP_000013290.1.22620 WP_000013290.1.22676 WP_000013290.1.22760 WP_000013290.1.22845 WP_000013290.1.22857 WP_000013290.1.22870 WP_000013290.1.22880 WP_000013290.1.22902 WP_000013290.1.22947 WP_000013290.1.22979 WP_000013290.1.23010 WP_000013290.1.23102 WP_000013290.1.23114 WP_000013290.1.2314 WP_000013290.1.23148 WP_000013290.1.23155 WP_000013290.1.23172 WP_000013290.1.23192 WP_000013290.1.2324 WP_000013290.1.23246 WP_000013290.1.23259 WP_000013290.1.23329 WP_000013290.1.2342 WP_000013290.1.23442 WP_000013290.1.23460 WP_000013290.1.23472 WP_000013290.1.23482 WP_000013290.1.23485 WP_000013290.1.23513 WP_000013290.1.2358 WP_000013290.1.23587 WP_000013290.1.23629 WP_000013290.1.23631 WP_000013290.1.23634 WP_000013290.1.2364 WP_000013290.1.23707 WP_000013290.1.23736 WP_000013290.1.23746 WP_000013290.1.2376 WP_000013290.1.23932 WP_000013290.1.24017 WP_000013290.1.24145 WP_000013290.1.24158 WP_000013290.1.24163 WP_000013290.1.24206 WP_000013290.1.24214 WP_000013290.1.24250 WP_000013290.1.24259 WP_000013290.1.24297 WP_000013290.1.24308 WP_000013290.1.24361 WP_000013290.1.24376 WP_000013290.1.24392 WP_000013290.1.24394 WP_000013290.1.24408 WP_000013290.1.24409 WP_000013290.1.24419 WP_000013290.1.24433 WP_000013290.1.24476 WP_000013290.1.24494 WP_000013290.1.24555 WP_000013290.1.24567 WP_000013290.1.24578 WP_000013290.1.2467 WP_000013290.1.24673 WP_000013290.1.24689 WP_000013290.1.24737 WP_000013290.1.24873 WP_000013290.1.24901 WP_000013290.1.24944 WP_000013290.1.25008 WP_000013290.1.25015 WP_000013290.1.25130 WP_000013290.1.25159 WP_000013290.1.25175 WP_000013290.1.25206 WP_000013290.1.25354 WP_000013290.1.25405 WP_000013290.1.25426 WP_000013290.1.25454 WP_000013290.1.25493 WP_000013290.1.25498 WP_000013290.1.2554 WP_000013290.1.25618 WP_000013290.1.25668 WP_000013290.1.25690 WP_000013290.1.2570 WP_000013290.1.25700 WP_000013290.1.25703 WP_000013290.1.25722 WP_000013290.1.25740 WP_000013290.1.25780 WP_000013290.1.25793 WP_000013290.1.25814 WP_000013290.1.25846 WP_000013290.1.25944 WP_000013290.1.25951 WP_000013290.1.25988 WP_000013290.1.26083 WP_000013290.1.26093 WP_000013290.1.26122 WP_000013290.1.26129 WP_000013290.1.26194 WP_000013290.1.26224 WP_000013290.1.26269 WP_000013290.1.26282 WP_000013290.1.26311 WP_000013290.1.26319 WP_000013290.1.26363 WP_000013290.1.26384 WP_000013290.1.26426 WP_000013290.1.26429 WP_000013290.1.26440 WP_000013290.1.26441 WP_000013290.1.26493 WP_000013290.1.26567 WP_000013290.1.26582 WP_000013290.1.26646 WP_000013290.1.26687 WP_000013290.1.26709 WP_000013290.1.2672 WP_000013290.1.26750 WP_000013290.1.26794 WP_000013290.1.26924 WP_000013290.1.26936 WP_000013290.1.26980 WP_000013290.1.27010 WP_000013290.1.27206 WP_000013290.1.27255 WP_000013290.1.27272 WP_000013290.1.27314 WP_000013290.1.27342 WP_000013290.1.27383 WP_000013290.1.27419 WP_000013290.1.27423 WP_000013290.1.27452 WP_000013290.1.27513 WP_000013290.1.27522 WP_000013290.1.27523 WP_000013290.1.27547 WP_000013290.1.27561 WP_000013290.1.27616 WP_000013290.1.2763 WP_000013290.1.27632 WP_000013290.1.27638 WP_000013290.1.27658 WP_000013290.1.27665 WP_000013290.1.27679 WP_000013290.1.27707 WP_000013290.1.27755 WP_000013290.1.27761 WP_000013290.1.2777 WP_000013290.1.27776 WP_000013290.1.27800 WP_000013290.1.27833 WP_000013290.1.27857 WP_000013290.1.27883 WP_000013290.1.27969 WP_000013290.1.27977 WP_000013290.1.27995 WP_000013290.1.28037 WP_000013290.1.28056 WP_000013290.1.28094 WP_000013290.1.28126 WP_000013290.1.28139 WP_000013290.1.28170 WP_000013290.1.28200 WP_000013290.1.28232 WP_000013290.1.28233 WP_000013290.1.2825 WP_000013290.1.28301 WP_000013290.1.28302 WP_000013290.1.28303 WP_000013290.1.2835 WP_000013290.1.28370 WP_000013290.1.28393 WP_000013290.1.28462 WP_000013290.1.2853 WP_000013290.1.28538 WP_000013290.1.28570 WP_000013290.1.28575 WP_000013290.1.28612 WP_000013290.1.28620 WP_000013290.1.28625 WP_000013290.1.28655 WP_000013290.1.28694 WP_000013290.1.28773 WP_000013290.1.28775 WP_000013290.1.28776 WP_000013290.1.2879 WP_000013290.1.2890 WP_000013290.1.28902 WP_000013290.1.28938 WP_000013290.1.28946 WP_000013290.1.29006 WP_000013290.1.29010 WP_000013290.1.2910 WP_000013290.1.29168 WP_000013290.1.29190 WP_000013290.1.29218 WP_000013290.1.2924 WP_000013290.1.2932 WP_000013290.1.29379 WP_000013290.1.29422 WP_000013290.1.29436 WP_000013290.1.29530 WP_000013290.1.29576 WP_000013290.1.29588 WP_000013290.1.29601 WP_000013290.1.29606 WP_000013290.1.29615 WP_000013290.1.29619 WP_000013290.1.29682 WP_000013290.1.29704 WP_000013290.1.29768 WP_000013290.1.29775 WP_000013290.1.29898 WP_000013290.1.29923 WP_000013290.1.29924 WP_000013290.1.29969 WP_000013290.1.30006 WP_000013290.1.30027 WP_000013290.1.3005 WP_000013290.1.30059 WP_000013290.1.30086 WP_000013290.1.30093 WP_000013290.1.30165 WP_000013290.1.30180 WP_000013290.1.30210 WP_000013290.1.30238 WP_000013290.1.30246 WP_000013290.1.30278 WP_000013290.1.30356 WP_000013290.1.30386 WP_000013290.1.30469 WP_000013290.1.30492 WP_000013290.1.30505 WP_000013290.1.30507 WP_000013290.1.30535 WP_000013290.1.30547 WP_000013290.1.30548 WP_000013290.1.30555 WP_000013290.1.30589 WP_000013290.1.30627 WP_000013290.1.30752 WP_000013290.1.3076 WP_000013290.1.30794 WP_000013290.1.3080 WP_000013290.1.30833 WP_000013290.1.30835 WP_000013290.1.30909 WP_000013290.1.30951 WP_000013290.1.30968 WP_000013290.1.31 WP_000013290.1.31069 WP_000013290.1.31111 WP_000013290.1.3113 WP_000013290.1.31167 WP_000013290.1.31171 WP_000013290.1.31185 WP_000013290.1.3119 WP_000013290.1.31190 WP_000013290.1.31195 WP_000013290.1.31196 WP_000013290.1.31210 WP_000013290.1.31214 WP_000013290.1.31219 WP_000013290.1.3127 WP_000013290.1.31272 WP_000013290.1.31281 WP_000013290.1.31335 WP_000013290.1.31362 WP_000013290.1.31435 WP_000013290.1.31476 WP_000013290.1.31504 WP_000013290.1.31515 WP_000013290.1.31546 WP_000013290.1.31578 WP_000013290.1.31585 WP_000013290.1.31658 WP_000013290.1.3167 WP_000013290.1.31725 WP_000013290.1.31782 WP_000013290.1.31845 WP_000013290.1.31854 WP_000013290.1.31895 WP_000013290.1.31901 WP_000013290.1.31927 WP_000013290.1.31940 WP_000013290.1.31967 WP_000013290.1.31972 WP_000013290.1.32109 WP_000013290.1.32116 WP_000013290.1.32192 WP_000013290.1.32206 WP_000013290.1.32252 WP_000013290.1.32274 WP_000013290.1.32277 WP_000013290.1.32309 WP_000013290.1.32408 WP_000013290.1.32424 WP_000013290.1.32515 WP_000013290.1.32519 WP_000013290.1.32527 WP_000013290.1.32660 WP_000013290.1.32668 WP_000013290.1.32702 WP_000013290.1.32714 WP_000013290.1.32740 WP_000013290.1.32750 WP_000013290.1.32786 WP_000013290.1.32804 WP_000013290.1.32832 WP_000013290.1.32860 