SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453135|ref|YP_005240495.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453135|ref|YP_005240495.1|
Domain Number 1 Region: 16-187
Classification Level Classification E-value
Superfamily Phage tail proteins 7.94e-23
Family Baseplate protein-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378453135|ref|YP_005240495.1|
Sequence length 347
Comment putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MAEITVSGGVFATLTPIFTLWYGHKEITYDIAPYVTSISYSDSIKNESDVIAIALEDSTG
RWVNEWYPGKGDTLALRLGYQGEDLLDCGIYVIDKIDISAPPSTVNIDGIATSVSKALRT
KNSQGFEETTLSAIASRIAQKHGLTLAGKIAPLTIDRVTQYAETDVAFLKRLASEYGYTV
KVTATELIFSHLPTLRCLAPVKTLRRTDVSHYTFKDTINRIYKNATVQHQNSKQKELVIY
THDSQEKTSARGAATSADTLKINSRAPDTGAAQAKANAALDSHNEYQQTGTLSLMGCPQL
TAGNKIELSDFGVLSGQWLIDKSMHKLTRSGGYTTEIDISRGPATSQ
Download sequence
Identical sequences A0A0D6HV64 A0A0F6BA47 A0A0F7JE27 A0A0H3NID7 A0A0M0QP54 A0A0T9XKR4 A0A0U1K4E2 A0A265AZH2 A0A2D3AJF8 A0A2H9YCQ8 E8X8W8 Q8ZKJ7
gi|378991476|ref|YP_005254640.1| gi|16767458|ref|NP_463073.1| gi|379703446|ref|YP_005245174.1| gi|378702051|ref|YP_005184009.1| gi|194450026|ref|YP_002048195.1| ABAM02000001|CDS_65501-64458 ABAO01000007|CDS_29491-28448 ABEL01000009|CDS_30096-29053 AE006468|CDS_4429384-4428341 CP001120|CDS_4425332-4424289 CP001363|CDS_4442923-4441880 FN424405|CDS_4452092-4451049 gi|378447528|ref|YP_005235160.1| gi|383498789|ref|YP_005399478.1| gi|525839821|ref|YP_008257207.1| gi|538364783|ref|YP_008508068.1| gi|378453135|ref|YP_005240495.1| NP_463073.1.58477 WP_000818154.1.100010 WP_000818154.1.100234 WP_000818154.1.100376 WP_000818154.1.100424 WP_000818154.1.100436 WP_000818154.1.100484 WP_000818154.1.100488 WP_000818154.1.100597 WP_000818154.1.100730 WP_000818154.1.10076 WP_000818154.1.100781 WP_000818154.1.100793 WP_000818154.1.100869 WP_000818154.1.100871 WP_000818154.1.100882 WP_000818154.1.101007 WP_000818154.1.101020 WP_000818154.1.101074 WP_000818154.1.101078 WP_000818154.1.101180 WP_000818154.1.101259 WP_000818154.1.101284 WP_000818154.1.101291 WP_000818154.1.1013 WP_000818154.1.101353 WP_000818154.1.101386 WP_000818154.1.101404 WP_000818154.1.101420 WP_000818154.1.101589 WP_000818154.1.101707 WP_000818154.1.101734 WP_000818154.1.101878 WP_000818154.1.101953 WP_000818154.1.10220 WP_000818154.1.10231 WP_000818154.1.10266 WP_000818154.1.10429 WP_000818154.1.10439 WP_000818154.1.10566 WP_000818154.1.10678 WP_000818154.1.10753 WP_000818154.1.10992 WP_000818154.1.11024 WP_000818154.1.11031 WP_000818154.1.11098 WP_000818154.1.1110 WP_000818154.1.11156 WP_000818154.1.11168 WP_000818154.1.11190 WP_000818154.1.11295 WP_000818154.1.11455 WP_000818154.1.11458 WP_000818154.1.11518 WP_000818154.1.11532 WP_000818154.1.11543 WP_000818154.1.11588 WP_000818154.1.11677 WP_000818154.1.11687 WP_000818154.1.11735 WP_000818154.1.11763 WP_000818154.1.11772 WP_000818154.1.11834 WP_000818154.1.11897 WP_000818154.1.12017 WP_000818154.1.12114 WP_000818154.1.12280 WP_000818154.1.12351 WP_000818154.1.12370 WP_000818154.1.12546 WP_000818154.1.1264 WP_000818154.1.12728 WP_000818154.1.12879 WP_000818154.1.12936 WP_000818154.1.12995 WP_000818154.1.13027 WP_000818154.1.13106 WP_000818154.1.13130 WP_000818154.1.13207 WP_000818154.1.13414 WP_000818154.1.13488 WP_000818154.1.13509 WP_000818154.1.13661 WP_000818154.1.13669 WP_000818154.1.13741 WP_000818154.1.1387 WP_000818154.1.13908 WP_000818154.1.13932 WP_000818154.1.13968 WP_000818154.1.14001 WP_000818154.1.14111 WP_000818154.1.14151 WP_000818154.1.14239 WP_000818154.1.14320 WP_000818154.1.14379 WP_000818154.1.14406 WP_000818154.1.14410 WP_000818154.1.14436 WP_000818154.1.14458 WP_000818154.1.14466 WP_000818154.1.14524 WP_000818154.1.14554 WP_000818154.1.14618 WP_000818154.1.14725 WP_000818154.1.14852 WP_000818154.1.1489 WP_000818154.1.14932 WP_000818154.1.15055 WP_000818154.1.15079 WP_000818154.1.15124 