SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453305|ref|YP_005240665.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453305|ref|YP_005240665.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.47e-48
Family DnaQ-like 3'-5' exonuclease 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378453305|ref|YP_005240665.1|
Sequence length 181
Comment oligoribonuclease [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MSADENNLIWIDLEMTGLDPERDRIIEIATLVTDASLNILAEGPTIAVHQSDAQLALMDD
WNVRTHTGSGLVDRVKASTMGERDAELATIEFLKTWVPAGKSPICGNSIGQDRRFLFKYM
PELEAYFHYRYLDVSTLKELARRWKPEILAGFTKQGTHQAMDDIRESVAELAYYREHFIK
L
Download sequence
Identical sequences A0A089GDL2 A0A0F6BAL7 A0A0F7DK55 A0A0H3BWP9 A0A0H3NJ10 A0A0J5DKU8 A0A0L3JN56 A0A0M0PTJ8 A0A0N1QS23 A0A0R9N115 A0A0T7RT09 A0A0T9VE31 A0A0V2EI16 A0A1C2ZW74 A0A1M3Y0Q0 A0A1R2RDF9 A0A1S0ZD84 A0A1S1AXR4 A0A1X2RQX0 A0A1X2TIA9 A0A1X2VAK9 A0A1X2Y9R9 A0A1Z3QAY4 A0A221YTG2 A0A221Z536 A0A241SIE1 A0A265B2S0 A0A267SMB9 A0A271CJ07 A0A271D0B5 A0A2C6FMW2 A0A2D1XIP8 A0A2D1XWY8 A0A2D3U104 A0A2G1NQU1 A0A2H9YDM5 A0A2I6MDG6 A0A2I6MQZ0 A0A2I6N4S0 A0A2I6NI71 A0A2I6NW57 A0A2I6P8Y9 A0A2K2RV16 A0A2K2S5L9 A0A2K2SIA0 A0A2K2SZW1 A0A2K2T380 A0A2K2Z1B8 A9MFP8 B5F379 G4C9R2 G5LXA3 G5MRM5 G5QBV7 G5RP45 M7R9L0 P65599 P65600 Q57GM7 Q5PLG7 S4K6C7 S5HPG0 V1WT52 V7IUK1 V7U583
gi|194446159|ref|YP_002043608.1| gi|194733922|ref|YP_002117294.1| gi|482906888|ref|YP_007905448.1| gi|378991617|ref|YP_005254781.1| gi|62182799|ref|YP_219216.1| gi|529221814|ref|YP_008383448.1| gi|526218772|ref|YP_008264023.1| gi|378962586|ref|YP_005220072.1| gi|550903690|ref|YP_008672782.1| gi|488656835|ref|YP_007928638.1| NP_458789.1.84458 NP_463214.1.58477 WP_001271546.1.100002 WP_001271546.1.100007 WP_001271546.1.100008 WP_001271546.1.100010 WP_001271546.1.100017 WP_001271546.1.100031 WP_001271546.1.100036 WP_001271546.1.100077 WP_001271546.1.100079 WP_001271546.1.100115 WP_001271546.1.100129 WP_001271546.1.10013 WP_001271546.1.100137 WP_001271546.1.100149 WP_001271546.1.100165 WP_001271546.1.100191 WP_001271546.1.100196 WP_001271546.1.1002 WP_001271546.1.100234 WP_001271546.1.100258 WP_001271546.1.100266 WP_001271546.1.100284 WP_001271546.1.100288 WP_001271546.1.100313 WP_001271546.1.100314 WP_001271546.1.100321 WP_001271546.1.100354 WP_001271546.1.100376 WP_001271546.1.100392 WP_001271546.1.100412 WP_001271546.1.100413 WP_001271546.1.100421 WP_001271546.1.100424 WP_001271546.1.100432 WP_001271546.1.100436 WP_001271546.1.100438 WP_001271546.1.100446 WP_001271546.1.100450 WP_001271546.1.100457 WP_001271546.1.100472 WP_001271546.1.100484 WP_001271546.1.100488 WP_001271546.1.100502 WP_001271546.1.100521 WP_001271546.1.100541 WP_001271546.1.100557 WP_001271546.1.100584 WP_001271546.1.100589 WP_001271546.1.100592 WP_001271546.1.100597 WP_001271546.1.100605 WP_001271546.1.100610 WP_001271546.1.100642 WP_001271546.1.10065 WP_001271546.1.100650 WP_001271546.1.100707 WP_001271546.1.100711 WP_001271546.1.100714 WP_001271546.1.100721 WP_001271546.1.100730 WP_001271546.1.100732 WP_001271546.1.100733 WP_001271546.1.100739 WP_001271546.1.10074 WP_001271546.1.100750 WP_001271546.1.10076 WP_001271546.1.100764 WP_001271546.1.100773 WP_001271546.1.100776 WP_001271546.1.100781 WP_001271546.1.100790 WP_001271546.1.100793 WP_001271546.1.100799 WP_001271546.1.10081 WP_001271546.1.100814 WP_001271546.1.100857 WP_001271546.1.100865 WP_001271546.1.100869 WP_001271546.1.100870 WP_001271546.1.100871 WP_001271546.1.100882 WP_001271546.1.100886 WP_001271546.1.100895 WP_001271546.1.100932 WP_001271546.1.100941 WP_001271546.1.100944 WP_001271546.1.100948 WP_001271546.1.100953 WP_001271546.1.100979 WP_001271546.1.101007 WP_001271546.1.101011 WP_001271546.1.101020 WP_001271546.1.101042 WP_001271546.1.101074 WP_001271546.1.101078 WP_001271546.1.10108 WP_001271546.1.101091 WP_001271546.1.101094 WP_001271546.1.101111 WP_001271546.1.101112 WP_001271546.1.101123 WP_001271546.1.101126 WP_001271546.1.101147 WP_001271546.1.101180 WP_001271546.1.101185 WP_001271546.1.101223 WP_001271546.1.101226 WP_001271546.1.101239 WP_001271546.1.10124 WP_001271546.1.101259 WP_001271546.1.101271 WP_001271546.1.101284 WP_001271546.1.101291 WP_001271546.1.1013 WP_001271546.1.101312 WP_001271546.1.101320 WP_001271546.1.101322 WP_001271546.1.101353 WP_001271546.1.101363 WP_001271546.1.101374 WP_001271546.1.101386 WP_001271546.1.101404 WP_001271546.1.101420 WP_001271546.1.101425 WP_001271546.1.101454 WP_001271546.1.101473 WP_001271546.1.101519 WP_001271546.1.101520 WP_001271546.1.101541 WP_001271546.1.101589 WP_001271546.1.101609 WP_001271546.1.101612 WP_001271546.1.101616 WP_001271546.1.101634 WP_001271546.1.101636 WP_001271546.1.101639 WP_001271546.1.10164 WP_001271546.1.101666 WP_001271546.1.101674 WP_001271546.1.101707 WP_001271546.1.101724 WP_001271546.1.101734 WP_001271546.1.101740 WP_001271546.1.101741 WP_001271546.1.101744 WP_001271546.1.101759 WP_001271546.1.10177 WP_001271546.1.101776 WP_001271546.1.101815 WP_001271546.1.101832 WP_001271546.1.101839 WP_001271546.1.101841 WP_001271546.1.101868 WP_001271546.1.101878 WP_001271546.1.101890 WP_001271546.1.101904 WP_001271546.1.10191 WP_001271546.1.101917 WP_001271546.1.101927 WP_001271546.1.101941 WP_001271546.1.101949 WP_001271546.1.101953 WP_001271546.1.101975 WP_001271546.1.102009 WP_001271546.1.102050 WP_001271546.1.102087 WP_001271546.1.102103 WP_001271546.1.102111 WP_001271546.1.10220 WP_001271546.1.10231 WP_001271546.1.10237 WP_001271546.1.10266 WP_001271546.1.10276 WP_001271546.1.10293 WP_001271546.1.10300 WP_001271546.1.10310 WP_001271546.1.10338 WP_001271546.1.1038 WP_001271546.1.10394 WP_001271546.1.104 WP_001271546.1.10401 WP_001271546.1.10428 WP_001271546.1.10429 WP_001271546.1.10439 WP_001271546.1.10459 WP_001271546.1.10463 WP_001271546.1.10465 WP_001271546.1.10475 WP_001271546.1.10498 WP_001271546.1.10507 WP_001271546.1.10511 WP_001271546.1.10514 WP_001271546.1.10521 WP_001271546.1.10530 WP_001271546.1.10532 WP_001271546.1.10547 WP_001271546.1.10562 WP_001271546.1.10566 WP_001271546.1.10568 WP_001271546.1.10595 WP_001271546.1.106 WP_001271546.1.10631 WP_001271546.1.10642 WP_001271546.1.10654 WP_001271546.1.10675 WP_001271546.1.10677 WP_001271546.1.10678 WP_001271546.1.10711 WP_001271546.1.10720 WP_001271546.1.10753 WP_001271546.1.10755 WP_001271546.1.10797 WP_001271546.1.10857 WP_001271546.1.10868 WP_001271546.1.10873 WP_001271546.1.10898 WP_001271546.1.10926 WP_001271546.1.10936 WP_001271546.1.10992 WP_001271546.1.11000 WP_001271546.1.11012 WP_001271546.1.11024 WP_001271546.1.11031 WP_001271546.1.11041 WP_001271546.1.11055 WP_001271546.1.11098 WP_001271546.1.1110 WP_001271546.1.11119 WP_001271546.1.11126 WP_001271546.1.11142 WP_001271546.1.11156 WP_001271546.1.11168 WP_001271546.1.11190 WP_001271546.1.11213 WP_001271546.1.11216 WP_001271546.1.11239 WP_001271546.1.11253 WP_001271546.1.11254 WP_001271546.1.11295 WP_001271546.1.113 WP_001271546.1.11304 WP_001271546.1.11314 WP_001271546.1.1135 WP_001271546.1.11362 WP_001271546.1.11369 WP_001271546.1.1137 WP_001271546.1.11385 WP_001271546.1.11405 WP_001271546.1.1142 WP_001271546.1.11426 WP_001271546.1.11429 WP_001271546.1.11444 WP_001271546.1.11455 WP_001271546.1.11458 WP_001271546.1.11479 WP_001271546.1.1150 WP_001271546.1.11511 WP_001271546.1.11518 WP_001271546.1.11526 WP_001271546.1.11528 WP_001271546.1.11532 