WP_000013290.1.32881 WP_000013290.1.32899 WP_000013290.1.329 WP_000013290.1.32900 WP_000013290.1.32902 WP_000013290.1.32907 WP_000013290.1.32961 WP_000013290.1.32977 WP_000013290.1.33030 WP_000013290.1.33127 WP_000013290.1.33143 WP_000013290.1.33248 WP_000013290.1.33253 WP_000013290.1.33261 WP_000013290.1.33270 WP_000013290.1.333 WP_000013290.1.33392 WP_000013290.1.33409 WP_000013290.1.33420 WP_000013290.1.33492 WP_000013290.1.33499 WP_000013290.1.335 WP_000013290.1.33504 WP_000013290.1.33553 WP_000013290.1.3356 WP_000013290.1.33586 WP_000013290.1.33592 WP_000013290.1.3364 WP_000013290.1.33817 WP_000013290.1.33894 WP_000013290.1.3395 WP_000013290.1.3396 WP_000013290.1.34 WP_000013290.1.34075 WP_000013290.1.34091 WP_000013290.1.34185 WP_000013290.1.34257 WP_000013290.1.34259 WP_000013290.1.34279 WP_000013290.1.34292 WP_000013290.1.34330 WP_000013290.1.3438 WP_000013290.1.34424 WP_000013290.1.34431 WP_000013290.1.3445 WP_000013290.1.34453 WP_000013290.1.34454 WP_000013290.1.34610 WP_000013290.1.34614 WP_000013290.1.34711 WP_000013290.1.34817 WP_000013290.1.34820 WP_000013290.1.34856 WP_000013290.1.34975 WP_000013290.1.34977 WP_000013290.1.35045 WP_000013290.1.35129 WP_000013290.1.35184 WP_000013290.1.35298 WP_000013290.1.35321 WP_000013290.1.35331 WP_000013290.1.35404 WP_000013290.1.35408 WP_000013290.1.35425 WP_000013290.1.35429 WP_000013290.1.35463 WP_000013290.1.35507 WP_000013290.1.35509 WP_000013290.1.3556 WP_000013290.1.35563 WP_000013290.1.35570 WP_000013290.1.35590 WP_000013290.1.35594 WP_000013290.1.35624 WP_000013290.1.35648 WP_000013290.1.35777 WP_000013290.1.35887 WP_000013290.1.35936 WP_000013290.1.35940 WP_000013290.1.35961 WP_000013290.1.36003 WP_000013290.1.3601 WP_000013290.1.36037 WP_000013290.1.36057 WP_000013290.1.36063 WP_000013290.1.36157 WP_000013290.1.36172 WP_000013290.1.36232 WP_000013290.1.36409 WP_000013290.1.36445 WP_000013290.1.36542 WP_000013290.1.36584 WP_000013290.1.36586 WP_000013290.1.36609 WP_000013290.1.36685 WP_000013290.1.36690 WP_000013290.1.3670 WP_000013290.1.36705 WP_000013290.1.36721 WP_000013290.1.36751 WP_000013290.1.36764 WP_000013290.1.36875 WP_000013290.1.36889 WP_000013290.1.36899 WP_000013290.1.36918 WP_000013290.1.36931 WP_000013290.1.37013 WP_000013290.1.37029 WP_000013290.1.37073 WP_000013290.1.37111 WP_000013290.1.37112 WP_000013290.1.37114 WP_000013290.1.37191 WP_000013290.1.37256 WP_000013290.1.37293 WP_000013290.1.37297 WP_000013290.1.37320 WP_000013290.1.37370 WP_000013290.1.37376 WP_000013290.1.3744 WP_000013290.1.3748 WP_000013290.1.37498 WP_000013290.1.37504 WP_000013290.1.37558 WP_000013290.1.3756 WP_000013290.1.37618 WP_000013290.1.37687 WP_000013290.1.3771 WP_000013290.1.3778 WP_000013290.1.37848 WP_000013290.1.37864 WP_000013290.1.3790 WP_000013290.1.37968 WP_000013290.1.37978 WP_000013290.1.38026 WP_000013290.1.38037 WP_000013290.1.38047 WP_000013290.1.38125 WP_000013290.1.38145 WP_000013290.1.38199 WP_000013290.1.383 WP_000013290.1.38341 WP_000013290.1.38344 WP_000013290.1.38393 WP_000013290.1.38452 WP_000013290.1.3848 WP_000013290.1.38613 WP_000013290.1.38620 WP_000013290.1.38673 WP_000013290.1.3869 WP_000013290.1.38693 WP_000013290.1.38740 WP_000013290.1.38773 WP_000013290.1.38881 WP_000013290.1.38882 WP_000013290.1.38895 WP_000013290.1.38913 WP_000013290.1.38942 WP_000013290.1.39003 WP_000013290.1.39048 WP_000013290.1.39055 WP_000013290.1.39065 WP_000013290.1.39112 WP_000013290.1.39113 WP_000013290.1.39136 WP_000013290.1.39140 WP_000013290.1.39197 WP_000013290.1.39229 WP_000013290.1.39312 WP_000013290.1.39395 WP_000013290.1.39405 WP_000013290.1.39420 WP_000013290.1.39449 WP_000013290.1.39466 WP_000013290.1.39471 WP_000013290.1.39512 WP_000013290.1.39553 WP_000013290.1.39556 WP_000013290.1.39629 WP_000013290.1.39722 WP_000013290.1.39723 WP_000013290.1.39763 WP_000013290.1.39862 WP_000013290.1.39921 WP_000013290.1.39923 WP_000013290.1.39953 WP_000013290.1.40017 WP_000013290.1.40031 WP_000013290.1.40072 WP_000013290.1.40073 WP_000013290.1.40081 WP_000013290.1.4011 WP_000013290.1.40155 WP_000013290.1.40170 WP_000013290.1.40171 WP_000013290.1.40208 WP_000013290.1.40224 WP_000013290.1.40240 WP_000013290.1.40254 WP_000013290.1.40257 WP_000013290.1.40292 WP_000013290.1.40305 WP_000013290.1.40307 WP_000013290.1.40311 WP_000013290.1.40374 WP_000013290.1.40380 WP_000013290.1.40395 WP_000013290.1.40465 WP_000013290.1.40493 WP_000013290.1.40533 WP_000013290.1.40577 WP_000013290.1.40622 WP_000013290.1.40648 WP_000013290.1.40688 WP_000013290.1.40695 WP_000013290.1.40710 WP_000013290.1.40745 WP_000013290.1.4075 WP_000013290.1.40771 WP_000013290.1.40849 WP_000013290.1.4087 WP_000013290.1.40877 WP_000013290.1.40930 WP_000013290.1.40935 WP_000013290.1.40973 WP_000013290.1.40979 WP_000013290.1.41017 WP_000013290.1.41048 WP_000013290.1.41050 WP_000013290.1.41086 WP_000013290.1.41091 WP_000013290.1.41116 WP_000013290.1.41128 WP_000013290.1.41192 WP_000013290.1.41225 WP_000013290.1.41226 WP_000013290.1.41277 WP_000013290.1.41279 WP_000013290.1.41345 WP_000013290.1.41375 WP_000013290.1.41427 WP_000013290.1.41516 WP_000013290.1.41528 WP_000013290.1.41554 WP_000013290.1.41572 WP_000013290.1.41591 WP_000013290.1.41610 WP_000013290.1.41662 WP_000013290.1.41688 WP_000013290.1.41690 WP_000013290.1.41708 WP_000013290.1.41724 WP_000013290.1.41761 WP_000013290.1.41799 WP_000013290.1.41859 WP_000013290.1.41882 WP_000013290.1.41911 WP_000013290.1.41949 WP_000013290.1.41978 WP_000013290.1.41979 WP_000013290.1.41985 WP_000013290.1.42098 WP_000013290.1.42104 WP_000013290.1.42136 WP_000013290.1.422 WP_000013290.1.42238 WP_000013290.1.42248 WP_000013290.1.42263 WP_000013290.1.42276 WP_000013290.1.4229 WP_000013290.1.42320 WP_000013290.1.42322 WP_000013290.1.42328 WP_000013290.1.42342 WP_000013290.1.42372 WP_000013290.1.4239 WP_000013290.1.42392 WP_000013290.1.42404 WP_000013290.1.42422 WP_000013290.1.42489 WP_000013290.1.42491 WP_000013290.1.42605 WP_000013290.1.42666 WP_000013290.1.42675 WP_000013290.1.42683 WP_000013290.1.42707 WP_000013290.1.42734 WP_000013290.1.4276 WP_000013290.1.42767 WP_000013290.1.42797 WP_000013290.1.42829 WP_000013290.1.42864 WP_000013290.1.4288 WP_000013290.1.42887 WP_000013290.1.4289 WP_000013290.1.42892 WP_000013290.1.42923 WP_000013290.1.43018 WP_000013290.1.43041 WP_000013290.1.43201 WP_000013290.1.43244 WP_000013290.1.43272 WP_000013290.1.43299 WP_000013290.1.43334 WP_000013290.1.43351 WP_000013290.1.43437 WP_000013290.1.43438 WP_000013290.1.4344 WP_000013290.1.43522 WP_000013290.1.43528 WP_000013290.1.43535 WP_000013290.1.43613 WP_000013290.1.43668 WP_000013290.1.43685 WP_000013290.1.43710 