WP_000818154.1.15223 WP_000818154.1.15226 WP_000818154.1.15316 WP_000818154.1.15369 WP_000818154.1.1540 WP_000818154.1.15508 WP_000818154.1.15784 WP_000818154.1.15830 WP_000818154.1.15862 WP_000818154.1.15909 WP_000818154.1.15910 WP_000818154.1.15986 WP_000818154.1.16004 WP_000818154.1.16047 WP_000818154.1.16062 WP_000818154.1.16063 WP_000818154.1.16103 WP_000818154.1.16226 WP_000818154.1.16233 WP_000818154.1.16284 WP_000818154.1.16328 WP_000818154.1.1635 WP_000818154.1.16361 WP_000818154.1.16468 WP_000818154.1.16525 WP_000818154.1.16614 WP_000818154.1.16650 WP_000818154.1.16686 WP_000818154.1.16691 WP_000818154.1.16732 WP_000818154.1.16735 WP_000818154.1.16786 WP_000818154.1.16858 WP_000818154.1.16873 WP_000818154.1.16896 WP_000818154.1.16903 WP_000818154.1.16965 WP_000818154.1.1700 WP_000818154.1.17093 WP_000818154.1.17307 WP_000818154.1.174 WP_000818154.1.17480 WP_000818154.1.17546 WP_000818154.1.17702 WP_000818154.1.17705 WP_000818154.1.17743 WP_000818154.1.17891 WP_000818154.1.1798 WP_000818154.1.18019 WP_000818154.1.18111 WP_000818154.1.18122 WP_000818154.1.18163 WP_000818154.1.1818 WP_000818154.1.18254 WP_000818154.1.18265 WP_000818154.1.18267 WP_000818154.1.18281 WP_000818154.1.18282 WP_000818154.1.18468 WP_000818154.1.18607 WP_000818154.1.18705 WP_000818154.1.18715 WP_000818154.1.18776 WP_000818154.1.18822 WP_000818154.1.18881 WP_000818154.1.18940 WP_000818154.1.18949 WP_000818154.1.19053 WP_000818154.1.19273 WP_000818154.1.19320 WP_000818154.1.19458 WP_000818154.1.19460 WP_000818154.1.19461 WP_000818154.1.19588 WP_000818154.1.19614 WP_000818154.1.19616 WP_000818154.1.19702 WP_000818154.1.19706 WP_000818154.1.19724 WP_000818154.1.19749 WP_000818154.1.19784 WP_000818154.1.19802 WP_000818154.1.19809 WP_000818154.1.19867 WP_000818154.1.19975 WP_000818154.1.1998 WP_000818154.1.20 WP_000818154.1.2010 WP_000818154.1.20119 WP_000818154.1.20212 WP_000818154.1.20266 WP_000818154.1.20271 WP_000818154.1.20362 WP_000818154.1.20418 WP_000818154.1.20443 WP_000818154.1.20446 WP_000818154.1.20525 WP_000818154.1.2054 WP_000818154.1.20553 WP_000818154.1.20614 WP_000818154.1.20626 WP_000818154.1.20646 WP_000818154.1.20886 WP_000818154.1.20908 WP_000818154.1.21049 WP_000818154.1.21136 WP_000818154.1.21146 WP_000818154.1.21245 WP_000818154.1.21246 WP_000818154.1.21269 WP_000818154.1.21351 WP_000818154.1.21400 WP_000818154.1.21497 WP_000818154.1.21499 WP_000818154.1.21603 WP_000818154.1.21751 WP_000818154.1.21757 WP_000818154.1.21991 WP_000818154.1.22024 WP_000818154.1.2205 WP_000818154.1.22062 WP_000818154.1.22067 WP_000818154.1.2221 WP_000818154.1.22235 WP_000818154.1.2235 WP_000818154.1.22379 WP_000818154.1.22427 WP_000818154.1.2246 WP_000818154.1.22485 WP_000818154.1.22582 WP_000818154.1.22620 WP_000818154.1.22692 WP_000818154.1.22758 WP_000818154.1.22864 WP_000818154.1.22870 WP_000818154.1.22979 WP_000818154.1.23102 WP_000818154.1.23114 WP_000818154.1.2314 WP_000818154.1.23192 WP_000818154.1.23259 WP_000818154.1.23379 WP_000818154.1.23460 WP_000818154.1.23472 WP_000818154.1.23482 WP_000818154.1.23509 WP_000818154.1.23634 WP_000818154.1.2364 WP_000818154.1.23932 WP_000818154.1.23959 WP_000818154.1.24017 WP_000818154.1.24082 WP_000818154.1.24206 WP_000818154.1.24308 WP_000818154.1.24578 WP_000818154.1.24737 WP_000818154.1.24779 WP_000818154.1.25008 WP_000818154.1.25015 WP_000818154.1.25036 WP_000818154.1.25119 WP_000818154.1.25405 WP_000818154.1.25454 WP_000818154.1.25493 WP_000818154.1.25668 WP_000818154.1.25690 WP_000818154.1.2570 WP_000818154.1.25740 WP_000818154.1.25793 WP_000818154.1.25814 WP_000818154.1.25988 WP_000818154.1.26282 WP_000818154.1.26311 WP_000818154.1.26319 WP_000818154.1.26429 WP_000818154.1.26440 WP_000818154.1.26493 WP_000818154.1.26551 WP_000818154.1.26567 WP_000818154.1.26741 WP_000818154.1.26856 WP_000818154.1.26919 WP_000818154.1.27010 