WP_001271546.1.11543 WP_001271546.1.11544 WP_001271546.1.11557 WP_001271546.1.1156 WP_001271546.1.11565 WP_001271546.1.11567 WP_001271546.1.11588 WP_001271546.1.11603 WP_001271546.1.11621 WP_001271546.1.11638 WP_001271546.1.11677 WP_001271546.1.11681 WP_001271546.1.11687 WP_001271546.1.1169 WP_001271546.1.11735 WP_001271546.1.1174 WP_001271546.1.11763 WP_001271546.1.11772 WP_001271546.1.11810 WP_001271546.1.11824 WP_001271546.1.11834 WP_001271546.1.11841 WP_001271546.1.11865 WP_001271546.1.11868 WP_001271546.1.11875 WP_001271546.1.11883 WP_001271546.1.11897 WP_001271546.1.11900 WP_001271546.1.11908 WP_001271546.1.11914 WP_001271546.1.11936 WP_001271546.1.11938 WP_001271546.1.11964 WP_001271546.1.11978 WP_001271546.1.12007 WP_001271546.1.12017 WP_001271546.1.12025 WP_001271546.1.12027 WP_001271546.1.1204 WP_001271546.1.12040 WP_001271546.1.12047 WP_001271546.1.12059 WP_001271546.1.12061 WP_001271546.1.12063 WP_001271546.1.1207 WP_001271546.1.12106 WP_001271546.1.12114 WP_001271546.1.12141 WP_001271546.1.12144 WP_001271546.1.1215 WP_001271546.1.12159 WP_001271546.1.12160 WP_001271546.1.12168 WP_001271546.1.12172 WP_001271546.1.12192 WP_001271546.1.12210 WP_001271546.1.1224 WP_001271546.1.12244 WP_001271546.1.12280 WP_001271546.1.12282 WP_001271546.1.12308 WP_001271546.1.12340 WP_001271546.1.12351 WP_001271546.1.12364 WP_001271546.1.12370 WP_001271546.1.12374 WP_001271546.1.1239 WP_001271546.1.12396 WP_001271546.1.12397 WP_001271546.1.12398 WP_001271546.1.12441 WP_001271546.1.12456 WP_001271546.1.1246 WP_001271546.1.12472 WP_001271546.1.12484 WP_001271546.1.12485 WP_001271546.1.1250 WP_001271546.1.12546 WP_001271546.1.12568 WP_001271546.1.12569 WP_001271546.1.12581 WP_001271546.1.12584 WP_001271546.1.12585 WP_001271546.1.12620 WP_001271546.1.1264 WP_001271546.1.12648 WP_001271546.1.12650 WP_001271546.1.12683 WP_001271546.1.12696 WP_001271546.1.12701 WP_001271546.1.12718 WP_001271546.1.12726 WP_001271546.1.12727 WP_001271546.1.12728 WP_001271546.1.12741 WP_001271546.1.12834 WP_001271546.1.12864 WP_001271546.1.12865 WP_001271546.1.12877 WP_001271546.1.12879 WP_001271546.1.12936 WP_001271546.1.1299 WP_001271546.1.12995 WP_001271546.1.1300 WP_001271546.1.13027 WP_001271546.1.13076 WP_001271546.1.13101 WP_001271546.1.13102 WP_001271546.1.13106 WP_001271546.1.13108 WP_001271546.1.13130 WP_001271546.1.13161 WP_001271546.1.13207 WP_001271546.1.1321 WP_001271546.1.13247 WP_001271546.1.1326 WP_001271546.1.13262 WP_001271546.1.13268 WP_001271546.1.13274 WP_001271546.1.13291 WP_001271546.1.133 WP_001271546.1.13311 WP_001271546.1.13314 WP_001271546.1.13334 WP_001271546.1.13338 WP_001271546.1.13342 WP_001271546.1.13352 WP_001271546.1.13367 WP_001271546.1.13391 WP_001271546.1.13406 WP_001271546.1.13414 WP_001271546.1.13429 WP_001271546.1.13440 WP_001271546.1.13443 WP_001271546.1.13446 WP_001271546.1.1346 WP_001271546.1.13465 WP_001271546.1.13476 WP_001271546.1.13488 WP_001271546.1.13509 WP_001271546.1.13528 WP_001271546.1.13543 WP_001271546.1.13573 WP_001271546.1.13599 WP_001271546.1.13602 WP_001271546.1.13625 WP_001271546.1.13661 WP_001271546.1.13669 WP_001271546.1.13677 WP_001271546.1.13686 WP_001271546.1.13691 WP_001271546.1.1372 WP_001271546.1.13732 WP_001271546.1.13741 WP_001271546.1.13750 WP_001271546.1.13764 WP_001271546.1.13799 WP_001271546.1.13819 WP_001271546.1.1382 WP_001271546.1.13827 WP_001271546.1.13829 WP_001271546.1.13848 WP_001271546.1.13857 WP_001271546.1.1387 WP_001271546.1.13908 WP_001271546.1.13932 WP_001271546.1.13967 WP_001271546.1.13968 WP_001271546.1.1397 WP_001271546.1.13972 WP_001271546.1.140 WP_001271546.1.14001 WP_001271546.1.1401 WP_001271546.1.14011 WP_001271546.1.14041 WP_001271546.1.14050 WP_001271546.1.14056 WP_001271546.1.1408 WP_001271546.1.14089 WP_001271546.1.14099 WP_001271546.1.14111 WP_001271546.1.1412 WP_001271546.1.14120 WP_001271546.1.14123 WP_001271546.1.14150 WP_001271546.1.14151 WP_001271546.1.14191 WP_001271546.1.14197 WP_001271546.1.14212 WP_001271546.1.14239 WP_001271546.1.14280 WP_001271546.1.14286 WP_001271546.1.14296 WP_001271546.1.14320 WP_001271546.1.14333 WP_001271546.1.14369 WP_001271546.1.14379 WP_001271546.1.14399 WP_001271546.1.1440 WP_001271546.1.14406 WP_001271546.1.14410 WP_001271546.1.14436 WP_001271546.1.14444 WP_001271546.1.14446 WP_001271546.1.14458 WP_001271546.1.14466 WP_001271546.1.14467 WP_001271546.1.14474 WP_001271546.1.14495 WP_001271546.1.14500 WP_001271546.1.14505 WP_001271546.1.14516 WP_001271546.1.14519 WP_001271546.1.14524 WP_001271546.1.14526 WP_001271546.1.14528 WP_001271546.1.14550 WP_001271546.1.14554 WP_001271546.1.14575 WP_001271546.1.146 WP_001271546.1.14618 WP_001271546.1.14688 WP_001271546.1.14701 WP_001271546.1.14703 WP_001271546.1.14706 WP_001271546.1.14708 WP_001271546.1.14719 WP_001271546.1.14725 WP_001271546.1.1473 WP_001271546.1.14737 WP_001271546.1.14765 WP_001271546.1.14789 WP_001271546.1.14793 WP_001271546.1.14808 WP_001271546.1.14810 WP_001271546.1.14819 WP_001271546.1.14852 WP_001271546.1.14876 WP_001271546.1.14877 WP_001271546.1.14884 WP_001271546.1.1489 WP_001271546.1.14894 WP_001271546.1.14913 WP_001271546.1.14917 WP_001271546.1.14927 WP_001271546.1.14930 WP_001271546.1.14932 WP_001271546.1.14936 WP_001271546.1.14947 WP_001271546.1.14948 WP_001271546.1.14964 WP_001271546.1.15011 WP_001271546.1.15046 WP_001271546.1.15054 WP_001271546.1.15055 WP_001271546.1.15059 WP_001271546.1.15067 WP_001271546.1.15079 WP_001271546.1.15100 WP_001271546.1.15102 WP_001271546.1.15124 WP_001271546.1.15184 WP_001271546.1.15214 WP_001271546.1.15223 WP_001271546.1.15226 WP_001271546.1.15244 WP_001271546.1.15265 WP_001271546.1.15276 WP_001271546.1.15316 WP_001271546.1.15318 WP_001271546.1.15353 WP_001271546.1.15362 WP_001271546.1.15369 WP_001271546.1.1540 WP_001271546.1.15415 WP_001271546.1.15423 WP_001271546.1.15433 WP_001271546.1.15439 WP_001271546.1.15468 WP_001271546.1.15479 WP_001271546.1.15483 WP_001271546.1.15487 WP_001271546.1.15508 WP_001271546.1.1551 WP_001271546.1.15535 WP_001271546.1.15581 WP_001271546.1.15585 WP_001271546.1.15586 WP_001271546.1.15597 WP_001271546.1.15612 WP_001271546.1.15616 WP_001271546.1.15625 WP_001271546.1.15627 WP_001271546.1.15637 WP_001271546.1.15644 WP_001271546.1.1568 WP_001271546.1.15708 WP_001271546.1.15710 WP_001271546.1.15717 WP_001271546.1.15775 WP_001271546.1.15777 WP_001271546.1.15784 WP_001271546.1.15795 WP_001271546.1.158 WP_001271546.1.15830 WP_001271546.1.15835 WP_001271546.1.15862 WP_001271546.1.15881 WP_001271546.1.15905 WP_001271546.1.15909 WP_001271546.1.15910 WP_001271546.1.15912 WP_001271546.1.1592 WP_001271546.1.15922 WP_001271546.1.15938 WP_001271546.1.15970 WP_001271546.1.15978 WP_001271546.1.15986 WP_001271546.1.15995 WP_001271546.1.16000 WP_001271546.1.16004 WP_001271546.1.16006 WP_001271546.1.1601 WP_001271546.1.16028 WP_001271546.1.16032 WP_001271546.1.16046 WP_001271546.1.16047 WP_001271546.1.16051 WP_001271546.1.16052 WP_001271546.1.16058 WP_001271546.1.16062 WP_001271546.1.16063 WP_001271546.1.16103 WP_001271546.1.16125 WP_001271546.1.16150 WP_001271546.1.16155 WP_001271546.1.16158 WP_001271546.1.16166 WP_001271546.1.16172 WP_001271546.1.16201 WP_001271546.1.16226 WP_001271546.1.16233 WP_001271546.1.16244 WP_001271546.1.1626 WP_001271546.1.16264 WP_001271546.1.16273 WP_001271546.1.16284 WP_001271546.1.16328 