WP_000013290.1.43711 WP_000013290.1.43785 WP_000013290.1.43864 WP_000013290.1.43873 WP_000013290.1.43875 WP_000013290.1.43886 WP_000013290.1.44010 WP_000013290.1.44043 WP_000013290.1.4405 WP_000013290.1.44099 WP_000013290.1.44113 WP_000013290.1.44121 WP_000013290.1.44144 WP_000013290.1.44291 WP_000013290.1.44310 WP_000013290.1.44337 WP_000013290.1.44386 WP_000013290.1.44438 WP_000013290.1.44440 WP_000013290.1.44443 WP_000013290.1.44474 WP_000013290.1.44479 WP_000013290.1.44578 WP_000013290.1.44593 WP_000013290.1.44606 WP_000013290.1.44633 WP_000013290.1.4467 WP_000013290.1.44678 WP_000013290.1.44687 WP_000013290.1.44702 WP_000013290.1.44705 WP_000013290.1.44747 WP_000013290.1.44781 WP_000013290.1.44791 WP_000013290.1.44831 WP_000013290.1.44833 WP_000013290.1.4485 WP_000013290.1.44877 WP_000013290.1.44887 WP_000013290.1.44927 WP_000013290.1.44950 WP_000013290.1.44966 WP_000013290.1.44971 WP_000013290.1.44978 WP_000013290.1.44996 WP_000013290.1.44997 WP_000013290.1.4500 WP_000013290.1.45027 WP_000013290.1.45045 WP_000013290.1.4505 WP_000013290.1.45074 WP_000013290.1.45079 WP_000013290.1.45098 WP_000013290.1.45138 WP_000013290.1.45173 WP_000013290.1.45177 WP_000013290.1.45184 WP_000013290.1.45259 WP_000013290.1.45302 WP_000013290.1.4531 WP_000013290.1.45344 WP_000013290.1.45349 WP_000013290.1.45351 WP_000013290.1.45365 WP_000013290.1.45432 WP_000013290.1.45522 WP_000013290.1.45544 WP_000013290.1.45549 WP_000013290.1.45550 WP_000013290.1.45569 WP_000013290.1.45571 WP_000013290.1.45583 WP_000013290.1.45585 WP_000013290.1.45660 WP_000013290.1.45690 WP_000013290.1.45797 WP_000013290.1.458 WP_000013290.1.45844 WP_000013290.1.45906 WP_000013290.1.45918 WP_000013290.1.46011 WP_000013290.1.46069 WP_000013290.1.46112 WP_000013290.1.46173 WP_000013290.1.46174 WP_000013290.1.46187 WP_000013290.1.46215 WP_000013290.1.46243 WP_000013290.1.46250 WP_000013290.1.46303 WP_000013290.1.46322 WP_000013290.1.46345 WP_000013290.1.46406 WP_000013290.1.46444 WP_000013290.1.46578 WP_000013290.1.46595 WP_000013290.1.46675 WP_000013290.1.46689 WP_000013290.1.4671 WP_000013290.1.46726 WP_000013290.1.46730 WP_000013290.1.46732 WP_000013290.1.4674 WP_000013290.1.46803 WP_000013290.1.4686 WP_000013290.1.46930 WP_000013290.1.46961 WP_000013290.1.46967 WP_000013290.1.46976 WP_000013290.1.47023 WP_000013290.1.47057 WP_000013290.1.47061 WP_000013290.1.47110 WP_000013290.1.47214 WP_000013290.1.47243 WP_000013290.1.47429 WP_000013290.1.47448 WP_000013290.1.4747 WP_000013290.1.47472 WP_000013290.1.47478 WP_000013290.1.47492 WP_000013290.1.47507 WP_000013290.1.47542 WP_000013290.1.47567 WP_000013290.1.47576 WP_000013290.1.4758 WP_000013290.1.47587 WP_000013290.1.47621 WP_000013290.1.47660 WP_000013290.1.4769 WP_000013290.1.47714 WP_000013290.1.4775 WP_000013290.1.47799 WP_000013290.1.47817 WP_000013290.1.47829 WP_000013290.1.47849 WP_000013290.1.47850 WP_000013290.1.47875 WP_000013290.1.47911 WP_000013290.1.47928 WP_000013290.1.4795 WP_000013290.1.47988 WP_000013290.1.48132 WP_000013290.1.48134 WP_000013290.1.48242 WP_000013290.1.48244 WP_000013290.1.48253 WP_000013290.1.483 WP_000013290.1.48367 WP_000013290.1.48377 WP_000013290.1.4839 WP_000013290.1.48399 WP_000013290.1.48493 WP_000013290.1.48510 WP_000013290.1.4853 WP_000013290.1.48651 WP_000013290.1.48768 WP_000013290.1.48788 WP_000013290.1.48797 WP_000013290.1.48841 WP_000013290.1.4885 WP_000013290.1.48876 WP_000013290.1.48894 WP_000013290.1.48896 WP_000013290.1.48919 WP_000013290.1.49084 WP_000013290.1.49102 WP_000013290.1.49155 WP_000013290.1.49175 WP_000013290.1.49204 WP_000013290.1.49226 WP_000013290.1.49233 WP_000013290.1.49239 WP_000013290.1.49256 WP_000013290.1.49276 WP_000013290.1.49290 WP_000013290.1.49309 WP_000013290.1.49311 WP_000013290.1.49334 WP_000013290.1.49340 WP_000013290.1.49366 WP_000013290.1.49430 WP_000013290.1.49490 WP_000013290.1.49494 WP_000013290.1.49515 WP_000013290.1.49550 WP_000013290.1.49572 WP_000013290.1.49590 WP_000013290.1.49595 WP_000013290.1.49626 WP_000013290.1.49630 WP_000013290.1.49647 WP_000013290.1.49770 WP_000013290.1.4979 WP_000013290.1.49790 WP_000013290.1.49803 WP_000013290.1.49805 WP_000013290.1.49827 WP_000013290.1.49929 WP_000013290.1.49931 WP_000013290.1.50003 WP_000013290.1.50007 WP_000013290.1.50080 WP_000013290.1.5009 WP_000013290.1.50128 WP_000013290.1.50153 WP_000013290.1.50161 WP_000013290.1.50211 WP_000013290.1.50332 WP_000013290.1.50376 WP_000013290.1.50389 WP_000013290.1.50449 WP_000013290.1.50517 WP_000013290.1.50529 WP_000013290.1.50576 WP_000013290.1.50593 WP_000013290.1.50652 WP_000013290.1.50676 WP_000013290.1.50684 WP_000013290.1.50750 WP_000013290.1.50774 WP_000013290.1.50782 WP_000013290.1.50800 WP_000013290.1.50804 WP_000013290.1.50808 WP_000013290.1.5088 WP_000013290.1.50882 WP_000013290.1.50908 WP_000013290.1.50941 WP_000013290.1.50954 WP_000013290.1.50960 WP_000013290.1.51014 WP_000013290.1.51022 WP_000013290.1.51025 WP_000013290.1.51117 WP_000013290.1.51162 WP_000013290.1.51179 WP_000013290.1.51182 WP_000013290.1.51186 WP_000013290.1.51285 WP_000013290.1.51308 WP_000013290.1.51331 WP_000013290.1.51338 WP_000013290.1.51356 WP_000013290.1.5138 WP_000013290.1.51394 WP_000013290.1.51412 WP_000013290.1.51451 WP_000013290.1.51464 WP_000013290.1.51487 WP_000013290.1.51488 WP_000013290.1.51502 WP_000013290.1.51514 WP_000013290.1.51555 WP_000013290.1.51594 WP_000013290.1.51611 WP_000013290.1.51613 WP_000013290.1.51634 WP_000013290.1.51642 WP_000013290.1.51649 WP_000013290.1.51686 WP_000013290.1.51756 WP_000013290.1.51764 WP_000013290.1.51810 WP_000013290.1.51841 WP_000013290.1.5185 WP_000013290.1.51868 WP_000013290.1.51888 WP_000013290.1.51911 WP_000013290.1.51930 WP_000013290.1.51932 WP_000013290.1.51989 WP_000013290.1.51994 WP_000013290.1.520 WP_000013290.1.52047 WP_000013290.1.52101 WP_000013290.1.5211 WP_000013290.1.52121 WP_000013290.1.52148 WP_000013290.1.52161 WP_000013290.1.52301 WP_000013290.1.52321 WP_000013290.1.52346 WP_000013290.1.52353 WP_000013290.1.52356 WP_000013290.1.52361 WP_000013290.1.52446 WP_000013290.1.52528 WP_000013290.1.52586 WP_000013290.1.52637 WP_000013290.1.52653 WP_000013290.1.52656 WP_000013290.1.52738 WP_000013290.1.52743 WP_000013290.1.52833 WP_000013290.1.52851 WP_000013290.1.52857 WP_000013290.1.52898 WP_000013290.1.52915 WP_000013290.1.53107 WP_000013290.1.53119 WP_000013290.1.5313 WP_000013290.1.53158 WP_000013290.1.53190 WP_000013290.1.53198 WP_000013290.1.53206 WP_000013290.1.53234 WP_000013290.1.53286 WP_000013290.1.53362 WP_000013290.1.53385 WP_000013290.1.53436 WP_000013290.1.53466 WP_000013290.1.53529 WP_000013290.1.53534 