WP_000818154.1.27084 WP_000818154.1.27173 WP_000818154.1.27206 WP_000818154.1.27223 WP_000818154.1.27423 WP_000818154.1.27544 WP_000818154.1.27561 WP_000818154.1.2763 WP_000818154.1.27665 WP_000818154.1.27707 WP_000818154.1.27761 WP_000818154.1.2777 WP_000818154.1.27857 WP_000818154.1.27977 WP_000818154.1.28032 WP_000818154.1.28094 WP_000818154.1.28170 WP_000818154.1.28302 WP_000818154.1.2835 WP_000818154.1.28370 WP_000818154.1.28538 WP_000818154.1.28575 WP_000818154.1.28625 WP_000818154.1.28655 WP_000818154.1.28694 WP_000818154.1.2879 WP_000818154.1.2890 WP_000818154.1.28938 WP_000818154.1.28946 WP_000818154.1.29006 WP_000818154.1.29010 WP_000818154.1.2910 WP_000818154.1.29113 WP_000818154.1.29509 WP_000818154.1.29588 WP_000818154.1.29601 WP_000818154.1.29606 WP_000818154.1.29615 WP_000818154.1.29619 WP_000818154.1.29704 WP_000818154.1.29827 WP_000818154.1.29969 WP_000818154.1.29990 WP_000818154.1.30006 WP_000818154.1.30022 WP_000818154.1.30027 WP_000818154.1.30180 WP_000818154.1.30202 WP_000818154.1.30469 WP_000818154.1.30505 WP_000818154.1.30507 WP_000818154.1.30535 WP_000818154.1.30547 WP_000818154.1.30794 WP_000818154.1.30833 WP_000818154.1.30835 WP_000818154.1.30972 WP_000818154.1.31 WP_000818154.1.31092 WP_000818154.1.31122 WP_000818154.1.3113 WP_000818154.1.31185 WP_000818154.1.3119 WP_000818154.1.31190 WP_000818154.1.31195 WP_000818154.1.31196 WP_000818154.1.31251 WP_000818154.1.31281 WP_000818154.1.31362 WP_000818154.1.31451 WP_000818154.1.31504 WP_000818154.1.31515 WP_000818154.1.31578 WP_000818154.1.31658 WP_000818154.1.31940 WP_000818154.1.31967 WP_000818154.1.31972 WP_000818154.1.32192 WP_000818154.1.32206 WP_000818154.1.32260 WP_000818154.1.32438 WP_000818154.1.32515 WP_000818154.1.32660 WP_000818154.1.32702 WP_000818154.1.32714 WP_000818154.1.32786 WP_000818154.1.32804 WP_000818154.1.32907 WP_000818154.1.33030 WP_000818154.1.33127 WP_000818154.1.33143 WP_000818154.1.33248 WP_000818154.1.33261 WP_000818154.1.333 WP_000818154.1.33492 WP_000818154.1.33553 WP_000818154.1.33580 WP_000818154.1.33592 WP_000818154.1.33825 WP_000818154.1.33894 WP_000818154.1.3394 WP_000818154.1.34043 WP_000818154.1.34075 WP_000818154.1.34257 WP_000818154.1.34279 WP_000818154.1.34319 WP_000818154.1.34417 WP_000818154.1.34453 WP_000818154.1.34610 WP_000818154.1.34856 WP_000818154.1.34975 WP_000818154.1.35045 WP_000818154.1.35129 WP_000818154.1.35184 WP_000818154.1.35193 WP_000818154.1.35404 WP_000818154.1.35408 WP_000818154.1.35425 WP_000818154.1.35446 WP_000818154.1.35463 WP_000818154.1.35503 WP_000818154.1.35509 WP_000818154.1.35590 WP_000818154.1.35892 WP_000818154.1.35940 WP_000818154.1.36003 WP_000818154.1.3601 WP_000818154.1.36017 WP_000818154.1.36547 WP_000818154.1.36609 WP_000818154.1.36690 WP_000818154.1.3670 WP_000818154.1.36705 WP_000818154.1.36918 WP_000818154.1.36931 WP_000818154.1.37063 WP_000818154.1.37073 WP_000818154.1.37111 WP_000818154.1.37112 WP_000818154.1.37256 WP_000818154.1.37293 WP_000818154.1.37370 WP_000818154.1.37376 WP_000818154.1.3744 WP_000818154.1.37498 WP_000818154.1.37504 WP_000818154.1.37618 WP_000818154.1.37968 WP_000818154.1.37978 WP_000818154.1.38125 WP_000818154.1.38145 WP_000818154.1.383 WP_000818154.1.38393 WP_000818154.1.3848 WP_000818154.1.38569 WP_000818154.1.38613 WP_000818154.1.38673 WP_000818154.1.38693 WP_000818154.1.38773 WP_000818154.1.38781 WP_000818154.1.38882 WP_000818154.1.38913 WP_000818154.1.39003 WP_000818154.1.39136 WP_000818154.1.39197 WP_000818154.1.39229 WP_000818154.1.39265 WP_000818154.1.39420 WP_000818154.1.39449 WP_000818154.1.39512 WP_000818154.1.39584 WP_000818154.1.39629 WP_000818154.1.39724 WP_000818154.1.39763 WP_000818154.1.39862 WP_000818154.1.39921 WP_000818154.1.39923 WP_000818154.1.40017 WP_000818154.1.40072 WP_000818154.1.40073 WP_000818154.1.4011 WP_000818154.1.40208 WP_000818154.1.40240 WP_000818154.1.40257 