WP_001271546.1.16331 WP_001271546.1.16344 WP_001271546.1.1635 WP_001271546.1.16361 WP_001271546.1.16363 WP_001271546.1.16365 WP_001271546.1.16366 WP_001271546.1.16394 WP_001271546.1.16452 WP_001271546.1.16453 WP_001271546.1.16461 WP_001271546.1.16462 WP_001271546.1.16465 WP_001271546.1.16468 WP_001271546.1.16474 WP_001271546.1.16508 WP_001271546.1.16522 WP_001271546.1.16525 WP_001271546.1.16551 WP_001271546.1.16565 WP_001271546.1.16581 WP_001271546.1.16588 WP_001271546.1.16614 WP_001271546.1.16650 WP_001271546.1.16656 WP_001271546.1.16658 WP_001271546.1.16666 WP_001271546.1.16673 WP_001271546.1.1668 WP_001271546.1.16686 WP_001271546.1.16691 WP_001271546.1.167 WP_001271546.1.16710 WP_001271546.1.16729 WP_001271546.1.16732 WP_001271546.1.16735 WP_001271546.1.16736 WP_001271546.1.1674 WP_001271546.1.16767 WP_001271546.1.16781 WP_001271546.1.16786 WP_001271546.1.16804 WP_001271546.1.16817 WP_001271546.1.16819 WP_001271546.1.16826 WP_001271546.1.16846 WP_001271546.1.16855 WP_001271546.1.16858 WP_001271546.1.16873 WP_001271546.1.16879 WP_001271546.1.1689 WP_001271546.1.16893 WP_001271546.1.16896 WP_001271546.1.16903 WP_001271546.1.16905 WP_001271546.1.16910 WP_001271546.1.16916 WP_001271546.1.16941 WP_001271546.1.16942 WP_001271546.1.16944 WP_001271546.1.16948 WP_001271546.1.16949 WP_001271546.1.16965 WP_001271546.1.16972 WP_001271546.1.16998 WP_001271546.1.1700 WP_001271546.1.17031 WP_001271546.1.17049 WP_001271546.1.17058 WP_001271546.1.17078 WP_001271546.1.17093 WP_001271546.1.17096 WP_001271546.1.17098 WP_001271546.1.17105 WP_001271546.1.17188 WP_001271546.1.17202 WP_001271546.1.17219 WP_001271546.1.1722 WP_001271546.1.17270 WP_001271546.1.17285 WP_001271546.1.17302 WP_001271546.1.17307 WP_001271546.1.17308 WP_001271546.1.1733 WP_001271546.1.17368 WP_001271546.1.1737 WP_001271546.1.17390 WP_001271546.1.174 WP_001271546.1.17405 WP_001271546.1.17406 WP_001271546.1.17439 WP_001271546.1.17447 WP_001271546.1.17480 WP_001271546.1.17482 WP_001271546.1.1749 WP_001271546.1.17504 WP_001271546.1.17513 WP_001271546.1.17525 WP_001271546.1.17543 WP_001271546.1.17546 WP_001271546.1.17560 WP_001271546.1.17563 WP_001271546.1.1757 WP_001271546.1.17578 WP_001271546.1.17583 WP_001271546.1.17622 WP_001271546.1.17629 WP_001271546.1.17659 WP_001271546.1.17667 WP_001271546.1.17686 WP_001271546.1.17693 WP_001271546.1.17694 WP_001271546.1.17702 WP_001271546.1.17703 WP_001271546.1.17705 WP_001271546.1.17732 WP_001271546.1.17741 WP_001271546.1.17743 WP_001271546.1.17747 WP_001271546.1.17755 WP_001271546.1.17758 WP_001271546.1.17840 WP_001271546.1.17865 WP_001271546.1.17886 WP_001271546.1.17891 WP_001271546.1.17901 WP_001271546.1.17914 WP_001271546.1.17919 WP_001271546.1.17936 WP_001271546.1.17949 WP_001271546.1.17956 WP_001271546.1.1798 WP_001271546.1.17991 WP_001271546.1.18005 WP_001271546.1.1801 WP_001271546.1.18019 WP_001271546.1.18021 WP_001271546.1.18022 WP_001271546.1.18056 WP_001271546.1.18061 WP_001271546.1.1807 WP_001271546.1.18089 WP_001271546.1.18092 WP_001271546.1.18099 WP_001271546.1.18103 WP_001271546.1.18109 WP_001271546.1.18111 WP_001271546.1.18122 WP_001271546.1.18124 WP_001271546.1.1814 WP_001271546.1.18144 WP_001271546.1.18149 WP_001271546.1.18163 WP_001271546.1.18173 WP_001271546.1.18178 WP_001271546.1.1818 WP_001271546.1.18192 WP_001271546.1.18249 WP_001271546.1.1825 WP_001271546.1.18254 WP_001271546.1.18265 WP_001271546.1.18267 WP_001271546.1.18270 WP_001271546.1.18277 WP_001271546.1.18280 WP_001271546.1.18281 WP_001271546.1.18282 WP_001271546.1.1832 WP_001271546.1.18328 WP_001271546.1.18355 WP_001271546.1.18358 WP_001271546.1.18365 WP_001271546.1.18370 WP_001271546.1.18384 WP_001271546.1.18406 WP_001271546.1.18426 WP_001271546.1.18441 WP_001271546.1.18445 WP_001271546.1.18468 WP_001271546.1.18474 WP_001271546.1.18485 WP_001271546.1.18489 WP_001271546.1.18513 WP_001271546.1.18607 WP_001271546.1.18610 WP_001271546.1.18641 WP_001271546.1.18678 WP_001271546.1.18686 WP_001271546.1.18688 WP_001271546.1.18692 WP_001271546.1.18705 WP_001271546.1.18715 WP_001271546.1.18722 WP_001271546.1.18737 WP_001271546.1.18766 WP_001271546.1.18776 WP_001271546.1.18796 WP_001271546.1.1880 WP_001271546.1.18822 WP_001271546.1.18847 WP_001271546.1.1885 WP_001271546.1.18860 WP_001271546.1.18881 WP_001271546.1.18886 WP_001271546.1.18895 WP_001271546.1.18919 WP_001271546.1.18922 WP_001271546.1.18940 WP_001271546.1.18949 WP_001271546.1.1895 WP_001271546.1.18959 WP_001271546.1.1897 WP_001271546.1.18972 WP_001271546.1.19001 WP_001271546.1.19006 WP_001271546.1.19030 WP_001271546.1.19038 WP_001271546.1.19044 WP_001271546.1.19053 WP_001271546.1.19055 WP_001271546.1.19084 WP_001271546.1.19093 WP_001271546.1.19163 WP_001271546.1.19174 WP_001271546.1.19187 WP_001271546.1.19228 WP_001271546.1.19240 WP_001271546.1.19273 WP_001271546.1.19288 WP_001271546.1.19291 WP_001271546.1.19300 WP_001271546.1.19320 WP_001271546.1.19340 WP_001271546.1.19357 WP_001271546.1.19373 WP_001271546.1.1939 WP_001271546.1.19405 WP_001271546.1.19422 WP_001271546.1.19433 WP_001271546.1.19454 WP_001271546.1.19456 WP_001271546.1.19458 WP_001271546.1.19460 WP_001271546.1.19461 WP_001271546.1.19469 WP_001271546.1.19496 WP_001271546.1.19535 WP_001271546.1.19538 WP_001271546.1.1954 WP_001271546.1.1955 WP_001271546.1.19588 WP_001271546.1.19589 WP_001271546.1.19614 WP_001271546.1.19616 WP_001271546.1.19642 WP_001271546.1.19656 WP_001271546.1.19660 WP_001271546.1.19663 WP_001271546.1.1968 WP_001271546.1.19683 WP_001271546.1.19686 WP_001271546.1.19702 WP_001271546.1.19706 WP_001271546.1.19723 WP_001271546.1.19724 WP_001271546.1.19731 WP_001271546.1.19740 WP_001271546.1.19749 WP_001271546.1.19784 WP_001271546.1.19793 WP_001271546.1.19794 WP_001271546.1.19802 WP_001271546.1.19809 WP_001271546.1.19823 WP_001271546.1.19834 WP_001271546.1.19851 WP_001271546.1.19863 WP_001271546.1.19867 WP_001271546.1.19882 WP_001271546.1.19884 WP_001271546.1.1990 WP_001271546.1.1992 WP_001271546.1.19938 WP_001271546.1.19967 WP_001271546.1.19970 WP_001271546.1.19975 WP_001271546.1.1998 WP_001271546.1.19987 WP_001271546.1.19999 WP_001271546.1.20 WP_001271546.1.20023 WP_001271546.1.20034 WP_001271546.1.20081 WP_001271546.1.20086 WP_001271546.1.20089 WP_001271546.1.20091 WP_001271546.1.2010 WP_001271546.1.20119 WP_001271546.1.20212 WP_001271546.1.20218 WP_001271546.1.20254 WP_001271546.1.20255 WP_001271546.1.2026 WP_001271546.1.20261 WP_001271546.1.20266 WP_001271546.1.20271 WP_001271546.1.20296 WP_001271546.1.20330 WP_001271546.1.20339 WP_001271546.1.20349 WP_001271546.1.2036 WP_001271546.1.20362 WP_001271546.1.20364 WP_001271546.1.20376 WP_001271546.1.20391 WP_001271546.1.2041 WP_001271546.1.20415 WP_001271546.1.20418 WP_001271546.1.20419 WP_001271546.1.20425 WP_001271546.1.20437 WP_001271546.1.20438 WP_001271546.1.20443 WP_001271546.1.20446 WP_001271546.1.20465 WP_001271546.1.20488 WP_001271546.1.20492 WP_001271546.1.20503 WP_001271546.1.20525 WP_001271546.1.2053 WP_001271546.1.2054 WP_001271546.1.20553 WP_001271546.1.20564 WP_001271546.1.20573 WP_001271546.1.20614 WP_001271546.1.20626 WP_001271546.1.20631 WP_001271546.1.20635 WP_001271546.1.20646 WP_001271546.1.20695 WP_001271546.1.20700 WP_001271546.1.20718 WP_001271546.1.20721 WP_001271546.1.2073 WP_001271546.1.20740 WP_001271546.1.20760 WP_001271546.1.20767 WP_001271546.1.20787 WP_001271546.1.20789 