WP_000013290.1.53543 WP_000013290.1.53567 WP_000013290.1.53664 WP_000013290.1.53675 WP_000013290.1.53688 WP_000013290.1.53694 WP_000013290.1.53757 WP_000013290.1.53778 WP_000013290.1.53781 WP_000013290.1.53790 WP_000013290.1.53812 WP_000013290.1.53896 WP_000013290.1.53961 WP_000013290.1.54033 WP_000013290.1.54061 WP_000013290.1.54082 WP_000013290.1.54085 WP_000013290.1.54136 WP_000013290.1.54196 WP_000013290.1.542 WP_000013290.1.54209 WP_000013290.1.54271 WP_000013290.1.54273 WP_000013290.1.54274 WP_000013290.1.54283 WP_000013290.1.54319 WP_000013290.1.54324 WP_000013290.1.54333 WP_000013290.1.54340 WP_000013290.1.54364 WP_000013290.1.54366 WP_000013290.1.54400 WP_000013290.1.54607 WP_000013290.1.54615 WP_000013290.1.5462 WP_000013290.1.54644 WP_000013290.1.54662 WP_000013290.1.54694 WP_000013290.1.54722 WP_000013290.1.54749 WP_000013290.1.54764 WP_000013290.1.54822 WP_000013290.1.54827 WP_000013290.1.54833 WP_000013290.1.54877 WP_000013290.1.5493 WP_000013290.1.54936 WP_000013290.1.55008 WP_000013290.1.55152 WP_000013290.1.55156 WP_000013290.1.5517 WP_000013290.1.55200 WP_000013290.1.55223 WP_000013290.1.55285 WP_000013290.1.55418 WP_000013290.1.55475 WP_000013290.1.5552 WP_000013290.1.55528 WP_000013290.1.55545 WP_000013290.1.55554 WP_000013290.1.55559 WP_000013290.1.55614 WP_000013290.1.55640 WP_000013290.1.55647 WP_000013290.1.55706 WP_000013290.1.5572 WP_000013290.1.55743 WP_000013290.1.55768 WP_000013290.1.5577 WP_000013290.1.55782 WP_000013290.1.55796 WP_000013290.1.55923 WP_000013290.1.55948 WP_000013290.1.55993 WP_000013290.1.55995 WP_000013290.1.56002 WP_000013290.1.56059 WP_000013290.1.56070 WP_000013290.1.56082 WP_000013290.1.56105 WP_000013290.1.56222 WP_000013290.1.56235 WP_000013290.1.56238 WP_000013290.1.56247 WP_000013290.1.56263 WP_000013290.1.56286 WP_000013290.1.56304 WP_000013290.1.5633 WP_000013290.1.56368 WP_000013290.1.56374 WP_000013290.1.56393 WP_000013290.1.56396 WP_000013290.1.56414 WP_000013290.1.56438 WP_000013290.1.56468 WP_000013290.1.56512 WP_000013290.1.56560 WP_000013290.1.56597 WP_000013290.1.56614 WP_000013290.1.56651 WP_000013290.1.56671 WP_000013290.1.5668 WP_000013290.1.56682 WP_000013290.1.56791 WP_000013290.1.56824 WP_000013290.1.56851 WP_000013290.1.56861 WP_000013290.1.56875 WP_000013290.1.56877 WP_000013290.1.56898 WP_000013290.1.56905 WP_000013290.1.56942 WP_000013290.1.57026 WP_000013290.1.57039 WP_000013290.1.57056 WP_000013290.1.5711 WP_000013290.1.57125 WP_000013290.1.57143 WP_000013290.1.57149 WP_000013290.1.57168 WP_000013290.1.57187 WP_000013290.1.57232 WP_000013290.1.57233 WP_000013290.1.57244 WP_000013290.1.57246 WP_000013290.1.57296 WP_000013290.1.57357 WP_000013290.1.57362 WP_000013290.1.57377 WP_000013290.1.57418 WP_000013290.1.57433 WP_000013290.1.57510 WP_000013290.1.57515 WP_000013290.1.57529 WP_000013290.1.5753 WP_000013290.1.57559 WP_000013290.1.57576 WP_000013290.1.57601 WP_000013290.1.5761 WP_000013290.1.57631 WP_000013290.1.57641 WP_000013290.1.57735 WP_000013290.1.57763 WP_000013290.1.57781 WP_000013290.1.57835 WP_000013290.1.57862 WP_000013290.1.57890 WP_000013290.1.57893 WP_000013290.1.57978 WP_000013290.1.5801 WP_000013290.1.58041 WP_000013290.1.58090 WP_000013290.1.58144 WP_000013290.1.58157 WP_000013290.1.58249 WP_000013290.1.5828 WP_000013290.1.58301 WP_000013290.1.58357 WP_000013290.1.58372 WP_000013290.1.58418 WP_000013290.1.58443 WP_000013290.1.58467 WP_000013290.1.58486 WP_000013290.1.58489 WP_000013290.1.5854 WP_000013290.1.58548 WP_000013290.1.5858 WP_000013290.1.58662 WP_000013290.1.58669 WP_000013290.1.58675 WP_000013290.1.58698 WP_000013290.1.587 WP_000013290.1.58744 WP_000013290.1.58745 WP_000013290.1.5878 WP_000013290.1.58803 WP_000013290.1.58834 WP_000013290.1.5886 WP_000013290.1.58884 WP_000013290.1.58926 WP_000013290.1.58932 WP_000013290.1.59068 WP_000013290.1.59084 WP_000013290.1.59094 WP_000013290.1.59097 WP_000013290.1.59125 WP_000013290.1.59136 WP_000013290.1.59142 WP_000013290.1.59163 WP_000013290.1.59224 WP_000013290.1.59236 WP_000013290.1.59276 WP_000013290.1.59294 WP_000013290.1.59321 WP_000013290.1.59375 WP_000013290.1.59427 WP_000013290.1.59439 WP_000013290.1.59458 WP_000013290.1.59490 WP_000013290.1.59508 WP_000013290.1.59512 WP_000013290.1.5953 WP_000013290.1.59538 WP_000013290.1.59548 WP_000013290.1.59646 WP_000013290.1.59684 WP_000013290.1.59694 WP_000013290.1.59709 WP_000013290.1.59771 WP_000013290.1.5979 WP_000013290.1.59848 WP_000013290.1.59928 WP_000013290.1.59953 WP_000013290.1.60004 WP_000013290.1.60008 WP_000013290.1.60015 WP_000013290.1.60021 WP_000013290.1.60052 WP_000013290.1.60069 WP_000013290.1.60106 WP_000013290.1.60126 WP_000013290.1.60137 WP_000013290.1.60140 WP_000013290.1.60155 WP_000013290.1.60213 WP_000013290.1.60285 WP_000013290.1.60320 WP_000013290.1.6033 WP_000013290.1.60370 WP_000013290.1.60379 WP_000013290.1.60425 WP_000013290.1.60464 WP_000013290.1.60507 WP_000013290.1.6052 WP_000013290.1.60560 WP_000013290.1.60608 WP_000013290.1.60713 WP_000013290.1.60746 WP_000013290.1.608 WP_000013290.1.60809 WP_000013290.1.60838 WP_000013290.1.60855 WP_000013290.1.60866 WP_000013290.1.60874 WP_000013290.1.60897 WP_000013290.1.60926 WP_000013290.1.60941 WP_000013290.1.61078 WP_000013290.1.6108 WP_000013290.1.61087 WP_000013290.1.6114 WP_000013290.1.61201 WP_000013290.1.61232 WP_000013290.1.61233 WP_000013290.1.6129 WP_000013290.1.61296 WP_000013290.1.61309 WP_000013290.1.61345 WP_000013290.1.61356 WP_000013290.1.61381 WP_000013290.1.61417 WP_000013290.1.6143 WP_000013290.1.61501 WP_000013290.1.61509 WP_000013290.1.61519 WP_000013290.1.61574 WP_000013290.1.61594 WP_000013290.1.61595 WP_000013290.1.61609 WP_000013290.1.61662 WP_000013290.1.61671 WP_000013290.1.61694 WP_000013290.1.61712 WP_000013290.1.61714 WP_000013290.1.61730 WP_000013290.1.61857 WP_000013290.1.61908 WP_000013290.1.61922 WP_000013290.1.61924 WP_000013290.1.61952 WP_000013290.1.62007 WP_000013290.1.62025 WP_000013290.1.62063 WP_000013290.1.62076 WP_000013290.1.6210 WP_000013290.1.62158 WP_000013290.1.62195 WP_000013290.1.62201 WP_000013290.1.62204 WP_000013290.1.62210 WP_000013290.1.62222 WP_000013290.1.62304 WP_000013290.1.62364 WP_000013290.1.62374 WP_000013290.1.62403 WP_000013290.1.62412 WP_000013290.1.62486 WP_000013290.1.62504 WP_000013290.1.6253 WP_000013290.1.62570 WP_000013290.1.62677 WP_000013290.1.627 WP_000013290.1.62745 WP_000013290.1.62757 WP_000013290.1.62853 WP_000013290.1.62903 WP_000013290.1.62910 WP_000013290.1.6292 WP_000013290.1.62955 WP_000013290.1.62983 WP_000013290.1.62988 WP_000013290.1.63043 WP_000013290.1.63045 WP_000013290.1.63063 