WP_000818154.1.40292 WP_000818154.1.40305 WP_000818154.1.40311 WP_000818154.1.40341 WP_000818154.1.40380 WP_000818154.1.40395 WP_000818154.1.40465 WP_000818154.1.40508 WP_000818154.1.40710 WP_000818154.1.4075 WP_000818154.1.4087 WP_000818154.1.40877 WP_000818154.1.40996 WP_000818154.1.41017 WP_000818154.1.41018 WP_000818154.1.41086 WP_000818154.1.41091 WP_000818154.1.41226 WP_000818154.1.41279 WP_000818154.1.41310 WP_000818154.1.41440 WP_000818154.1.41516 WP_000818154.1.41554 WP_000818154.1.41572 WP_000818154.1.41591 WP_000818154.1.41662 WP_000818154.1.41708 WP_000818154.1.41761 WP_000818154.1.41882 WP_000818154.1.41979 WP_000818154.1.41985 WP_000818154.1.42104 WP_000818154.1.42156 WP_000818154.1.4222 WP_000818154.1.42243 WP_000818154.1.42320 WP_000818154.1.42342 WP_000818154.1.42422 WP_000818154.1.42444 WP_000818154.1.42676 WP_000818154.1.4276 WP_000818154.1.42864 WP_000818154.1.4288 WP_000818154.1.43018 WP_000818154.1.43041 WP_000818154.1.43077 WP_000818154.1.43244 WP_000818154.1.43312 WP_000818154.1.43334 WP_000818154.1.43339 WP_000818154.1.43371 WP_000818154.1.43437 WP_000818154.1.43522 WP_000818154.1.43613 WP_000818154.1.43668 WP_000818154.1.43778 WP_000818154.1.43886 WP_000818154.1.43951 WP_000818154.1.44005 WP_000818154.1.44043 WP_000818154.1.44099 WP_000818154.1.44121 WP_000818154.1.44291 WP_000818154.1.44300 WP_000818154.1.44310 WP_000818154.1.44386 WP_000818154.1.44433 WP_000818154.1.44479 WP_000818154.1.44607 WP_000818154.1.44640 WP_000818154.1.4467 WP_000818154.1.44747 WP_000818154.1.4485 WP_000818154.1.44877 WP_000818154.1.44927 WP_000818154.1.44933 WP_000818154.1.45067 WP_000818154.1.45074 WP_000818154.1.45079 WP_000818154.1.45098 WP_000818154.1.45145 WP_000818154.1.45177 WP_000818154.1.45184 WP_000818154.1.45259 WP_000818154.1.45344 WP_000818154.1.45349 WP_000818154.1.45365 WP_000818154.1.45434 WP_000818154.1.45550 WP_000818154.1.45582 WP_000818154.1.45585 WP_000818154.1.45622 WP_000818154.1.45660 WP_000818154.1.45690 WP_000818154.1.458 WP_000818154.1.45848 WP_000818154.1.46011 WP_000818154.1.46069 WP_000818154.1.46112 WP_000818154.1.46173 WP_000818154.1.46174 WP_000818154.1.46187 WP_000818154.1.46278 WP_000818154.1.46303 WP_000818154.1.46434 WP_000818154.1.46595 WP_000818154.1.46675 WP_000818154.1.46749 WP_000818154.1.47008 WP_000818154.1.47057 WP_000818154.1.47067 WP_000818154.1.47214 WP_000818154.1.47429 WP_000818154.1.47448 WP_000818154.1.4747 WP_000818154.1.47472 WP_000818154.1.47478 WP_000818154.1.47579 WP_000818154.1.47621 WP_000818154.1.47799 WP_000818154.1.47928 WP_000818154.1.48253 WP_000818154.1.483 WP_000818154.1.48367 WP_000818154.1.48377 WP_000818154.1.4853 WP_000818154.1.48788 WP_000818154.1.4885 WP_000818154.1.48876 WP_000818154.1.48894 WP_000818154.1.48919 WP_000818154.1.49084 WP_000818154.1.49113 WP_000818154.1.49155 WP_000818154.1.49204 WP_000818154.1.49239 WP_000818154.1.49256 WP_000818154.1.49290 WP_000818154.1.49340 WP_000818154.1.49366 WP_000818154.1.49490 WP_000818154.1.49515 WP_000818154.1.49572 WP_000818154.1.49686 WP_000818154.1.4979 WP_000818154.1.49803 WP_000818154.1.49805 WP_000818154.1.49929 WP_000818154.1.50080 WP_000818154.1.50161 WP_000818154.1.50211 WP_000818154.1.50374 WP_000818154.1.50376 WP_000818154.1.50389 WP_000818154.1.50404 WP_000818154.1.50676 WP_000818154.1.50774 WP_000818154.1.50804 WP_000818154.1.50808 WP_000818154.1.5088 WP_000818154.1.50908 WP_000818154.1.50941 WP_000818154.1.50999 WP_000818154.1.51014 WP_000818154.1.51022 WP_000818154.1.51066 WP_000818154.1.51179 WP_000818154.1.51182 WP_000818154.1.51186 WP_000818154.1.51224 WP_000818154.1.51487 WP_000818154.1.51488 WP_000818154.1.51555 WP_000818154.1.51634 WP_000818154.1.51649 WP_000818154.1.51686 WP_000818154.1.51700 WP_000818154.1.51756 WP_000818154.1.51831 WP_000818154.1.51911 WP_000818154.1.51932 WP_000818154.1.51989 WP_000818154.1.52121 