WP_001271546.1.20795 WP_001271546.1.20810 WP_001271546.1.20828 WP_001271546.1.20839 WP_001271546.1.20862 WP_001271546.1.2087 WP_001271546.1.20883 WP_001271546.1.20886 WP_001271546.1.20894 WP_001271546.1.20900 WP_001271546.1.20908 WP_001271546.1.2091 WP_001271546.1.20947 WP_001271546.1.20953 WP_001271546.1.2101 WP_001271546.1.21010 WP_001271546.1.21049 WP_001271546.1.2106 WP_001271546.1.21062 WP_001271546.1.2107 WP_001271546.1.21075 WP_001271546.1.21079 WP_001271546.1.21086 WP_001271546.1.21089 WP_001271546.1.21103 WP_001271546.1.21136 WP_001271546.1.21144 WP_001271546.1.21146 WP_001271546.1.2116 WP_001271546.1.21162 WP_001271546.1.21165 WP_001271546.1.21181 WP_001271546.1.21184 WP_001271546.1.21185 WP_001271546.1.21194 WP_001271546.1.21202 WP_001271546.1.21241 WP_001271546.1.21245 WP_001271546.1.21246 WP_001271546.1.21260 WP_001271546.1.21269 WP_001271546.1.21286 WP_001271546.1.2130 WP_001271546.1.21309 WP_001271546.1.21326 WP_001271546.1.21332 WP_001271546.1.21351 WP_001271546.1.21362 WP_001271546.1.21366 WP_001271546.1.2139 WP_001271546.1.21399 WP_001271546.1.21400 WP_001271546.1.21404 WP_001271546.1.21423 WP_001271546.1.21443 WP_001271546.1.21453 WP_001271546.1.2146 WP_001271546.1.21473 WP_001271546.1.21492 WP_001271546.1.21497 WP_001271546.1.21499 WP_001271546.1.21534 WP_001271546.1.21548 WP_001271546.1.2155 WP_001271546.1.21603 WP_001271546.1.21616 WP_001271546.1.2166 WP_001271546.1.21674 WP_001271546.1.21681 WP_001271546.1.21692 WP_001271546.1.21715 WP_001271546.1.21728 WP_001271546.1.21730 WP_001271546.1.21750 WP_001271546.1.21751 WP_001271546.1.21757 WP_001271546.1.21792 WP_001271546.1.21825 WP_001271546.1.21845 WP_001271546.1.21877 WP_001271546.1.21886 WP_001271546.1.21909 WP_001271546.1.21910 WP_001271546.1.21940 WP_001271546.1.21946 WP_001271546.1.21950 WP_001271546.1.21966 WP_001271546.1.21981 WP_001271546.1.21991 WP_001271546.1.22019 WP_001271546.1.22024 WP_001271546.1.22026 WP_001271546.1.22030 WP_001271546.1.2205 WP_001271546.1.22051 WP_001271546.1.22062 WP_001271546.1.22064 WP_001271546.1.22067 WP_001271546.1.22069 WP_001271546.1.22096 WP_001271546.1.22117 WP_001271546.1.22118 WP_001271546.1.22126 WP_001271546.1.22136 WP_001271546.1.22158 WP_001271546.1.2216 WP_001271546.1.22162 WP_001271546.1.22169 WP_001271546.1.22205 WP_001271546.1.22208 WP_001271546.1.2221 WP_001271546.1.22235 WP_001271546.1.2224 WP_001271546.1.22240 WP_001271546.1.2227 WP_001271546.1.22270 WP_001271546.1.22296 WP_001271546.1.22315 WP_001271546.1.22337 WP_001271546.1.22346 WP_001271546.1.2235 WP_001271546.1.22373 WP_001271546.1.22379 WP_001271546.1.22388 WP_001271546.1.22427 WP_001271546.1.22449 WP_001271546.1.22451 WP_001271546.1.22453 WP_001271546.1.22454 WP_001271546.1.2246 WP_001271546.1.22460 WP_001271546.1.22476 WP_001271546.1.22485 WP_001271546.1.22514 WP_001271546.1.22537 WP_001271546.1.22565 WP_001271546.1.22566 WP_001271546.1.22575 WP_001271546.1.22582 WP_001271546.1.22590 WP_001271546.1.22595 WP_001271546.1.22604 WP_001271546.1.22605 WP_001271546.1.22614 WP_001271546.1.22620 WP_001271546.1.22623 WP_001271546.1.22652 WP_001271546.1.22676 WP_001271546.1.22683 WP_001271546.1.22692 WP_001271546.1.22758 WP_001271546.1.22760 WP_001271546.1.2283 WP_001271546.1.2284 WP_001271546.1.22845 WP_001271546.1.22855 WP_001271546.1.22857 WP_001271546.1.22864 WP_001271546.1.22870 WP_001271546.1.22880 WP_001271546.1.22895 WP_001271546.1.22902 WP_001271546.1.22926 WP_001271546.1.22943 WP_001271546.1.22947 WP_001271546.1.22966 WP_001271546.1.22967 WP_001271546.1.22979 WP_001271546.1.23010 WP_001271546.1.23040 WP_001271546.1.23053 WP_001271546.1.23058 WP_001271546.1.23080 WP_001271546.1.23102 WP_001271546.1.23114 WP_001271546.1.2314 WP_001271546.1.23148 WP_001271546.1.23155 WP_001271546.1.23169 WP_001271546.1.23172 WP_001271546.1.23175 WP_001271546.1.23192 WP_001271546.1.23201 WP_001271546.1.23218 WP_001271546.1.2324 WP_001271546.1.23246 WP_001271546.1.23258 WP_001271546.1.23259 WP_001271546.1.23274 WP_001271546.1.23279 WP_001271546.1.23309 WP_001271546.1.2331 WP_001271546.1.23311 WP_001271546.1.2332 WP_001271546.1.23329 WP_001271546.1.23340 WP_001271546.1.23343 WP_001271546.1.2336 WP_001271546.1.23365 WP_001271546.1.23379 WP_001271546.1.23409 WP_001271546.1.23412 WP_001271546.1.2342 WP_001271546.1.23426 WP_001271546.1.23442 WP_001271546.1.23444 WP_001271546.1.23460 WP_001271546.1.23466 WP_001271546.1.23472 WP_001271546.1.23482 WP_001271546.1.23485 WP_001271546.1.23492 WP_001271546.1.235 WP_001271546.1.23500 WP_001271546.1.23503 WP_001271546.1.23509 WP_001271546.1.23513 WP_001271546.1.23515 WP_001271546.1.23529 WP_001271546.1.23548 WP_001271546.1.23571 WP_001271546.1.2358 WP_001271546.1.23587 WP_001271546.1.23604 WP_001271546.1.23621 WP_001271546.1.23629 WP_001271546.1.23631 WP_001271546.1.23634 WP_001271546.1.23639 WP_001271546.1.2364 WP_001271546.1.23643 WP_001271546.1.23646 WP_001271546.1.23670 WP_001271546.1.23675 WP_001271546.1.23679 WP_001271546.1.23685 WP_001271546.1.237 WP_001271546.1.23707 WP_001271546.1.23720 WP_001271546.1.23728 WP_001271546.1.23736 WP_001271546.1.23746 WP_001271546.1.2375 WP_001271546.1.23755 WP_001271546.1.2376 WP_001271546.1.23783 WP_001271546.1.23786 WP_001271546.1.23787 WP_001271546.1.2380 WP_001271546.1.23801 WP_001271546.1.23819 WP_001271546.1.23932 WP_001271546.1.23959 WP_001271546.1.24017 WP_001271546.1.24028 WP_001271546.1.24061 WP_001271546.1.24082 WP_001271546.1.24083 WP_001271546.1.24117 WP_001271546.1.24125 WP_001271546.1.24138 WP_001271546.1.2415 WP_001271546.1.24153 WP_001271546.1.24158 WP_001271546.1.24163 WP_001271546.1.24206 WP_001271546.1.24214 WP_001271546.1.24250 WP_001271546.1.24259 WP_001271546.1.24291 WP_001271546.1.24297 WP_001271546.1.24303 WP_001271546.1.24308 WP_001271546.1.24322 WP_001271546.1.24325 WP_001271546.1.24355 WP_001271546.1.24361 WP_001271546.1.24375 WP_001271546.1.24376 WP_001271546.1.24392 WP_001271546.1.24394 WP_001271546.1.24400 WP_001271546.1.24408 WP_001271546.1.24409 WP_001271546.1.24412 WP_001271546.1.24419 WP_001271546.1.24420 WP_001271546.1.24433 WP_001271546.1.24444 WP_001271546.1.24450 WP_001271546.1.24476 WP_001271546.1.24494 WP_001271546.1.24521 WP_001271546.1.24555 WP_001271546.1.24567 WP_001271546.1.24578 WP_001271546.1.24619 WP_001271546.1.24643 WP_001271546.1.2467 WP_001271546.1.24673 WP_001271546.1.24686 WP_001271546.1.24688 WP_001271546.1.24689 WP_001271546.1.24696 WP_001271546.1.24716 WP_001271546.1.24723 WP_001271546.1.24727 WP_001271546.1.24737 WP_001271546.1.24779 WP_001271546.1.24803 WP_001271546.1.2481 WP_001271546.1.24832 WP_001271546.1.24837 WP_001271546.1.24839 WP_001271546.1.24873 WP_001271546.1.24901 WP_001271546.1.24944 WP_001271546.1.24964 WP_001271546.1.24995 WP_001271546.1.25008 WP_001271546.1.25015 WP_001271546.1.25017 WP_001271546.1.25032 WP_001271546.1.25036 WP_001271546.1.25041 WP_001271546.1.25053 WP_001271546.1.25064 WP_001271546.1.25072 WP_001271546.1.25119 WP_001271546.1.25130 WP_001271546.1.25140 WP_001271546.1.25159 WP_001271546.1.25175 WP_001271546.1.25185 WP_001271546.1.25196 WP_001271546.1.25205 WP_001271546.1.25206 WP_001271546.1.25210 WP_001271546.1.25217 WP_001271546.1.25219 WP_001271546.1.25229 WP_001271546.1.2525 WP_001271546.1.25297 WP_001271546.1.25304 WP_001271546.1.25354 WP_001271546.1.25374 WP_001271546.1.25397 WP_001271546.1.25405 