WP_000013290.1.63102 WP_000013290.1.63181 WP_000013290.1.63203 WP_000013290.1.63229 WP_000013290.1.63234 WP_000013290.1.63243 WP_000013290.1.63256 WP_000013290.1.63290 WP_000013290.1.63358 WP_000013290.1.63382 WP_000013290.1.63432 WP_000013290.1.63461 WP_000013290.1.63479 WP_000013290.1.63497 WP_000013290.1.63509 WP_000013290.1.63529 WP_000013290.1.63577 WP_000013290.1.63585 WP_000013290.1.63603 WP_000013290.1.63664 WP_000013290.1.6370 WP_000013290.1.63718 WP_000013290.1.63731 WP_000013290.1.63748 WP_000013290.1.6375 WP_000013290.1.63757 WP_000013290.1.63824 WP_000013290.1.63831 WP_000013290.1.63834 WP_000013290.1.63851 WP_000013290.1.63863 WP_000013290.1.63992 WP_000013290.1.64010 WP_000013290.1.64034 WP_000013290.1.64046 WP_000013290.1.64072 WP_000013290.1.64085 WP_000013290.1.64109 WP_000013290.1.64157 WP_000013290.1.64208 WP_000013290.1.64229 WP_000013290.1.6423 WP_000013290.1.64242 WP_000013290.1.64244 WP_000013290.1.64266 WP_000013290.1.64350 WP_000013290.1.6437 WP_000013290.1.64385 WP_000013290.1.64403 WP_000013290.1.64462 WP_000013290.1.64500 WP_000013290.1.64569 WP_000013290.1.64597 WP_000013290.1.64645 WP_000013290.1.64649 WP_000013290.1.64674 WP_000013290.1.64702 WP_000013290.1.64711 WP_000013290.1.64757 WP_000013290.1.64758 WP_000013290.1.64781 WP_000013290.1.64831 WP_000013290.1.6489 WP_000013290.1.64919 WP_000013290.1.64920 WP_000013290.1.65011 WP_000013290.1.65018 WP_000013290.1.65022 WP_000013290.1.65028 WP_000013290.1.65168 WP_000013290.1.65171 WP_000013290.1.65185 WP_000013290.1.65238 WP_000013290.1.65248 WP_000013290.1.65357 WP_000013290.1.65474 WP_000013290.1.65475 WP_000013290.1.65508 WP_000013290.1.65558 WP_000013290.1.65572 WP_000013290.1.6560 WP_000013290.1.65601 WP_000013290.1.65633 WP_000013290.1.6565 WP_000013290.1.65696 WP_000013290.1.65698 WP_000013290.1.6572 WP_000013290.1.6575 WP_000013290.1.65771 WP_000013290.1.65782 WP_000013290.1.65790 WP_000013290.1.65795 WP_000013290.1.65818 WP_000013290.1.65838 WP_000013290.1.65876 WP_000013290.1.65881 WP_000013290.1.65883 WP_000013290.1.65901 WP_000013290.1.6594 WP_000013290.1.65945 WP_000013290.1.6595 WP_000013290.1.66129 WP_000013290.1.66167 WP_000013290.1.66171 WP_000013290.1.66235 WP_000013290.1.66272 WP_000013290.1.6630 WP_000013290.1.66314 WP_000013290.1.66315 WP_000013290.1.66358 WP_000013290.1.66362 WP_000013290.1.66365 WP_000013290.1.6638 WP_000013290.1.66385 WP_000013290.1.6640 WP_000013290.1.66400 WP_000013290.1.66428 WP_000013290.1.66446 WP_000013290.1.66462 WP_000013290.1.66534 WP_000013290.1.66539 WP_000013290.1.66698 WP_000013290.1.66733 WP_000013290.1.6680 WP_000013290.1.66820 WP_000013290.1.66824 WP_000013290.1.66834 WP_000013290.1.66901 WP_000013290.1.6692 WP_000013290.1.66959 WP_000013290.1.66962 WP_000013290.1.67045 WP_000013290.1.67075 WP_000013290.1.6710 WP_000013290.1.67173 WP_000013290.1.67181 WP_000013290.1.67184 WP_000013290.1.67228 WP_000013290.1.67268 WP_000013290.1.67279 WP_000013290.1.67374 WP_000013290.1.67424 WP_000013290.1.67465 WP_000013290.1.67552 WP_000013290.1.6760 WP_000013290.1.67682 WP_000013290.1.6782 WP_000013290.1.67825 WP_000013290.1.67829 WP_000013290.1.67887 WP_000013290.1.67905 WP_000013290.1.67924 WP_000013290.1.67932 WP_000013290.1.67942 WP_000013290.1.68073 WP_000013290.1.68140 WP_000013290.1.68159 WP_000013290.1.68201 WP_000013290.1.68206 WP_000013290.1.6827 WP_000013290.1.68275 WP_000013290.1.6849 WP_000013290.1.68547 WP_000013290.1.6857 WP_000013290.1.68589 WP_000013290.1.68652 WP_000013290.1.68655 WP_000013290.1.68656 WP_000013290.1.68658 WP_000013290.1.68677 WP_000013290.1.6869 WP_000013290.1.68690 WP_000013290.1.68778 WP_000013290.1.68787 WP_000013290.1.68818 WP_000013290.1.6882 WP_000013290.1.68893 WP_000013290.1.68894 WP_000013290.1.68895 WP_000013290.1.68928 WP_000013290.1.68958 WP_000013290.1.68966 WP_000013290.1.68975 WP_000013290.1.69006 WP_000013290.1.69011 WP_000013290.1.69029 WP_000013290.1.69080 WP_000013290.1.69086 WP_000013290.1.6913 WP_000013290.1.69131 WP_000013290.1.69146 WP_000013290.1.69236 WP_000013290.1.69255 WP_000013290.1.69273 WP_000013290.1.69288 WP_000013290.1.69320 WP_000013290.1.69346 WP_000013290.1.69357 WP_000013290.1.69397 WP_000013290.1.69433 WP_000013290.1.69485 WP_000013290.1.69564 WP_000013290.1.69575 WP_000013290.1.69588 WP_000013290.1.69592 WP_000013290.1.69616 WP_000013290.1.69644 WP_000013290.1.69704 WP_000013290.1.69754 WP_000013290.1.69767 WP_000013290.1.69785 WP_000013290.1.69787 WP_000013290.1.69807 WP_000013290.1.69839 WP_000013290.1.69890 WP_000013290.1.69965 WP_000013290.1.69977 WP_000013290.1.70028 WP_000013290.1.70088 WP_000013290.1.7010 WP_000013290.1.7014 WP_000013290.1.7016 WP_000013290.1.7021 WP_000013290.1.70241 WP_000013290.1.70269 WP_000013290.1.70272 WP_000013290.1.70289 WP_000013290.1.70326 WP_000013290.1.70440 WP_000013290.1.70447 WP_000013290.1.70485 WP_000013290.1.70488 WP_000013290.1.70523 WP_000013290.1.70531 WP_000013290.1.70547 WP_000013290.1.70580 WP_000013290.1.70596 WP_000013290.1.7060 WP_000013290.1.70643 WP_000013290.1.70662 WP_000013290.1.70678 WP_000013290.1.70683 WP_000013290.1.70785 WP_000013290.1.70837 WP_000013290.1.70869 WP_000013290.1.70883 WP_000013290.1.70914 WP_000013290.1.70922 WP_000013290.1.70948 WP_000013290.1.70985 WP_000013290.1.71007 WP_000013290.1.71010 WP_000013290.1.71069 WP_000013290.1.71116 WP_000013290.1.71146 WP_000013290.1.71165 WP_000013290.1.71172 WP_000013290.1.71184 WP_000013290.1.71188 WP_000013290.1.71201 WP_000013290.1.71202 WP_000013290.1.71243 WP_000013290.1.71248 WP_000013290.1.71299 WP_000013290.1.71305 WP_000013290.1.71306 WP_000013290.1.71337 WP_000013290.1.71378 WP_000013290.1.71401 WP_000013290.1.71407 WP_000013290.1.71626 WP_000013290.1.71649 WP_000013290.1.71656 WP_000013290.1.71691 WP_000013290.1.71702 WP_000013290.1.71750 WP_000013290.1.71845 WP_000013290.1.71848 WP_000013290.1.71881 WP_000013290.1.71908 WP_000013290.1.71929 WP_000013290.1.71952 WP_000013290.1.71973 WP_000013290.1.71979 WP_000013290.1.71984 WP_000013290.1.720 WP_000013290.1.72065 WP_000013290.1.72100 WP_000013290.1.72105 WP_000013290.1.72107 WP_000013290.1.72119 WP_000013290.1.72121 WP_000013290.1.72190 WP_000013290.1.72203 WP_000013290.1.72221 WP_000013290.1.72234 WP_000013290.1.72254 WP_000013290.1.72300 WP_000013290.1.72307 WP_000013290.1.72325 WP_000013290.1.72339 WP_000013290.1.72351 WP_000013290.1.72372 WP_000013290.1.72376 WP_000013290.1.72382 WP_000013290.1.72412 WP_000013290.1.72532 WP_000013290.1.72594 WP_000013290.1.72602 WP_000013290.1.72629 WP_000013290.1.72716 WP_000013290.1.72718 WP_000013290.1.72797 WP_000013290.1.72827 