SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378452988|ref|YP_005240348.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378452988|ref|YP_005240348.1|
Domain Number 1 Region: 24-115
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.13e-24
Family TM1287-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378452988|ref|YP_005240348.1|
Sequence length 116
Comment putative mannose-6-phosphate isomerase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MQKTNEKNHEYRFGDNGPKYLIRGPGCDMGVVILQPGQSFPNHRHNTACEIFYTLSGEVC
LYLEGTPHILQTGDVLQCEPGEAHYLINNGDKPWKGVFIKSPHLENDSHPADPPAW
Download sequence
Identical sequences A0A0D6IQF2 A0A0F6B9Q0 A0A0F7JBV6 A0A0H2WV00 A0A0H3BMV4 A0A0M0Q275 A0A0N1QUT9 A0A0R9P7T3 A0A0T9WNH8 A0A0U1K2W9 A0A1C3A0C8 A0A1S0Z9T7 A0A265AZR4 A0A271CEI5 A0A2C6FT13 A0A2D3AIZ6 A0A2D3U1T4 A0A2H9YF37 A0A2I6ME70 A0A2I6MRQ8 A0A2I6N5M9 A0A2I6NJ17 A0A2I6NWX8 A0A2I6PAR1 C0Q421 E8XKD8 G5LWF3 G5QB08 G5QP35
gi|194443190|ref|YP_002043332.1| gi|161617203|ref|YP_001591168.1| gi|383498670|ref|YP_005399359.1| gi|386589422|ref|YP_006085822.1| gi|194451199|ref|YP_002048073.1| gi|525841226|ref|YP_008257329.1| gi|379703317|ref|YP_005245045.1| gi|378986758|ref|YP_005249914.1| gi|194735168|ref|YP_002116992.1| gi|526221730|ref|YP_008263198.1| gi|482906622|ref|YP_007905182.1| gi|56415916|ref|YP_152991.1| gi|525815376|ref|YP_008245394.1| WP_001173080.1.11405 WP_001173080.1.13311 WP_001173080.1.14706 WP_001173080.1.1489 WP_001173080.1.15079 WP_001173080.1.15784 WP_001173080.1.1814 WP_001173080.1.19749 WP_001173080.1.20330 WP_001173080.1.2581 WP_001173080.1.2829 WP_001173080.1.30246 WP_001173080.1.30803 WP_001173080.1.32408 WP_001173080.1.43149 WP_001173080.1.53328 WP_001173080.1.57418 WP_001173080.1.62184 WP_001173080.1.64674 WP_001173080.1.76529 WP_001173080.1.78110 WP_001173080.1.7956 WP_001173080.1.80939 WP_001173080.1.8545 WP_001173080.1.85654 WP_001173080.1.89291 WP_001173080.1.94458 WP_001173080.1.94557 gi|525830515|ref|YP_008251141.1| gi|224585882|ref|YP_002639681.1| gi|538364658|ref|YP_008507943.1| gi|378452988|ref|YP_005240348.1| gi|528821326|ref|YP_008362529.1| ABAM02000001|CDS_4648366-4648016 ABAN01000010|CDS_70227-70577 ABAO01000008|CDS_87654-87304 ABEH02000008|CDS_182114-181764 ABEJ01000012|CDS_77864-77514 ABEL01000012|CDS_62691-63041 ABFG01000008|CDS_79634-79984 CP000026|CDS_4058637-4058287 CP000857|CDS_4252963-4252613 CP000886|CDS_4221985-4221635 CP001113|CDS_4272209-4271859 CP001120|CDS_4284974-4284624 CP001127|CDS_4157641-4157291 CP001363|CDS_4294176-4293826 FM200053|CDS_4054321-4053971 gi|197364843|ref|YP_002144480.1| gi|452122153|ref|YP_007472401.1| 272994.SPAB_05044 295319.SPA3914 423368.SNSL254_A4399 439843.SeSA_A4287 454169.SeHA_C4402 476213.SPC_4177 554290.SSPA3642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]