WP_001271546.1.25421 WP_001271546.1.25426 WP_001271546.1.25454 WP_001271546.1.25475 WP_001271546.1.25490 WP_001271546.1.25493 WP_001271546.1.25498 WP_001271546.1.25508 WP_001271546.1.25512 WP_001271546.1.25514 WP_001271546.1.2554 WP_001271546.1.25546 WP_001271546.1.25564 WP_001271546.1.25596 WP_001271546.1.25603 WP_001271546.1.25618 WP_001271546.1.2562 WP_001271546.1.25666 WP_001271546.1.25668 WP_001271546.1.2568 WP_001271546.1.25690 WP_001271546.1.2570 WP_001271546.1.25700 WP_001271546.1.25703 WP_001271546.1.25708 WP_001271546.1.25709 WP_001271546.1.25722 WP_001271546.1.25740 WP_001271546.1.25780 WP_001271546.1.25793 WP_001271546.1.25807 WP_001271546.1.25809 WP_001271546.1.2581 WP_001271546.1.25814 WP_001271546.1.25821 WP_001271546.1.25833 WP_001271546.1.25835 WP_001271546.1.25846 WP_001271546.1.25882 WP_001271546.1.25911 WP_001271546.1.25928 WP_001271546.1.25932 WP_001271546.1.25944 WP_001271546.1.25951 WP_001271546.1.25962 WP_001271546.1.25963 WP_001271546.1.25988 WP_001271546.1.26001 WP_001271546.1.26027 WP_001271546.1.26030 WP_001271546.1.26034 WP_001271546.1.26075 WP_001271546.1.26083 WP_001271546.1.26093 WP_001271546.1.26107 WP_001271546.1.26122 WP_001271546.1.26123 WP_001271546.1.26129 WP_001271546.1.2615 WP_001271546.1.26194 WP_001271546.1.26199 WP_001271546.1.26213 WP_001271546.1.26217 WP_001271546.1.26224 WP_001271546.1.26230 WP_001271546.1.26232 WP_001271546.1.26269 WP_001271546.1.26272 WP_001271546.1.26282 WP_001271546.1.26286 WP_001271546.1.26288 WP_001271546.1.26311 WP_001271546.1.26319 WP_001271546.1.2634 WP_001271546.1.26363 WP_001271546.1.26384 WP_001271546.1.26394 WP_001271546.1.26414 WP_001271546.1.26426 WP_001271546.1.26429 WP_001271546.1.26440 WP_001271546.1.26441 WP_001271546.1.26491 WP_001271546.1.26493 WP_001271546.1.26512 WP_001271546.1.26532 WP_001271546.1.2654 WP_001271546.1.26551 WP_001271546.1.26554 WP_001271546.1.26563 WP_001271546.1.26567 WP_001271546.1.26576 WP_001271546.1.26582 WP_001271546.1.26587 WP_001271546.1.2660 WP_001271546.1.26636 WP_001271546.1.26646 WP_001271546.1.2667 WP_001271546.1.26687 WP_001271546.1.26689 WP_001271546.1.26709 WP_001271546.1.2672 WP_001271546.1.26741 WP_001271546.1.26750 WP_001271546.1.26758 WP_001271546.1.2679 WP_001271546.1.26794 WP_001271546.1.26833 WP_001271546.1.26856 WP_001271546.1.26882 WP_001271546.1.26883 WP_001271546.1.26892 WP_001271546.1.26908 WP_001271546.1.26919 WP_001271546.1.2692 WP_001271546.1.26924 WP_001271546.1.26928 WP_001271546.1.26936 WP_001271546.1.26980 WP_001271546.1.270 WP_001271546.1.27008 WP_001271546.1.27010 WP_001271546.1.27027 WP_001271546.1.27051 WP_001271546.1.27055 WP_001271546.1.27070 WP_001271546.1.27072 WP_001271546.1.27077 WP_001271546.1.27084 WP_001271546.1.27086 WP_001271546.1.27087 WP_001271546.1.27111 WP_001271546.1.27115 WP_001271546.1.27122 WP_001271546.1.27123 WP_001271546.1.2713 WP_001271546.1.27169 WP_001271546.1.2717 WP_001271546.1.27173 WP_001271546.1.272 WP_001271546.1.27206 WP_001271546.1.27223 WP_001271546.1.27228 WP_001271546.1.2723 WP_001271546.1.27255 WP_001271546.1.27272 WP_001271546.1.27279 WP_001271546.1.27282 WP_001271546.1.27285 WP_001271546.1.27309 WP_001271546.1.27314 WP_001271546.1.27329 WP_001271546.1.27342 WP_001271546.1.27361 WP_001271546.1.27383 WP_001271546.1.27419 WP_001271546.1.27423 WP_001271546.1.27452 WP_001271546.1.27513 WP_001271546.1.27522 WP_001271546.1.27523 WP_001271546.1.27535 WP_001271546.1.27544 WP_001271546.1.27547 WP_001271546.1.27556 WP_001271546.1.27561 WP_001271546.1.27565 WP_001271546.1.27595 WP_001271546.1.27598 WP_001271546.1.27616 WP_001271546.1.2763 WP_001271546.1.27632 WP_001271546.1.27638 WP_001271546.1.27655 WP_001271546.1.27658 WP_001271546.1.27665 WP_001271546.1.27679 WP_001271546.1.27706 WP_001271546.1.27707 WP_001271546.1.27713 WP_001271546.1.27755 WP_001271546.1.27761 WP_001271546.1.2777 WP_001271546.1.27775 WP_001271546.1.27776 WP_001271546.1.27785 WP_001271546.1.27798 WP_001271546.1.27800 WP_001271546.1.27815 WP_001271546.1.27833 WP_001271546.1.27857 WP_001271546.1.27883 WP_001271546.1.27900 WP_001271546.1.27928 WP_001271546.1.27945 WP_001271546.1.27969 WP_001271546.1.27977 WP_001271546.1.27995 WP_001271546.1.27997 WP_001271546.1.28002 WP_001271546.1.28004 WP_001271546.1.28032 WP_001271546.1.28037 WP_001271546.1.28056 WP_001271546.1.2806 WP_001271546.1.28073 WP_001271546.1.2809 WP_001271546.1.28094 WP_001271546.1.28116 WP_001271546.1.28126 WP_001271546.1.28139 WP_001271546.1.28155 WP_001271546.1.28170 WP_001271546.1.28174 WP_001271546.1.28198 WP_001271546.1.28200 WP_001271546.1.2822 WP_001271546.1.28225 WP_001271546.1.28229 WP_001271546.1.28232 WP_001271546.1.28233 WP_001271546.1.28235 WP_001271546.1.2825 WP_001271546.1.28267 WP_001271546.1.2829 WP_001271546.1.28301 WP_001271546.1.28302 WP_001271546.1.28303 WP_001271546.1.2835 WP_001271546.1.28370 WP_001271546.1.28384 WP_001271546.1.28386 WP_001271546.1.28393 WP_001271546.1.28395 WP_001271546.1.284 WP_001271546.1.2845 WP_001271546.1.28462 WP_001271546.1.28479 WP_001271546.1.28504 WP_001271546.1.28514 WP_001271546.1.2853 WP_001271546.1.28538 WP_001271546.1.28570 WP_001271546.1.28575 WP_001271546.1.28612 WP_001271546.1.28620 WP_001271546.1.28625 WP_001271546.1.28627 WP_001271546.1.28655 WP_001271546.1.28673 WP_001271546.1.28692 WP_001271546.1.28694 WP_001271546.1.287 WP_001271546.1.2873 WP_001271546.1.28733 WP_001271546.1.28773 WP_001271546.1.28775 WP_001271546.1.28776 WP_001271546.1.2879 WP_001271546.1.28811 WP_001271546.1.2890 WP_001271546.1.28902 WP_001271546.1.28917 WP_001271546.1.28921 WP_001271546.1.28938 WP_001271546.1.28946 WP_001271546.1.28948 WP_001271546.1.28962 WP_001271546.1.28963 WP_001271546.1.28977 WP_001271546.1.29006 WP_001271546.1.29010 WP_001271546.1.29023 WP_001271546.1.29042 WP_001271546.1.2905 WP_001271546.1.2907 WP_001271546.1.29081 WP_001271546.1.29089 WP_001271546.1.29099 WP_001271546.1.2910 WP_001271546.1.29113 WP_001271546.1.29130 WP_001271546.1.2915 WP_001271546.1.29153 WP_001271546.1.29168 WP_001271546.1.29174 WP_001271546.1.29190 WP_001271546.1.29203 WP_001271546.1.29218 WP_001271546.1.29237 WP_001271546.1.2924 WP_001271546.1.29248 WP_001271546.1.29255 WP_001271546.1.29265 WP_001271546.1.29274 WP_001271546.1.29288 WP_001271546.1.2932 WP_001271546.1.29349 WP_001271546.1.29379 WP_001271546.1.29389 WP_001271546.1.29422 WP_001271546.1.29436 WP_001271546.1.29439 WP_001271546.1.29454 WP_001271546.1.2946 WP_001271546.1.29462 WP_001271546.1.29509 WP_001271546.1.29530 WP_001271546.1.29563 WP_001271546.1.29576 WP_001271546.1.29588 WP_001271546.1.29593 WP_001271546.1.29601 WP_001271546.1.29606 WP_001271546.1.29615 WP_001271546.1.29619 WP_001271546.1.29682 WP_001271546.1.29704 WP_001271546.1.29711 WP_001271546.1.29727 WP_001271546.1.29732 WP_001271546.1.2974 WP_001271546.1.29743 WP_001271546.1.29768 WP_001271546.1.29774 WP_001271546.1.29775 WP_001271546.1.29782 WP_001271546.1.29827 WP_001271546.1.29833 WP_001271546.1.2984 WP_001271546.1.29845 WP_001271546.1.29851 WP_001271546.1.29865 WP_001271546.1.29886 WP_001271546.1.29898 WP_001271546.1.29919 WP_001271546.1.29923 WP_001271546.1.29924 WP_001271546.1.2994 WP_001271546.1.29964 WP_001271546.1.29983 WP_001271546.1.29990 WP_001271546.1.30006 WP_001271546.1.30009 WP_001271546.1.30013 WP_001271546.1.30018 WP_001271546.1.3002 WP_001271546.1.30022 WP_001271546.1.30027 