WP_000818154.1.52170 WP_000818154.1.52336 WP_000818154.1.52346 WP_000818154.1.52353 WP_000818154.1.52361 WP_000818154.1.52653 WP_000818154.1.52656 WP_000818154.1.52692 WP_000818154.1.52743 WP_000818154.1.52857 WP_000818154.1.52866 WP_000818154.1.52898 WP_000818154.1.52915 WP_000818154.1.52949 WP_000818154.1.52985 WP_000818154.1.53190 WP_000818154.1.53272 WP_000818154.1.53406 WP_000818154.1.53466 WP_000818154.1.53529 WP_000818154.1.53543 WP_000818154.1.53757 WP_000818154.1.53812 WP_000818154.1.53905 WP_000818154.1.54033 WP_000818154.1.54075 WP_000818154.1.54196 WP_000818154.1.54209 WP_000818154.1.54271 WP_000818154.1.54274 WP_000818154.1.54319 WP_000818154.1.54364 WP_000818154.1.54400 WP_000818154.1.54526 WP_000818154.1.54644 WP_000818154.1.54662 WP_000818154.1.54722 WP_000818154.1.54749 WP_000818154.1.54764 WP_000818154.1.55008 WP_000818154.1.55152 WP_000818154.1.55156 WP_000818154.1.5523 WP_000818154.1.55285 WP_000818154.1.55325 WP_000818154.1.55430 WP_000818154.1.55475 WP_000818154.1.5555 WP_000818154.1.5560 WP_000818154.1.55647 WP_000818154.1.55743 WP_000818154.1.55768 WP_000818154.1.55782 WP_000818154.1.55796 WP_000818154.1.55973 WP_000818154.1.56002 WP_000818154.1.56012 WP_000818154.1.56105 WP_000818154.1.56238 WP_000818154.1.56244 WP_000818154.1.56286 WP_000818154.1.56304 WP_000818154.1.56414 WP_000818154.1.56438 WP_000818154.1.56559 WP_000818154.1.56560 WP_000818154.1.56597 WP_000818154.1.56601 WP_000818154.1.56614 WP_000818154.1.56671 WP_000818154.1.56682 WP_000818154.1.56875 WP_000818154.1.57168 WP_000818154.1.57187 WP_000818154.1.57356 WP_000818154.1.57377 WP_000818154.1.57418 WP_000818154.1.57433 WP_000818154.1.57515 WP_000818154.1.57529 WP_000818154.1.57576 WP_000818154.1.57601 WP_000818154.1.57607 WP_000818154.1.57735 WP_000818154.1.57763 WP_000818154.1.57862 WP_000818154.1.57890 WP_000818154.1.57891 WP_000818154.1.57978 WP_000818154.1.5801 WP_000818154.1.58041 WP_000818154.1.58358 WP_000818154.1.58407 WP_000818154.1.58418 WP_000818154.1.58442 WP_000818154.1.58548 WP_000818154.1.5858 WP_000818154.1.58662 WP_000818154.1.58669 WP_000818154.1.58745 WP_000818154.1.58803 WP_000818154.1.58836 WP_000818154.1.5886 WP_000818154.1.59094 WP_000818154.1.59125 WP_000818154.1.59224 WP_000818154.1.59375 WP_000818154.1.59420 WP_000818154.1.59458 WP_000818154.1.59490 WP_000818154.1.59508 WP_000818154.1.59684 WP_000818154.1.59694 WP_000818154.1.59771 WP_000818154.1.5979 WP_000818154.1.59953 WP_000818154.1.60008 WP_000818154.1.60021 WP_000818154.1.60052 WP_000818154.1.60069 WP_000818154.1.60140 WP_000818154.1.60155 WP_000818154.1.60285 WP_000818154.1.60379 WP_000818154.1.60464 WP_000818154.1.60545 WP_000818154.1.60561 WP_000818154.1.60772 WP_000818154.1.60794 WP_000818154.1.60874 WP_000818154.1.60941 WP_000818154.1.61078 WP_000818154.1.6114 WP_000818154.1.61232 WP_000818154.1.6129 WP_000818154.1.61296 WP_000818154.1.61345 WP_000818154.1.61417 WP_000818154.1.61574 WP_000818154.1.61712 WP_000818154.1.61714 WP_000818154.1.61730 WP_000818154.1.61857 WP_000818154.1.61918 WP_000818154.1.61952 WP_000818154.1.62007 WP_000818154.1.62020 WP_000818154.1.62025 WP_000818154.1.6209 WP_000818154.1.62204 WP_000818154.1.62257 WP_000818154.1.62304 WP_000818154.1.62364 WP_000818154.1.62374 WP_000818154.1.62403 WP_000818154.1.6253 WP_000818154.1.62853 WP_000818154.1.62903 WP_000818154.1.62910 WP_000818154.1.62955 WP_000818154.1.63181 WP_000818154.1.63203 WP_000818154.1.63256 WP_000818154.1.63290 WP_000818154.1.63382 WP_000818154.1.63461 WP_000818154.1.63479 WP_000818154.1.63577 WP_000818154.1.63664 WP_000818154.1.63718 WP_000818154.1.6375 WP_000818154.1.63757 WP_000818154.1.63797 WP_000818154.1.63834 WP_000818154.1.64018 WP_000818154.1.64046 WP_000818154.1.6423 WP_000818154.1.64244 WP_000818154.1.64387 WP_000818154.1.64403 WP_000818154.1.64649 WP_000818154.1.64702 WP_000818154.1.64757 