WP_000013290.1.72865 WP_000013290.1.72871 WP_000013290.1.72892 WP_000013290.1.72897 WP_000013290.1.72946 WP_000013290.1.7295 WP_000013290.1.72975 WP_000013290.1.73062 WP_000013290.1.73068 WP_000013290.1.73102 WP_000013290.1.73144 WP_000013290.1.7315 WP_000013290.1.73164 WP_000013290.1.73200 WP_000013290.1.7334 WP_000013290.1.73362 WP_000013290.1.73377 WP_000013290.1.73379 WP_000013290.1.7341 WP_000013290.1.73481 WP_000013290.1.7356 WP_000013290.1.73561 WP_000013290.1.73581 WP_000013290.1.73617 WP_000013290.1.73667 WP_000013290.1.73708 WP_000013290.1.73753 WP_000013290.1.73758 WP_000013290.1.73794 WP_000013290.1.73804 WP_000013290.1.7386 WP_000013290.1.7387 WP_000013290.1.73924 WP_000013290.1.73926 WP_000013290.1.7394 WP_000013290.1.73945 WP_000013290.1.73958 WP_000013290.1.74029 WP_000013290.1.74049 WP_000013290.1.74117 WP_000013290.1.74174 WP_000013290.1.74181 WP_000013290.1.74191 WP_000013290.1.74207 WP_000013290.1.74248 WP_000013290.1.743 WP_000013290.1.74300 WP_000013290.1.7433 WP_000013290.1.74379 WP_000013290.1.74402 WP_000013290.1.74410 WP_000013290.1.74414 WP_000013290.1.74418 WP_000013290.1.74422 WP_000013290.1.74466 WP_000013290.1.74481 WP_000013290.1.74500 WP_000013290.1.74529 WP_000013290.1.74545 WP_000013290.1.74578 WP_000013290.1.74620 WP_000013290.1.74639 WP_000013290.1.74741 WP_000013290.1.74745 WP_000013290.1.74884 WP_000013290.1.74972 WP_000013290.1.74992 WP_000013290.1.74996 WP_000013290.1.75051 WP_000013290.1.75056 WP_000013290.1.75058 WP_000013290.1.75114 WP_000013290.1.75148 WP_000013290.1.75159 WP_000013290.1.75177 WP_000013290.1.75180 WP_000013290.1.75187 WP_000013290.1.75288 WP_000013290.1.75334 WP_000013290.1.75371 WP_000013290.1.75385 WP_000013290.1.75392 WP_000013290.1.75400 WP_000013290.1.7543 WP_000013290.1.75450 WP_000013290.1.75494 WP_000013290.1.7558 WP_000013290.1.75585 WP_000013290.1.75607 WP_000013290.1.75626 WP_000013290.1.75716 WP_000013290.1.75751 WP_000013290.1.75760 WP_000013290.1.75764 WP_000013290.1.75793 WP_000013290.1.75794 WP_000013290.1.75810 WP_000013290.1.75837 WP_000013290.1.75874 WP_000013290.1.75902 WP_000013290.1.75945 WP_000013290.1.75957 WP_000013290.1.76020 WP_000013290.1.76108 WP_000013290.1.76115 WP_000013290.1.76137 WP_000013290.1.76208 WP_000013290.1.76252 WP_000013290.1.76301 WP_000013290.1.7634 WP_000013290.1.76345 WP_000013290.1.76445 WP_000013290.1.76451 WP_000013290.1.76471 WP_000013290.1.76495 WP_000013290.1.76532 WP_000013290.1.7660 WP_000013290.1.76673 WP_000013290.1.76706 WP_000013290.1.76721 WP_000013290.1.76724 WP_000013290.1.76738 WP_000013290.1.76756 WP_000013290.1.76760 WP_000013290.1.76776 WP_000013290.1.76866 WP_000013290.1.76875 WP_000013290.1.76880 WP_000013290.1.76899 WP_000013290.1.76913 WP_000013290.1.76968 WP_000013290.1.77017 WP_000013290.1.77038 WP_000013290.1.77047 WP_000013290.1.77080 WP_000013290.1.7712 WP_000013290.1.77180 WP_000013290.1.77193 WP_000013290.1.77244 WP_000013290.1.77271 WP_000013290.1.77292 WP_000013290.1.77306 WP_000013290.1.77313 WP_000013290.1.77349 WP_000013290.1.77356 WP_000013290.1.77414 WP_000013290.1.77436 WP_000013290.1.77475 WP_000013290.1.77496 WP_000013290.1.77514 WP_000013290.1.77529 WP_000013290.1.77543 WP_000013290.1.77549 WP_000013290.1.77565 WP_000013290.1.77575 WP_000013290.1.77646 WP_000013290.1.77692 WP_000013290.1.77754 WP_000013290.1.7782 WP_000013290.1.7784 WP_000013290.1.77851 WP_000013290.1.77871 WP_000013290.1.77898 WP_000013290.1.77918 WP_000013290.1.7792 WP_000013290.1.7793 WP_000013290.1.77951 WP_000013290.1.77960 WP_000013290.1.77971 WP_000013290.1.77983 WP_000013290.1.77989 WP_000013290.1.78 WP_000013290.1.7802 WP_000013290.1.78026 WP_000013290.1.78033 WP_000013290.1.78051 WP_000013290.1.78076 WP_000013290.1.78096 WP_000013290.1.78100 WP_000013290.1.78110 WP_000013290.1.78120 WP_000013290.1.78168 WP_000013290.1.78170 WP_000013290.1.78245 WP_000013290.1.78383 WP_000013290.1.78407 WP_000013290.1.78443 WP_000013290.1.78501 WP_000013290.1.78602 WP_000013290.1.78603 WP_000013290.1.7861 WP_000013290.1.78618 WP_000013290.1.78632 WP_000013290.1.78658 WP_000013290.1.78673 WP_000013290.1.78697 WP_000013290.1.78734 WP_000013290.1.78735 WP_000013290.1.7877 WP_000013290.1.78802 WP_000013290.1.78815 WP_000013290.1.78830 WP_000013290.1.78835 WP_000013290.1.78862 WP_000013290.1.78871 WP_000013290.1.78874 WP_000013290.1.78877 WP_000013290.1.78896 WP_000013290.1.7891 WP_000013290.1.78918 WP_000013290.1.78930 WP_000013290.1.78959 WP_000013290.1.79032 WP_000013290.1.79099 WP_000013290.1.79140 WP_000013290.1.79151 WP_000013290.1.79203 WP_000013290.1.79289 WP_000013290.1.79297 WP_000013290.1.79302 WP_000013290.1.79335 WP_000013290.1.794 WP_000013290.1.79427 WP_000013290.1.79462 WP_000013290.1.79468 WP_000013290.1.79472 WP_000013290.1.79495 WP_000013290.1.79529 WP_000013290.1.79531 WP_000013290.1.79570 WP_000013290.1.79580 WP_000013290.1.79586 WP_000013290.1.7964 WP_000013290.1.79645 WP_000013290.1.79668 WP_000013290.1.79708 WP_000013290.1.79738 WP_000013290.1.7982 WP_000013290.1.79832 WP_000013290.1.79845 WP_000013290.1.79867 WP_000013290.1.79892 WP_000013290.1.7991 WP_000013290.1.79914 WP_000013290.1.79929 WP_000013290.1.7994 WP_000013290.1.79942 WP_000013290.1.79951 WP_000013290.1.79966 WP_000013290.1.79977 WP_000013290.1.79996 WP_000013290.1.80077 WP_000013290.1.80137 WP_000013290.1.80182 WP_000013290.1.80249 WP_000013290.1.80254 WP_000013290.1.80296 WP_000013290.1.80366 WP_000013290.1.80380 WP_000013290.1.80448 WP_000013290.1.80479 WP_000013290.1.80667 WP_000013290.1.80674 WP_000013290.1.80750 WP_000013290.1.80757 WP_000013290.1.80760 WP_000013290.1.80780 WP_000013290.1.80827 WP_000013290.1.80831 WP_000013290.1.80850 WP_000013290.1.80868 WP_000013290.1.80874 WP_000013290.1.80876 WP_000013290.1.80881 WP_000013290.1.80939 WP_000013290.1.80959 WP_000013290.1.8096 WP_000013290.1.80973 WP_000013290.1.81037 WP_000013290.1.81041 WP_000013290.1.8106 WP_000013290.1.81069 WP_000013290.1.81084 WP_000013290.1.81107 WP_000013290.1.81109 WP_000013290.1.81110 WP_000013290.1.81149 WP_000013290.1.81175 WP_000013290.1.8119 WP_000013290.1.81193 WP_000013290.1.81197 WP_000013290.1.81225 WP_000013290.1.8130 WP_000013290.1.81321 WP_000013290.1.8134 WP_000013290.1.81354 WP_000013290.1.81388 WP_000013290.1.81404 WP_000013290.1.81410 WP_000013290.1.81425 WP_000013290.1.81568 WP_000013290.1.81667 WP_000013290.1.81668 WP_000013290.1.81750 WP_000013290.1.81760 WP_000013290.1.81768 WP_000013290.1.81785 WP_000013290.1.81798 WP_000013290.1.81902 WP_000013290.1.81941 WP_000013290.1.8196 WP_000013290.1.81965 WP_000013290.1.81974 WP_000013290.1.81977 