WP_001271546.1.30034 WP_001271546.1.30049 WP_001271546.1.3005 WP_001271546.1.30058 WP_001271546.1.30059 WP_001271546.1.30086 WP_001271546.1.30093 WP_001271546.1.30165 WP_001271546.1.3017 WP_001271546.1.30170 WP_001271546.1.30172 WP_001271546.1.30179 WP_001271546.1.30180 WP_001271546.1.30185 WP_001271546.1.30195 WP_001271546.1.30202 WP_001271546.1.30210 WP_001271546.1.30213 WP_001271546.1.30225 WP_001271546.1.30238 WP_001271546.1.30246 WP_001271546.1.30278 WP_001271546.1.30331 WP_001271546.1.30354 WP_001271546.1.30356 WP_001271546.1.30357 WP_001271546.1.30362 WP_001271546.1.30386 WP_001271546.1.30389 WP_001271546.1.3042 WP_001271546.1.30421 WP_001271546.1.30425 WP_001271546.1.30437 WP_001271546.1.30440 WP_001271546.1.30448 WP_001271546.1.30469 WP_001271546.1.30489 WP_001271546.1.30492 WP_001271546.1.30505 WP_001271546.1.30507 WP_001271546.1.30517 WP_001271546.1.30535 WP_001271546.1.30542 WP_001271546.1.30544 WP_001271546.1.30547 WP_001271546.1.30548 WP_001271546.1.30555 WP_001271546.1.30556 WP_001271546.1.30572 WP_001271546.1.30573 WP_001271546.1.30585 WP_001271546.1.30589 WP_001271546.1.30602 WP_001271546.1.30618 WP_001271546.1.30619 WP_001271546.1.30627 WP_001271546.1.30635 WP_001271546.1.3066 WP_001271546.1.30664 WP_001271546.1.3067 WP_001271546.1.3068 WP_001271546.1.30688 WP_001271546.1.30696 WP_001271546.1.30752 WP_001271546.1.3076 WP_001271546.1.30794 WP_001271546.1.3080 WP_001271546.1.30802 WP_001271546.1.30803 WP_001271546.1.30806 WP_001271546.1.30819 WP_001271546.1.30823 WP_001271546.1.30833 WP_001271546.1.30835 WP_001271546.1.3089 WP_001271546.1.30909 WP_001271546.1.30934 WP_001271546.1.3095 WP_001271546.1.30951 WP_001271546.1.30967 WP_001271546.1.30968 WP_001271546.1.30972 WP_001271546.1.31 WP_001271546.1.31001 WP_001271546.1.31011 WP_001271546.1.31042 WP_001271546.1.31046 WP_001271546.1.31066 WP_001271546.1.31069 WP_001271546.1.31078 WP_001271546.1.31086 WP_001271546.1.31092 WP_001271546.1.31107 WP_001271546.1.31111 WP_001271546.1.31122 WP_001271546.1.3113 WP_001271546.1.31139 WP_001271546.1.3114 WP_001271546.1.31145 WP_001271546.1.31155 WP_001271546.1.31156 WP_001271546.1.31167 WP_001271546.1.31171 WP_001271546.1.31182 WP_001271546.1.31185 WP_001271546.1.3119 WP_001271546.1.31190 WP_001271546.1.31195 WP_001271546.1.31196 WP_001271546.1.31198 WP_001271546.1.31205 WP_001271546.1.3121 WP_001271546.1.31210 WP_001271546.1.31214 WP_001271546.1.31219 WP_001271546.1.31222 WP_001271546.1.31223 WP_001271546.1.3124 WP_001271546.1.31251 WP_001271546.1.31262 WP_001271546.1.3127 WP_001271546.1.31272 WP_001271546.1.31281 WP_001271546.1.31303 WP_001271546.1.3131 WP_001271546.1.31335 WP_001271546.1.31352 WP_001271546.1.31362 WP_001271546.1.31389 WP_001271546.1.31413 WP_001271546.1.31435 WP_001271546.1.31446 WP_001271546.1.31451 WP_001271546.1.31476 WP_001271546.1.31504 WP_001271546.1.31515 WP_001271546.1.31533 WP_001271546.1.31546 WP_001271546.1.31578 WP_001271546.1.31585 WP_001271546.1.31658 WP_001271546.1.31665 WP_001271546.1.3167 WP_001271546.1.31720 WP_001271546.1.31725 WP_001271546.1.31762 WP_001271546.1.31782 WP_001271546.1.31799 WP_001271546.1.31836 WP_001271546.1.31845 WP_001271546.1.3185 WP_001271546.1.31854 WP_001271546.1.31895 WP_001271546.1.31901 WP_001271546.1.31927 WP_001271546.1.31940 WP_001271546.1.31951 WP_001271546.1.31952 WP_001271546.1.31967 WP_001271546.1.31972 WP_001271546.1.31983 WP_001271546.1.32006 WP_001271546.1.32038 WP_001271546.1.32041 WP_001271546.1.32042 WP_001271546.1.32054 WP_001271546.1.32056 WP_001271546.1.3207 WP_001271546.1.3208 WP_001271546.1.32109 WP_001271546.1.32116 WP_001271546.1.32170 WP_001271546.1.32189 WP_001271546.1.32192 WP_001271546.1.32202 WP_001271546.1.32204 WP_001271546.1.32206 WP_001271546.1.32252 WP_001271546.1.32255 WP_001271546.1.32260 WP_001271546.1.32263 WP_001271546.1.32274 WP_001271546.1.32277 WP_001271546.1.32293 WP_001271546.1.32299 WP_001271546.1.32309 WP_001271546.1.32357 WP_001271546.1.32368 WP_001271546.1.32408 WP_001271546.1.32422 WP_001271546.1.32423 WP_001271546.1.32424 WP_001271546.1.32425 WP_001271546.1.32434 WP_001271546.1.32438 WP_001271546.1.32458 WP_001271546.1.32459 WP_001271546.1.32460 WP_001271546.1.32491 WP_001271546.1.32493 WP_001271546.1.32515 WP_001271546.1.32519 WP_001271546.1.32527 WP_001271546.1.32529 WP_001271546.1.32545 WP_001271546.1.32563 WP_001271546.1.32578 WP_001271546.1.32617 WP_001271546.1.32624 WP_001271546.1.32629 WP_001271546.1.32643 WP_001271546.1.32660 WP_001271546.1.32668 WP_001271546.1.3270 WP_001271546.1.32702 WP_001271546.1.32714 WP_001271546.1.32725 WP_001271546.1.32740 WP_001271546.1.32747 WP_001271546.1.32750 WP_001271546.1.3278 WP_001271546.1.32786 WP_001271546.1.32804 WP_001271546.1.32832 WP_001271546.1.32838 WP_001271546.1.32848 WP_001271546.1.32860 WP_001271546.1.32868 WP_001271546.1.32881 WP_001271546.1.32899 WP_001271546.1.329 WP_001271546.1.3290 WP_001271546.1.32902 WP_001271546.1.32907 WP_001271546.1.32930 WP_001271546.1.32940 WP_001271546.1.32941 WP_001271546.1.3296 WP_001271546.1.32961 WP_001271546.1.32966 WP_001271546.1.32977 WP_001271546.1.32985 WP_001271546.1.33010 WP_001271546.1.33030 WP_001271546.1.33037 WP_001271546.1.3304 WP_001271546.1.3305 WP_001271546.1.33051 WP_001271546.1.33065 WP_001271546.1.33078 WP_001271546.1.3310 WP_001271546.1.33106 WP_001271546.1.33114 WP_001271546.1.33122 WP_001271546.1.33127 WP_001271546.1.33143 WP_001271546.1.33144 WP_001271546.1.3315 WP_001271546.1.33160 WP_001271546.1.33208 WP_001271546.1.33214 WP_001271546.1.33247 WP_001271546.1.33248 WP_001271546.1.33253 WP_001271546.1.33261 WP_001271546.1.33280 WP_001271546.1.33283 WP_001271546.1.333 WP_001271546.1.33313 WP_001271546.1.33339 WP_001271546.1.33382 WP_001271546.1.33392 WP_001271546.1.33409 WP_001271546.1.33420 WP_001271546.1.33486 WP_001271546.1.33490 WP_001271546.1.33492 WP_001271546.1.33499 WP_001271546.1.335 WP_001271546.1.33501 WP_001271546.1.33504 WP_001271546.1.33529 WP_001271546.1.33553 WP_001271546.1.3356 WP_001271546.1.33580 WP_001271546.1.33586 WP_001271546.1.33592 WP_001271546.1.33609 WP_001271546.1.33629 WP_001271546.1.3364 WP_001271546.1.33659 WP_001271546.1.33689 WP_001271546.1.33693 WP_001271546.1.3370 WP_001271546.1.33730 WP_001271546.1.33741 WP_001271546.1.33817 WP_001271546.1.33825 WP_001271546.1.33840 WP_001271546.1.33865 WP_001271546.1.33870 WP_001271546.1.33894 WP_001271546.1.3392 WP_001271546.1.33926 WP_001271546.1.3394 WP_001271546.1.3395 WP_001271546.1.33957 WP_001271546.1.3396 WP_001271546.1.33969 WP_001271546.1.33986 WP_001271546.1.34 WP_001271546.1.34001 WP_001271546.1.34022 WP_001271546.1.34043 WP_001271546.1.34059 WP_001271546.1.34075 WP_001271546.1.34081 WP_001271546.1.34084 WP_001271546.1.34091 WP_001271546.1.34118 WP_001271546.1.34126 WP_001271546.1.34179 WP_001271546.1.34184 WP_001271546.1.34185 WP_001271546.1.34211 WP_001271546.1.34214 WP_001271546.1.34234 WP_001271546.1.34257 WP_001271546.1.34259 WP_001271546.1.34279 WP_001271546.1.34284 WP_001271546.1.34292 WP_001271546.1.34304 WP_001271546.1.34319 WP_001271546.1.34330 WP_001271546.1.34376 WP_001271546.1.3438 WP_001271546.1.34382 WP_001271546.1.34417 WP_001271546.1.34424 WP_001271546.1.34431 WP_001271546.1.3445 WP_001271546.1.34453 WP_001271546.1.34454 WP_001271546.1.34458 WP_001271546.1.34484 WP_001271546.1.34496 WP_001271546.1.34517 WP_001271546.1.34530 