WP_000818154.1.64781 WP_000818154.1.64831 WP_000818154.1.6489 WP_000818154.1.64894 WP_000818154.1.65018 WP_000818154.1.65028 WP_000818154.1.65171 WP_000818154.1.65248 WP_000818154.1.65269 WP_000818154.1.6535 WP_000818154.1.65474 WP_000818154.1.65633 WP_000818154.1.6565 WP_000818154.1.65696 WP_000818154.1.6575 WP_000818154.1.65782 WP_000818154.1.65940 WP_000818154.1.65956 WP_000818154.1.66049 WP_000818154.1.6630 WP_000818154.1.66314 WP_000818154.1.66330 WP_000818154.1.66358 WP_000818154.1.66362 WP_000818154.1.6638 WP_000818154.1.6640 WP_000818154.1.66600 WP_000818154.1.66678 WP_000818154.1.66698 WP_000818154.1.6680 WP_000818154.1.66834 WP_000818154.1.66901 WP_000818154.1.66962 WP_000818154.1.67037 WP_000818154.1.67045 WP_000818154.1.67100 WP_000818154.1.67181 WP_000818154.1.67235 WP_000818154.1.67268 WP_000818154.1.67347 WP_000818154.1.6739 WP_000818154.1.67465 WP_000818154.1.67552 WP_000818154.1.67682 WP_000818154.1.67829 WP_000818154.1.67887 WP_000818154.1.68073 WP_000818154.1.68201 WP_000818154.1.68206 WP_000818154.1.6827 WP_000818154.1.68275 WP_000818154.1.68401 WP_000818154.1.68477 WP_000818154.1.6849 WP_000818154.1.68547 WP_000818154.1.68589 WP_000818154.1.68591 WP_000818154.1.68655 WP_000818154.1.68656 WP_000818154.1.68778 WP_000818154.1.68787 WP_000818154.1.68894 WP_000818154.1.68928 WP_000818154.1.68975 WP_000818154.1.69001 WP_000818154.1.69006 WP_000818154.1.6904 WP_000818154.1.6913 WP_000818154.1.69146 WP_000818154.1.69151 WP_000818154.1.69255 WP_000818154.1.69359 WP_000818154.1.69397 WP_000818154.1.6954 WP_000818154.1.69564 WP_000818154.1.69644 WP_000818154.1.69704 WP_000818154.1.69754 WP_000818154.1.69758 WP_000818154.1.7021 WP_000818154.1.70241 WP_000818154.1.70269 WP_000818154.1.70289 WP_000818154.1.70447 WP_000818154.1.70485 WP_000818154.1.70643 WP_000818154.1.70683 WP_000818154.1.70883 WP_000818154.1.70922 WP_000818154.1.70948 WP_000818154.1.70959 WP_000818154.1.71023 WP_000818154.1.71116 WP_000818154.1.71146 WP_000818154.1.71165 WP_000818154.1.71188 WP_000818154.1.71202 WP_000818154.1.71243 WP_000818154.1.71248 WP_000818154.1.71306 WP_000818154.1.71337 WP_000818154.1.71363 WP_000818154.1.71368 WP_000818154.1.71378 WP_000818154.1.71401 WP_000818154.1.71481 WP_000818154.1.71636 WP_000818154.1.71702 WP_000818154.1.71750 WP_000818154.1.71798 WP_000818154.1.71845 WP_000818154.1.71881 WP_000818154.1.71908 WP_000818154.1.71952 WP_000818154.1.71973 WP_000818154.1.72065 WP_000818154.1.72105 WP_000818154.1.72203 WP_000818154.1.72376 WP_000818154.1.72403 WP_000818154.1.72594 WP_000818154.1.72728 WP_000818154.1.72871 WP_000818154.1.72975 WP_000818154.1.73125 WP_000818154.1.7315 WP_000818154.1.73200 WP_000818154.1.7334 WP_000818154.1.73377 WP_000818154.1.73461 WP_000818154.1.73481 WP_000818154.1.7356 WP_000818154.1.73581 WP_000818154.1.73617 WP_000818154.1.73669 WP_000818154.1.73753 WP_000818154.1.73758 WP_000818154.1.73794 WP_000818154.1.73847 WP_000818154.1.7387 WP_000818154.1.73924 WP_000818154.1.73956 WP_000818154.1.74029 WP_000818154.1.74181 WP_000818154.1.74191 WP_000818154.1.7433 WP_000818154.1.74379 WP_000818154.1.74410 WP_000818154.1.74466 WP_000818154.1.745 WP_000818154.1.74529 WP_000818154.1.74545 WP_000818154.1.74745 WP_000818154.1.7491 WP_000818154.1.75129 WP_000818154.1.75187 WP_000818154.1.75288 WP_000818154.1.75334 WP_000818154.1.75362 WP_000818154.1.75385 WP_000818154.1.75392 WP_000818154.1.75760 WP_000818154.1.75764 WP_000818154.1.75828 WP_000818154.1.75837 WP_000818154.1.75874 WP_000818154.1.75884 WP_000818154.1.75945 WP_000818154.1.76020 WP_000818154.1.76024 WP_000818154.1.76252 WP_000818154.1.76327 WP_000818154.1.76445 WP_000818154.1.7660 WP_000818154.1.76673 WP_000818154.1.76706 WP_000818154.1.76721 WP_000818154.1.76756 WP_000818154.1.76760 WP_000818154.1.76875 WP_000818154.1.76880 WP_000818154.1.76899 WP_000818154.1.77038 WP_000818154.1.77047 