WP_000013290.1.82037 WP_000013290.1.82099 WP_000013290.1.82149 WP_000013290.1.82337 WP_000013290.1.82347 WP_000013290.1.82395 WP_000013290.1.82401 WP_000013290.1.82420 WP_000013290.1.82434 WP_000013290.1.8247 WP_000013290.1.82474 WP_000013290.1.82479 WP_000013290.1.82503 WP_000013290.1.82515 WP_000013290.1.82529 WP_000013290.1.82569 WP_000013290.1.82584 WP_000013290.1.82692 WP_000013290.1.82761 WP_000013290.1.8282 WP_000013290.1.82843 WP_000013290.1.82867 WP_000013290.1.82895 WP_000013290.1.82944 WP_000013290.1.82956 WP_000013290.1.82964 WP_000013290.1.82992 WP_000013290.1.83005 WP_000013290.1.83006 WP_000013290.1.83061 WP_000013290.1.83092 WP_000013290.1.83119 WP_000013290.1.83139 WP_000013290.1.83163 WP_000013290.1.83204 WP_000013290.1.8322 WP_000013290.1.83280 WP_000013290.1.83301 WP_000013290.1.83305 WP_000013290.1.83331 WP_000013290.1.83354 WP_000013290.1.83356 WP_000013290.1.83365 WP_000013290.1.83413 WP_000013290.1.83491 WP_000013290.1.83516 WP_000013290.1.83523 WP_000013290.1.8354 WP_000013290.1.83558 WP_000013290.1.83598 WP_000013290.1.83710 WP_000013290.1.83721 WP_000013290.1.83759 WP_000013290.1.83760 WP_000013290.1.83806 WP_000013290.1.83897 WP_000013290.1.83960 WP_000013290.1.8399 WP_000013290.1.83995 WP_000013290.1.84000 WP_000013290.1.84011 WP_000013290.1.84031 WP_000013290.1.84075 WP_000013290.1.84077 WP_000013290.1.84083 WP_000013290.1.84086 WP_000013290.1.84103 WP_000013290.1.84154 WP_000013290.1.84179 WP_000013290.1.84283 WP_000013290.1.84300 WP_000013290.1.84373 WP_000013290.1.84392 WP_000013290.1.8441 WP_000013290.1.84459 WP_000013290.1.84497 WP_000013290.1.84515 WP_000013290.1.84532 WP_000013290.1.84554 WP_000013290.1.84572 WP_000013290.1.84598 WP_000013290.1.84644 WP_000013290.1.84659 WP_000013290.1.84683 WP_000013290.1.84693 WP_000013290.1.84711 WP_000013290.1.84814 WP_000013290.1.84872 WP_000013290.1.84876 WP_000013290.1.84879 WP_000013290.1.84899 WP_000013290.1.8497 WP_000013290.1.84983 WP_000013290.1.85014 WP_000013290.1.85040 WP_000013290.1.85079 WP_000013290.1.85120 WP_000013290.1.85126 WP_000013290.1.85134 WP_000013290.1.85147 WP_000013290.1.85178 WP_000013290.1.85190 WP_000013290.1.8526 WP_000013290.1.85271 WP_000013290.1.85301 WP_000013290.1.8533 WP_000013290.1.8537 WP_000013290.1.8545 WP_000013290.1.85456 WP_000013290.1.85483 WP_000013290.1.8552 WP_000013290.1.85541 WP_000013290.1.8556 WP_000013290.1.85615 WP_000013290.1.85617 WP_000013290.1.85663 WP_000013290.1.85671 WP_000013290.1.85672 WP_000013290.1.85742 WP_000013290.1.85759 WP_000013290.1.85777 WP_000013290.1.85780 WP_000013290.1.85854 WP_000013290.1.85855 WP_000013290.1.85864 WP_000013290.1.85886 WP_000013290.1.85900 WP_000013290.1.85904 WP_000013290.1.85943 WP_000013290.1.85976 WP_000013290.1.85982 WP_000013290.1.86017 WP_000013290.1.86138 WP_000013290.1.86157 WP_000013290.1.8616 WP_000013290.1.86224 WP_000013290.1.86285 WP_000013290.1.86306 WP_000013290.1.86316 WP_000013290.1.86335 WP_000013290.1.86347 WP_000013290.1.86356 WP_000013290.1.86380 WP_000013290.1.86389 WP_000013290.1.86450 WP_000013290.1.86466 WP_000013290.1.86469 WP_000013290.1.8647 WP_000013290.1.86514 WP_000013290.1.86580 WP_000013290.1.86588 WP_000013290.1.86593 WP_000013290.1.86601 WP_000013290.1.86610 WP_000013290.1.86634 WP_000013290.1.86661 WP_000013290.1.8672 WP_000013290.1.8678 WP_000013290.1.86807 WP_000013290.1.86810 WP_000013290.1.8684 WP_000013290.1.86860 WP_000013290.1.86895 WP_000013290.1.86906 WP_000013290.1.86915 WP_000013290.1.86982 WP_000013290.1.87038 WP_000013290.1.87051 WP_000013290.1.87095 WP_000013290.1.87187 WP_000013290.1.87219 WP_000013290.1.8722 WP_000013290.1.87220 WP_000013290.1.87265 WP_000013290.1.87276 WP_000013290.1.87323 WP_000013290.1.8736 WP_000013290.1.87365 WP_000013290.1.87376 WP_000013290.1.87460 WP_000013290.1.87484 WP_000013290.1.87500 WP_000013290.1.87552 WP_000013290.1.87583 WP_000013290.1.87618 WP_000013290.1.87651 WP_000013290.1.87687 WP_000013290.1.87712 WP_000013290.1.87779 WP_000013290.1.87891 WP_000013290.1.87905 WP_000013290.1.87945 WP_000013290.1.87999 WP_000013290.1.88019 WP_000013290.1.88052 WP_000013290.1.88073 WP_000013290.1.8809 WP_000013290.1.88185 WP_000013290.1.88244 WP_000013290.1.88264 WP_000013290.1.88275 WP_000013290.1.88291 WP_000013290.1.88293 WP_000013290.1.88356 WP_000013290.1.8837 WP_000013290.1.88393 WP_000013290.1.88474 WP_000013290.1.8849 WP_000013290.1.88508 WP_000013290.1.88651 WP_000013290.1.88698 WP_000013290.1.88703 WP_000013290.1.88731 WP_000013290.1.88762 WP_000013290.1.88792 WP_000013290.1.88817 WP_000013290.1.88845 WP_000013290.1.88854 WP_000013290.1.88902 WP_000013290.1.8891 WP_000013290.1.88942 WP_000013290.1.88966 WP_000013290.1.88967 WP_000013290.1.88968 WP_000013290.1.88981 WP_000013290.1.88998 WP_000013290.1.89008 WP_000013290.1.89116 WP_000013290.1.89120 WP_000013290.1.89138 WP_000013290.1.89177 WP_000013290.1.89221 WP_000013290.1.89304 WP_000013290.1.89311 WP_000013290.1.89362 WP_000013290.1.89408 WP_000013290.1.89425 WP_000013290.1.89452 WP_000013290.1.89462 WP_000013290.1.89512 WP_000013290.1.89527 WP_000013290.1.89570 WP_000013290.1.8958 WP_000013290.1.89604 WP_000013290.1.89606 WP_000013290.1.8961 WP_000013290.1.89622 WP_000013290.1.89632 WP_000013290.1.89634 WP_000013290.1.89659 WP_000013290.1.89680 WP_000013290.1.89764 WP_000013290.1.89789 WP_000013290.1.89832 WP_000013290.1.89870 WP_000013290.1.89902 WP_000013290.1.89940 WP_000013290.1.8996 WP_000013290.1.89965 WP_000013290.1.89975 WP_000013290.1.9002 WP_000013290.1.9003 WP_000013290.1.90084 WP_000013290.1.90097 WP_000013290.1.90211 WP_000013290.1.90248 WP_000013290.1.90252 WP_000013290.1.90409 WP_000013290.1.90417 WP_000013290.1.90421 WP_000013290.1.90440 WP_000013290.1.90453 WP_000013290.1.90458 WP_000013290.1.90472 WP_000013290.1.90522 WP_000013290.1.90540 WP_000013290.1.90557 WP_000013290.1.90563 WP_000013290.1.90566 WP_000013290.1.90585 WP_000013290.1.9064 WP_000013290.1.90641 WP_000013290.1.90686 WP_000013290.1.90701 WP_000013290.1.90734 WP_000013290.1.90748 WP_000013290.1.90759 WP_000013290.1.90814 WP_000013290.1.90859 WP_000013290.1.90866 WP_000013290.1.9093 WP_000013290.1.90959 WP_000013290.1.90973 WP_000013290.1.90984 WP_000013290.1.91003 WP_000013290.1.91049 WP_000013290.1.91069 WP_000013290.1.91107 WP_000013290.1.91156 WP_000013290.1.91189 WP_000013290.1.91215 WP_000013290.1.91278 WP_000013290.1.91282 WP_000013290.1.9131 WP_000013290.1.91312 WP_000013290.1.91331 WP_000013290.1.9137 WP_000013290.1.91372 WP_000013290.1.91424 WP_000013290.1.91474 WP_000013290.1.91505 WP_000013290.1.91512 WP_000013290.1.91580 WP_000013290.1.91628 WP_000013290.1.91655 