WP_001271546.1.34610 WP_001271546.1.34614 WP_001271546.1.34647 WP_001271546.1.34659 WP_001271546.1.34665 WP_001271546.1.34667 WP_001271546.1.34684 WP_001271546.1.34694 WP_001271546.1.34703 WP_001271546.1.34704 WP_001271546.1.34707 WP_001271546.1.34711 WP_001271546.1.34745 WP_001271546.1.34751 WP_001271546.1.3476 WP_001271546.1.34801 WP_001271546.1.34808 WP_001271546.1.34817 WP_001271546.1.34820 WP_001271546.1.34824 WP_001271546.1.34834 WP_001271546.1.34854 WP_001271546.1.34856 WP_001271546.1.34881 WP_001271546.1.3489 WP_001271546.1.34932 WP_001271546.1.34962 WP_001271546.1.34972 WP_001271546.1.34975 WP_001271546.1.34977 WP_001271546.1.35001 WP_001271546.1.35035 WP_001271546.1.35040 WP_001271546.1.35045 WP_001271546.1.35074 WP_001271546.1.35075 WP_001271546.1.35125 WP_001271546.1.35129 WP_001271546.1.35175 WP_001271546.1.35184 WP_001271546.1.35193 WP_001271546.1.35219 WP_001271546.1.35240 WP_001271546.1.35274 WP_001271546.1.35294 WP_001271546.1.35298 WP_001271546.1.35321 WP_001271546.1.35331 WP_001271546.1.35332 WP_001271546.1.35404 WP_001271546.1.35408 WP_001271546.1.35425 WP_001271546.1.35429 WP_001271546.1.35446 WP_001271546.1.35460 WP_001271546.1.35463 WP_001271546.1.35494 WP_001271546.1.35503 WP_001271546.1.35507 WP_001271546.1.35509 WP_001271546.1.35532 WP_001271546.1.3556 WP_001271546.1.35560 WP_001271546.1.35563 WP_001271546.1.3557 WP_001271546.1.35570 WP_001271546.1.35590 WP_001271546.1.35594 WP_001271546.1.35619 WP_001271546.1.35624 WP_001271546.1.35628 WP_001271546.1.35648 WP_001271546.1.3566 WP_001271546.1.3570 WP_001271546.1.35712 WP_001271546.1.35713 WP_001271546.1.3572 WP_001271546.1.35736 WP_001271546.1.35777 WP_001271546.1.35791 WP_001271546.1.35795 WP_001271546.1.35809 WP_001271546.1.35835 WP_001271546.1.35868 WP_001271546.1.35870 WP_001271546.1.35887 WP_001271546.1.35892 WP_001271546.1.35916 WP_001271546.1.35936 WP_001271546.1.35938 WP_001271546.1.35940 WP_001271546.1.35961 WP_001271546.1.35966 WP_001271546.1.35993 WP_001271546.1.36000 WP_001271546.1.36003 WP_001271546.1.3601 WP_001271546.1.36011 WP_001271546.1.36017 WP_001271546.1.36034 WP_001271546.1.36036 WP_001271546.1.36037 WP_001271546.1.36057 WP_001271546.1.36063 WP_001271546.1.36069 WP_001271546.1.3610 WP_001271546.1.36157 WP_001271546.1.36172 WP_001271546.1.36229 WP_001271546.1.36232 WP_001271546.1.36236 WP_001271546.1.36286 WP_001271546.1.36291 WP_001271546.1.36298 WP_001271546.1.36308 WP_001271546.1.36323 WP_001271546.1.36343 WP_001271546.1.36409 WP_001271546.1.36425 WP_001271546.1.36445 WP_001271546.1.36460 WP_001271546.1.3649 WP_001271546.1.36495 WP_001271546.1.36512 WP_001271546.1.36526 WP_001271546.1.36542 WP_001271546.1.36547 WP_001271546.1.36564 WP_001271546.1.36567 WP_001271546.1.36579 WP_001271546.1.36584 WP_001271546.1.36586 WP_001271546.1.36592 WP_001271546.1.36609 WP_001271546.1.36617 WP_001271546.1.36618 WP_001271546.1.36643 WP_001271546.1.36652 WP_001271546.1.36663 WP_001271546.1.36685 WP_001271546.1.36690 WP_001271546.1.3670 WP_001271546.1.36701 WP_001271546.1.36705 WP_001271546.1.36721 WP_001271546.1.36725 WP_001271546.1.36751 WP_001271546.1.36764 WP_001271546.1.36765 WP_001271546.1.36779 WP_001271546.1.36792 WP_001271546.1.36798 WP_001271546.1.36802 WP_001271546.1.36821 WP_001271546.1.36839 WP_001271546.1.36853 WP_001271546.1.36875 WP_001271546.1.3688 WP_001271546.1.36885 WP_001271546.1.36889 WP_001271546.1.36899 WP_001271546.1.36918 WP_001271546.1.36931 WP_001271546.1.36948 WP_001271546.1.36949 WP_001271546.1.36950 WP_001271546.1.36978 WP_001271546.1.37013 WP_001271546.1.37014 WP_001271546.1.37021 WP_001271546.1.37028 WP_001271546.1.37029 WP_001271546.1.37063 WP_001271546.1.37073 WP_001271546.1.37100 WP_001271546.1.37111 WP_001271546.1.37112 WP_001271546.1.37114 WP_001271546.1.37133 WP_001271546.1.37147 WP_001271546.1.37158 WP_001271546.1.37176 WP_001271546.1.37190 WP_001271546.1.37191 WP_001271546.1.37199 WP_001271546.1.37200 WP_001271546.1.37256 WP_001271546.1.37258 WP_001271546.1.3726 WP_001271546.1.37267 WP_001271546.1.3728 WP_001271546.1.37293 WP_001271546.1.37297 WP_001271546.1.37303 WP_001271546.1.37320 WP_001271546.1.3734 WP_001271546.1.37351 WP_001271546.1.37363 WP_001271546.1.37370 WP_001271546.1.37376 WP_001271546.1.37405 WP_001271546.1.3744 WP_001271546.1.37478 WP_001271546.1.3748 WP_001271546.1.37498 WP_001271546.1.37504 WP_001271546.1.3751 WP_001271546.1.37513 WP_001271546.1.37521 WP_001271546.1.37558 WP_001271546.1.3756 WP_001271546.1.37584 WP_001271546.1.37590 WP_001271546.1.37593 WP_001271546.1.37600 WP_001271546.1.37610 WP_001271546.1.37613 WP_001271546.1.37618 WP_001271546.1.37659 WP_001271546.1.37662 WP_001271546.1.37666 WP_001271546.1.37675 WP_001271546.1.37687 WP_001271546.1.37691 WP_001271546.1.3771 WP_001271546.1.37719 WP_001271546.1.37761 WP_001271546.1.37775 WP_001271546.1.37777 WP_001271546.1.3778 WP_001271546.1.378 WP_001271546.1.37808 WP_001271546.1.37848 WP_001271546.1.37864 WP_001271546.1.379 WP_001271546.1.3790 WP_001271546.1.37911 WP_001271546.1.37941 WP_001271546.1.37965 WP_001271546.1.37968 WP_001271546.1.37978 WP_001271546.1.37985 WP_001271546.1.38001 WP_001271546.1.38026 WP_001271546.1.38037 WP_001271546.1.38047 WP_001271546.1.38055 WP_001271546.1.38061 WP_001271546.1.38064 WP_001271546.1.38108 WP_001271546.1.38113 WP_001271546.1.38125 WP_001271546.1.38145 WP_001271546.1.3816 WP_001271546.1.38199 WP_001271546.1.38207 WP_001271546.1.38261 WP_001271546.1.38266 WP_001271546.1.38273 WP_001271546.1.3828 WP_001271546.1.383 WP_001271546.1.38310 WP_001271546.1.38322 WP_001271546.1.3834 WP_001271546.1.38341 WP_001271546.1.38344 WP_001271546.1.38349 WP_001271546.1.38351 WP_001271546.1.3838 WP_001271546.1.38381 WP_001271546.1.38393 WP_001271546.1.38408 WP_001271546.1.38440 WP_001271546.1.38452 WP_001271546.1.3848 WP_001271546.1.38486 WP_001271546.1.38512 WP_001271546.1.38515 WP_001271546.1.38569 WP_001271546.1.38595 WP_001271546.1.3860 WP_001271546.1.38609 WP_001271546.1.38613 WP_001271546.1.38620 WP_001271546.1.38622 WP_001271546.1.38642 WP_001271546.1.38673 WP_001271546.1.3869 WP_001271546.1.38693 WP_001271546.1.38734 WP_001271546.1.38740 WP_001271546.1.38773 WP_001271546.1.38781 WP_001271546.1.38797 WP_001271546.1.38830 WP_001271546.1.38857 WP_001271546.1.38877 WP_001271546.1.38881 WP_001271546.1.38882 WP_001271546.1.38895 WP_001271546.1.38898 WP_001271546.1.3891 WP_001271546.1.38913 WP_001271546.1.38942 WP_001271546.1.38983 WP_001271546.1.38995 WP_001271546.1.38996 WP_001271546.1.39003 WP_001271546.1.39038 WP_001271546.1.39048 WP_001271546.1.39055 WP_001271546.1.39056 WP_001271546.1.39059 WP_001271546.1.39065 WP_001271546.1.3907 WP_001271546.1.39082 WP_001271546.1.39105 WP_001271546.1.39112 WP_001271546.1.39113 WP_001271546.1.39128 WP_001271546.1.39136 WP_001271546.1.3914 WP_001271546.1.39140 WP_001271546.1.39147 WP_001271546.1.39161 WP_001271546.1.39183 WP_001271546.1.39197 WP_001271546.1.39210 WP_001271546.1.39229 WP_001271546.1.39235 WP_001271546.1.39265 WP_001271546.1.39275 WP_001271546.1.3931 WP_001271546.1.39311 WP_001271546.1.39312 WP_001271546.1.39385 WP_001271546.1.39395 WP_001271546.1.39405 WP_001271546.1.39414 WP_001271546.1.39420 WP_001271546.1.39435 WP_001271546.1.39449 WP_001271546.1.39466 WP_001271546.1.39471 WP_001271546.1.39497 WP_001271546.1.39502 WP_001271546.1.39503 WP_001271546.1.39512 WP_001271546.1.39530 