WP_000818154.1.77080 WP_000818154.1.7712 WP_000818154.1.77177 WP_000818154.1.77180 WP_000818154.1.77244 WP_000818154.1.77267 WP_000818154.1.77292 WP_000818154.1.77349 WP_000818154.1.77514 WP_000818154.1.77529 WP_000818154.1.77549 WP_000818154.1.77692 WP_000818154.1.77710 WP_000818154.1.7782 WP_000818154.1.77851 WP_000818154.1.77898 WP_000818154.1.77918 WP_000818154.1.77960 WP_000818154.1.78033 WP_000818154.1.78076 WP_000818154.1.78096 WP_000818154.1.78100 WP_000818154.1.78110 WP_000818154.1.78120 WP_000818154.1.78372 WP_000818154.1.78383 WP_000818154.1.78407 WP_000818154.1.7861 WP_000818154.1.78618 WP_000818154.1.78673 WP_000818154.1.78735 WP_000818154.1.78802 WP_000818154.1.78830 WP_000818154.1.78835 WP_000818154.1.78838 WP_000818154.1.78871 WP_000818154.1.78874 WP_000818154.1.78918 WP_000818154.1.78930 WP_000818154.1.79151 WP_000818154.1.79167 WP_000818154.1.79335 WP_000818154.1.79462 WP_000818154.1.79472 WP_000818154.1.79490 WP_000818154.1.79495 WP_000818154.1.79529 WP_000818154.1.79570 WP_000818154.1.7964 WP_000818154.1.79642 WP_000818154.1.79659 WP_000818154.1.79668 WP_000818154.1.79708 WP_000818154.1.79734 WP_000818154.1.79845 WP_000818154.1.80077 WP_000818154.1.80137 WP_000818154.1.80182 WP_000818154.1.80296 WP_000818154.1.80366 WP_000818154.1.80741 WP_000818154.1.80780 WP_000818154.1.80831 WP_000818154.1.80850 WP_000818154.1.80881 WP_000818154.1.80939 WP_000818154.1.8096 WP_000818154.1.81037 WP_000818154.1.81069 WP_000818154.1.81149 WP_000818154.1.81175 WP_000818154.1.8119 WP_000818154.1.81193 WP_000818154.1.81305 WP_000818154.1.81320 WP_000818154.1.81328 WP_000818154.1.81354 WP_000818154.1.81425 WP_000818154.1.81528 WP_000818154.1.81735 WP_000818154.1.81750 WP_000818154.1.81760 WP_000818154.1.81785 WP_000818154.1.81902 WP_000818154.1.81974 WP_000818154.1.82192 WP_000818154.1.82232 WP_000818154.1.82337 WP_000818154.1.82395 WP_000818154.1.82464 WP_000818154.1.82479 WP_000818154.1.82503 WP_000818154.1.82515 WP_000818154.1.82584 WP_000818154.1.82676 WP_000818154.1.82761 WP_000818154.1.8282 WP_000818154.1.82944 WP_000818154.1.82956 WP_000818154.1.82992 WP_000818154.1.83092 WP_000818154.1.83163 WP_000818154.1.83305 WP_000818154.1.83413 WP_000818154.1.83491 WP_000818154.1.83523 WP_000818154.1.8354 WP_000818154.1.83651 WP_000818154.1.83721 WP_000818154.1.83760 WP_000818154.1.83995 WP_000818154.1.84103 WP_000818154.1.84283 WP_000818154.1.84291 WP_000818154.1.84392 WP_000818154.1.84397 WP_000818154.1.8441 WP_000818154.1.84532 WP_000818154.1.84554 WP_000818154.1.84659 WP_000818154.1.84899 WP_000818154.1.8497 WP_000818154.1.85040 WP_000818154.1.85134 WP_000818154.1.85178 WP_000818154.1.85180 WP_000818154.1.85190 WP_000818154.1.8545 WP_000818154.1.85481 WP_000818154.1.85483 WP_000818154.1.85541 WP_000818154.1.8556 WP_000818154.1.85568 WP_000818154.1.85615 WP_000818154.1.85617 WP_000818154.1.85663 WP_000818154.1.85671 WP_000818154.1.85672 WP_000818154.1.85777 WP_000818154.1.85886 WP_000818154.1.85900 WP_000818154.1.85904 WP_000818154.1.85976 WP_000818154.1.86043 WP_000818154.1.86173 WP_000818154.1.86306 WP_000818154.1.86356 WP_000818154.1.86450 WP_000818154.1.86469 WP_000818154.1.86580 WP_000818154.1.86588 WP_000818154.1.86661 WP_000818154.1.8671 WP_000818154.1.8672 WP_000818154.1.8678 WP_000818154.1.86810 WP_000818154.1.8684 WP_000818154.1.86895 WP_000818154.1.86906 WP_000818154.1.87095 WP_000818154.1.8736 WP_000818154.1.87460 WP_000818154.1.87552 WP_000818154.1.87695 WP_000818154.1.87779 WP_000818154.1.87899 WP_000818154.1.8792 WP_000818154.1.87945 WP_000818154.1.88019 WP_000818154.1.88073 WP_000818154.1.8809 WP_000818154.1.88092 WP_000818154.1.88291 WP_000818154.1.88293 WP_000818154.1.8837 WP_000818154.1.88393 WP_000818154.1.88703 WP_000818154.1.88792 WP_000818154.1.88902 WP_000818154.1.8891 WP_000818154.1.88957 WP_000818154.1.88980 WP_000818154.1.89008 WP_000818154.1.89114 