WP_000013290.1.9166 WP_000013290.1.91724 WP_000013290.1.91732 WP_000013290.1.91742 WP_000013290.1.91772 WP_000013290.1.91776 WP_000013290.1.91788 WP_000013290.1.91795 WP_000013290.1.91806 WP_000013290.1.91898 WP_000013290.1.91904 WP_000013290.1.91974 WP_000013290.1.91984 WP_000013290.1.92013 WP_000013290.1.92044 WP_000013290.1.92047 WP_000013290.1.92060 WP_000013290.1.92082 WP_000013290.1.92093 WP_000013290.1.92108 WP_000013290.1.92122 WP_000013290.1.92129 WP_000013290.1.92171 WP_000013290.1.92183 WP_000013290.1.92208 WP_000013290.1.9222 WP_000013290.1.92268 WP_000013290.1.92310 WP_000013290.1.92318 WP_000013290.1.92375 WP_000013290.1.92439 WP_000013290.1.92443 WP_000013290.1.92452 WP_000013290.1.92482 WP_000013290.1.92529 WP_000013290.1.92531 WP_000013290.1.92557 WP_000013290.1.92628 WP_000013290.1.92646 WP_000013290.1.92659 WP_000013290.1.92669 WP_000013290.1.92671 WP_000013290.1.92738 WP_000013290.1.92758 WP_000013290.1.92786 WP_000013290.1.92806 WP_000013290.1.92832 WP_000013290.1.92842 WP_000013290.1.92890 WP_000013290.1.92929 WP_000013290.1.92936 WP_000013290.1.92939 WP_000013290.1.92988 WP_000013290.1.93076 WP_000013290.1.93086 WP_000013290.1.93101 WP_000013290.1.93118 WP_000013290.1.93136 WP_000013290.1.93155 WP_000013290.1.93213 WP_000013290.1.93215 WP_000013290.1.93275 WP_000013290.1.93350 WP_000013290.1.93365 WP_000013290.1.93376 WP_000013290.1.93524 WP_000013290.1.93543 WP_000013290.1.93577 WP_000013290.1.93596 WP_000013290.1.93650 WP_000013290.1.93656 WP_000013290.1.93662 WP_000013290.1.93691 WP_000013290.1.937 WP_000013290.1.93705 WP_000013290.1.93741 WP_000013290.1.93761 WP_000013290.1.9380 WP_000013290.1.93804 WP_000013290.1.93809 WP_000013290.1.9389 WP_000013290.1.93956 WP_000013290.1.93994 WP_000013290.1.94039 WP_000013290.1.94071 WP_000013290.1.94072 WP_000013290.1.94132 WP_000013290.1.94162 WP_000013290.1.94168 WP_000013290.1.94198 WP_000013290.1.9432 WP_000013290.1.94352 WP_000013290.1.94354 WP_000013290.1.94379 WP_000013290.1.94380 WP_000013290.1.9440 WP_000013290.1.94473 WP_000013290.1.94562 WP_000013290.1.94565 WP_000013290.1.94584 WP_000013290.1.94598 WP_000013290.1.94622 WP_000013290.1.94649 WP_000013290.1.94670 WP_000013290.1.94674 WP_000013290.1.94796 WP_000013290.1.9481 WP_000013290.1.94817 WP_000013290.1.94835 WP_000013290.1.94959 WP_000013290.1.94982 WP_000013290.1.95051 WP_000013290.1.95085 WP_000013290.1.95121 WP_000013290.1.95133 WP_000013290.1.95136 WP_000013290.1.9516 WP_000013290.1.95249 WP_000013290.1.9527 WP_000013290.1.95282 WP_000013290.1.95289 WP_000013290.1.95298 WP_000013290.1.95320 WP_000013290.1.95434 WP_000013290.1.95447 WP_000013290.1.95456 WP_000013290.1.95546 WP_000013290.1.95579 WP_000013290.1.95607 WP_000013290.1.95641 WP_000013290.1.95656 WP_000013290.1.95703 WP_000013290.1.95757 WP_000013290.1.95840 WP_000013290.1.9586 WP_000013290.1.95866 WP_000013290.1.95911 WP_000013290.1.95940 WP_000013290.1.95963 WP_000013290.1.9609 WP_000013290.1.96107 WP_000013290.1.96139 WP_000013290.1.96172 WP_000013290.1.96206 WP_000013290.1.9624 WP_000013290.1.96260 WP_000013290.1.96317 WP_000013290.1.96340 WP_000013290.1.96343 WP_000013290.1.96348 WP_000013290.1.96349 WP_000013290.1.96380 WP_000013290.1.96469 WP_000013290.1.96497 WP_000013290.1.96500 WP_000013290.1.96521 WP_000013290.1.96537 WP_000013290.1.96555 WP_000013290.1.96563 WP_000013290.1.96588 WP_000013290.1.96590 WP_000013290.1.96662 WP_000013290.1.96731 WP_000013290.1.96732 WP_000013290.1.96735 WP_000013290.1.96758 WP_000013290.1.96771 WP_000013290.1.96798 WP_000013290.1.96876 WP_000013290.1.96917 WP_000013290.1.96993 WP_000013290.1.97015 WP_000013290.1.97043 WP_000013290.1.97103 WP_000013290.1.97109 WP_000013290.1.97145 WP_000013290.1.97190 WP_000013290.1.97318 WP_000013290.1.97322 WP_000013290.1.97328 WP_000013290.1.97337 WP_000013290.1.97368 WP_000013290.1.97369 WP_000013290.1.97480 WP_000013290.1.97547 WP_000013290.1.97594 WP_000013290.1.97613 WP_000013290.1.97620 WP_000013290.1.97626 WP_000013290.1.97640 WP_000013290.1.97648 WP_000013290.1.97656 WP_000013290.1.97704 WP_000013290.1.97727 WP_000013290.1.97732 WP_000013290.1.97736 WP_000013290.1.9774 WP_000013290.1.9775 WP_000013290.1.97772 WP_000013290.1.97800 WP_000013290.1.97846 WP_000013290.1.97873 WP_000013290.1.97907 WP_000013290.1.9793 WP_000013290.1.97981 WP_000013290.1.97983 WP_000013290.1.98006 WP_000013290.1.98019 WP_000013290.1.98022 WP_000013290.1.98110 WP_000013290.1.98119 WP_000013290.1.98124 WP_000013290.1.98146 WP_000013290.1.98219 WP_000013290.1.98236 WP_000013290.1.98250 WP_000013290.1.98314 WP_000013290.1.98338 WP_000013290.1.98392 WP_000013290.1.9841 WP_000013290.1.98440 WP_000013290.1.98472 WP_000013290.1.98495 WP_000013290.1.98513 WP_000013290.1.98531 WP_000013290.1.98551 WP_000013290.1.98570 WP_000013290.1.98577 WP_000013290.1.98634 WP_000013290.1.98676 WP_000013290.1.98677 WP_000013290.1.98726 WP_000013290.1.98760 WP_000013290.1.98763 WP_000013290.1.98843 WP_000013290.1.98947 WP_000013290.1.9898 WP_000013290.1.9899 WP_000013290.1.99040 WP_000013290.1.99057 WP_000013290.1.99073 WP_000013290.1.99097 WP_000013290.1.99098 WP_000013290.1.99164 WP_000013290.1.99184 WP_000013290.1.9919 WP_000013290.1.99215 WP_000013290.1.99267 WP_000013290.1.99276 WP_000013290.1.99456 WP_000013290.1.99490 WP_000013290.1.99493 WP_000013290.1.99531 WP_000013290.1.9954 WP_000013290.1.99561 WP_000013290.1.99613 WP_000013290.1.99630 WP_000013290.1.99646 WP_000013290.1.99657 WP_000013290.1.99660 WP_000013290.1.99712 WP_000013290.1.99725 WP_000013290.1.99783 WP_000013290.1.99813 WP_000013290.1.99858 WP_000013290.1.99889 WP_000013290.1.99924 WP_000013290.1.99958 WP_000013290.1.99961 gi|526218132|ref|YP_008263221.1| gi|378447387|ref|YP_005235019.1| gi|549481254|ref|YP_008615660.1| gi|207859240|ref|YP_002245891.1| gi|197364824|ref|YP_002144461.1| 367048 gi|378986735|ref|YP_005249891.1| gi|56415895|ref|YP_152970.1| gi|525839940|ref|YP_008257352.1| 272994.SPAB_05016 295319.SPA3892 423368.SNSL254_A4332 550537.SEN3840 554290.SSPA3620 99287.STM4049 gi|550903409|ref|YP_008672501.1| gi|378452963|ref|YP_005240323.1| ABAM02000001|CDS_4627826-4628674 ABAO01000008|CDS_36060-36908 ABEW01000011|CDS_59997-60845 ABFG01000008|CDS_100179-99331 ABFH02000001|CDS_876856-876008 AE006468|CDS_4260054-4260902 AM933172|CDS_4128836-4129684 CP000026|CDS_4038091-4038939 CP000886|CDS_4201118-4201966 CP001113|CDS_4220370-4221218 CP001363|CDS_4273638-4274486 FM200053|CDS_4033775-4034623 FN424405|CDS_4282809-4283657 NZ_ACBF01000011|CDS_45260-46108 gi|549726576|ref|YP_008646766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]