WP_000818154.1.89116 WP_000818154.1.89119 WP_000818154.1.89138 WP_000818154.1.89304 WP_000818154.1.89512 WP_000818154.1.89527 WP_000818154.1.89570 WP_000818154.1.89604 WP_000818154.1.89622 WP_000818154.1.89657 WP_000818154.1.89659 WP_000818154.1.89765 WP_000818154.1.89817 WP_000818154.1.89902 WP_000818154.1.8996 WP_000818154.1.90097 WP_000818154.1.90252 WP_000818154.1.90417 WP_000818154.1.90453 WP_000818154.1.90458 WP_000818154.1.90557 WP_000818154.1.90585 WP_000818154.1.90641 WP_000818154.1.90734 WP_000818154.1.91003 WP_000818154.1.91056 WP_000818154.1.91069 WP_000818154.1.91179 WP_000818154.1.91278 WP_000818154.1.91512 WP_000818154.1.91524 WP_000818154.1.91564 WP_000818154.1.91621 WP_000818154.1.91628 WP_000818154.1.91655 WP_000818154.1.91724 WP_000818154.1.91732 WP_000818154.1.91788 WP_000818154.1.92013 WP_000818154.1.92093 WP_000818154.1.92108 WP_000818154.1.92165 WP_000818154.1.92183 WP_000818154.1.92208 WP_000818154.1.92268 WP_000818154.1.92310 WP_000818154.1.92443 WP_000818154.1.92482 WP_000818154.1.92531 WP_000818154.1.92669 WP_000818154.1.92671 WP_000818154.1.92738 WP_000818154.1.92893 WP_000818154.1.93059 WP_000818154.1.93086 WP_000818154.1.93101 WP_000818154.1.93136 WP_000818154.1.93155 WP_000818154.1.93339 WP_000818154.1.93365 WP_000818154.1.93543 WP_000818154.1.93650 WP_000818154.1.93656 WP_000818154.1.93662 WP_000818154.1.937 WP_000818154.1.93705 WP_000818154.1.93804 WP_000818154.1.9389 WP_000818154.1.93937 WP_000818154.1.93994 WP_000818154.1.94072 WP_000818154.1.94162 WP_000818154.1.94168 WP_000818154.1.94198 WP_000818154.1.9432 WP_000818154.1.94354 WP_000818154.1.94380 WP_000818154.1.94458 WP_000818154.1.94565 WP_000818154.1.94584 WP_000818154.1.94655 WP_000818154.1.94674 WP_000818154.1.94796 WP_000818154.1.94959 WP_000818154.1.94967 WP_000818154.1.95051 WP_000818154.1.95085 WP_000818154.1.95121 WP_000818154.1.95248 WP_000818154.1.95277 WP_000818154.1.95282 WP_000818154.1.95388 WP_000818154.1.95546 WP_000818154.1.95630 WP_000818154.1.95670 WP_000818154.1.95691 WP_000818154.1.95911 WP_000818154.1.95939 WP_000818154.1.96004 WP_000818154.1.96139 WP_000818154.1.96162 WP_000818154.1.96317 WP_000818154.1.96343 WP_000818154.1.9644 WP_000818154.1.96469 WP_000818154.1.96500 WP_000818154.1.96555 WP_000818154.1.96563 WP_000818154.1.96732 WP_000818154.1.9674 WP_000818154.1.96771 WP_000818154.1.96902 WP_000818154.1.97015 WP_000818154.1.97047 WP_000818154.1.97143 WP_000818154.1.97145 WP_000818154.1.97190 WP_000818154.1.97297 WP_000818154.1.97318 WP_000818154.1.97369 WP_000818154.1.97477 WP_000818154.1.97487 WP_000818154.1.97594 WP_000818154.1.97597 WP_000818154.1.97613 WP_000818154.1.97620 WP_000818154.1.97631 WP_000818154.1.97727 WP_000818154.1.97732 WP_000818154.1.97736 WP_000818154.1.9775 WP_000818154.1.97846 WP_000818154.1.9799 WP_000818154.1.98006 WP_000818154.1.98019 WP_000818154.1.98022 WP_000818154.1.98110 WP_000818154.1.98146 WP_000818154.1.98170 WP_000818154.1.98219 WP_000818154.1.9826 WP_000818154.1.9841 WP_000818154.1.98446 WP_000818154.1.98495 WP_000818154.1.98531 WP_000818154.1.98577 WP_000818154.1.98627 WP_000818154.1.98676 WP_000818154.1.98677 WP_000818154.1.98760 WP_000818154.1.98843 WP_000818154.1.9898 WP_000818154.1.99072 WP_000818154.1.99098 WP_000818154.1.99184 WP_000818154.1.99267 WP_000818154.1.99276 WP_000818154.1.99626 WP_000818154.1.99646 WP_000818154.1.99657 WP_000818154.1.99660 WP_000818154.1.99712 WP_000818154.1.99813 WP_000818154.1.99858 WP_000818154.1.99889 WP_000818154.1.99958 gi|482906746|ref|YP_007905306.1| gi|525828213|ref|YP_008251026.1| gi|549726721|ref|YP_008646911.1| gi|386589533|ref|YP_006085933.1| gi|378986881|ref|YP_005250037.1| APC24156 gi|525815493|ref|YP_008245511.1| gi|526218666|ref|YP_008263880.1| gi|550903551|ref|YP_008672643.1| 454169.SeHA_C4546 99287.STM4208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]