WP_001271546.1.39553 WP_001271546.1.39556 WP_001271546.1.39576 WP_001271546.1.39584 WP_001271546.1.39609 WP_001271546.1.39614 WP_001271546.1.39619 WP_001271546.1.39620 WP_001271546.1.39624 WP_001271546.1.39629 WP_001271546.1.39632 WP_001271546.1.39659 WP_001271546.1.39667 WP_001271546.1.39722 WP_001271546.1.39723 WP_001271546.1.39724 WP_001271546.1.39763 WP_001271546.1.39775 WP_001271546.1.39808 WP_001271546.1.39862 WP_001271546.1.39879 WP_001271546.1.39890 WP_001271546.1.39921 WP_001271546.1.39923 WP_001271546.1.39941 WP_001271546.1.39945 WP_001271546.1.39947 WP_001271546.1.39953 WP_001271546.1.40008 WP_001271546.1.40017 WP_001271546.1.40025 WP_001271546.1.40031 WP_001271546.1.40072 WP_001271546.1.40073 WP_001271546.1.40081 WP_001271546.1.40095 WP_001271546.1.40097 WP_001271546.1.401 WP_001271546.1.4011 WP_001271546.1.40111 WP_001271546.1.40155 WP_001271546.1.40158 WP_001271546.1.40160 WP_001271546.1.40167 WP_001271546.1.40170 WP_001271546.1.40171 WP_001271546.1.40205 WP_001271546.1.40208 WP_001271546.1.40224 WP_001271546.1.40229 WP_001271546.1.40240 WP_001271546.1.40254 WP_001271546.1.40257 WP_001271546.1.40258 WP_001271546.1.40259 WP_001271546.1.40279 WP_001271546.1.40284 WP_001271546.1.40292 WP_001271546.1.40305 WP_001271546.1.40307 WP_001271546.1.40311 WP_001271546.1.40341 WP_001271546.1.40361 WP_001271546.1.40374 WP_001271546.1.40380 WP_001271546.1.40395 WP_001271546.1.4042 WP_001271546.1.40465 WP_001271546.1.40467 WP_001271546.1.40492 WP_001271546.1.40493 WP_001271546.1.40496 WP_001271546.1.40508 WP_001271546.1.40517 WP_001271546.1.40528 WP_001271546.1.40533 WP_001271546.1.40577 WP_001271546.1.40583 WP_001271546.1.40605 WP_001271546.1.40622 WP_001271546.1.40648 WP_001271546.1.40688 WP_001271546.1.40693 WP_001271546.1.40695 WP_001271546.1.40698 WP_001271546.1.40710 WP_001271546.1.40722 WP_001271546.1.40745 WP_001271546.1.4075 WP_001271546.1.40750 WP_001271546.1.40763 WP_001271546.1.40771 WP_001271546.1.40788 WP_001271546.1.40849 WP_001271546.1.40854 WP_001271546.1.4087 WP_001271546.1.40877 WP_001271546.1.4088 WP_001271546.1.4089 WP_001271546.1.40910 WP_001271546.1.40924 WP_001271546.1.40930 WP_001271546.1.40932 WP_001271546.1.40935 WP_001271546.1.40946 WP_001271546.1.40973 WP_001271546.1.40979 WP_001271546.1.40996 WP_001271546.1.41004 WP_001271546.1.41017 WP_001271546.1.41018 WP_001271546.1.41048 WP_001271546.1.41050 WP_001271546.1.4106 WP_001271546.1.41070 WP_001271546.1.41074 WP_001271546.1.41075 WP_001271546.1.41086 WP_001271546.1.4109 WP_001271546.1.41091 WP_001271546.1.41097 WP_001271546.1.41116 WP_001271546.1.41128 WP_001271546.1.41132 WP_001271546.1.4114 WP_001271546.1.41176 WP_001271546.1.41192 WP_001271546.1.41225 WP_001271546.1.41226 WP_001271546.1.41251 WP_001271546.1.41258 WP_001271546.1.41265 WP_001271546.1.41277 WP_001271546.1.41279 WP_001271546.1.41299 WP_001271546.1.41305 WP_001271546.1.41308 WP_001271546.1.41310 WP_001271546.1.41321 WP_001271546.1.41333 WP_001271546.1.41335 WP_001271546.1.41345 WP_001271546.1.4136 WP_001271546.1.41375 WP_001271546.1.4141 WP_001271546.1.41415 WP_001271546.1.41427 WP_001271546.1.41434 WP_001271546.1.41438 WP_001271546.1.41440 WP_001271546.1.41459 WP_001271546.1.41468 WP_001271546.1.41498 WP_001271546.1.41516 WP_001271546.1.41519 WP_001271546.1.41524 WP_001271546.1.41528 WP_001271546.1.41554 WP_001271546.1.41572 WP_001271546.1.41591 WP_001271546.1.41593 WP_001271546.1.41610 WP_001271546.1.41628 WP_001271546.1.41631 WP_001271546.1.41658 WP_001271546.1.41659 WP_001271546.1.41662 WP_001271546.1.41688 WP_001271546.1.41690 WP_001271546.1.41708 WP_001271546.1.41716 WP_001271546.1.41735 WP_001271546.1.41746 WP_001271546.1.41761 WP_001271546.1.4178 WP_001271546.1.41789 WP_001271546.1.41799 WP_001271546.1.41802 WP_001271546.1.41824 WP_001271546.1.41825 WP_001271546.1.41836 WP_001271546.1.4184 WP_001271546.1.41859 WP_001271546.1.41862 WP_001271546.1.41877 WP_001271546.1.41882 WP_001271546.1.41894 WP_001271546.1.41897 WP_001271546.1.41904 WP_001271546.1.41911 WP_001271546.1.41919 WP_001271546.1.41929 WP_001271546.1.41931 WP_001271546.1.41938 WP_001271546.1.41949 WP_001271546.1.41978 WP_001271546.1.41979 WP_001271546.1.41985 WP_001271546.1.41994 WP_001271546.1.41998 WP_001271546.1.42009 WP_001271546.1.42069 WP_001271546.1.42081 WP_001271546.1.42090 WP_001271546.1.42098 WP_001271546.1.42104 WP_001271546.1.42109 WP_001271546.1.42111 WP_001271546.1.42136 WP_001271546.1.42156 WP_001271546.1.42187 WP_001271546.1.422 WP_001271546.1.42200 WP_001271546.1.42219 WP_001271546.1.4222 WP_001271546.1.42238 WP_001271546.1.42243 WP_001271546.1.42244 WP_001271546.1.42248 WP_001271546.1.42257 WP_001271546.1.42261 WP_001271546.1.42262 WP_001271546.1.42263 WP_001271546.1.42276 WP_001271546.1.4229 WP_001271546.1.42320 WP_001271546.1.42322 WP_001271546.1.42328 WP_001271546.1.42342 WP_001271546.1.42349 WP_001271546.1.42356 WP_001271546.1.42364 WP_001271546.1.42371 WP_001271546.1.42372 WP_001271546.1.42379 WP_001271546.1.4239 WP_001271546.1.42391 WP_001271546.1.42392 WP_001271546.1.42399 WP_001271546.1.42404 WP_001271546.1.42422 WP_001271546.1.42433 WP_001271546.1.42444 WP_001271546.1.42453 WP_001271546.1.42489 WP_001271546.1.42491 WP_001271546.1.42539 WP_001271546.1.4257 WP_001271546.1.42595 WP_001271546.1.42603 WP_001271546.1.42605 WP_001271546.1.42650 WP_001271546.1.42655 WP_001271546.1.42666 WP_001271546.1.4267 WP_001271546.1.42675 WP_001271546.1.42676 WP_001271546.1.42683 WP_001271546.1.42685 WP_001271546.1.42701 WP_001271546.1.42707 WP_001271546.1.4276 WP_001271546.1.42767 WP_001271546.1.42794 WP_001271546.1.42797 WP_001271546.1.42805 WP_001271546.1.42815 WP_001271546.1.42829 WP_001271546.1.42859 WP_001271546.1.42861 WP_001271546.1.42864 WP_001271546.1.4288 WP_001271546.1.42887 WP_001271546.1.4289 WP_001271546.1.42892 WP_001271546.1.42923 WP_001271546.1.42932 WP_001271546.1.42957 WP_001271546.1.42978 WP_001271546.1.4298 WP_001271546.1.42981 WP_001271546.1.43008 WP_001271546.1.43016 WP_001271546.1.43018 WP_001271546.1.43019 WP_001271546.1.43041 WP_001271546.1.43065 WP_001271546.1.43068 WP_001271546.1.43069 WP_001271546.1.43070 WP_001271546.1.43077 WP_001271546.1.43086 WP_001271546.1.43089 WP_001271546.1.43128 WP_001271546.1.43141 WP_001271546.1.43149 WP_001271546.1.43157 WP_001271546.1.43160 WP_001271546.1.43161 WP_001271546.1.43190 WP_001271546.1.43198 WP_001271546.1.43201 WP_001271546.1.43244 WP_001271546.1.43258 WP_001271546.1.4326 WP_001271546.1.43272 WP_001271546.1.43276 WP_001271546.1.43290 WP_001271546.1.43292 WP_001271546.1.43299 WP_001271546.1.43307 WP_001271546.1.43312 WP_001271546.1.4332 WP_001271546.1.43334 WP_001271546.1.43339 WP_001271546.1.43351 WP_001271546.1.43371 WP_001271546.1.43437 WP_001271546.1.43438 WP_001271546.1.4344 WP_001271546.1.43441 WP_001271546.1.43476 WP_001271546.1.43508 WP_001271546.1.43513 WP_001271546.1.43520 WP_001271546.1.43522 WP_001271546.1.43528 WP_001271546.1.43535 WP_001271546.1.43606 WP_001271546.1.43613 WP_001271546.1.43633 WP_001271546.1.43637 WP_001271546.1.43651 WP_001271546.1.43654 WP_001271546.1.43668 WP_001271546.1.43676 WP_001271546.1.43685 WP_001271546.1.43710 WP_001271546.1.43711 WP_001271546.1.43722 WP_001271546.1.4373 WP_001271546.1.43778 WP_001271546.1.43782 WP_001271546.1.43785 WP_001271546.1.43801 WP_001271546.1.43812 WP_001271546.1.43828 WP_001271546.1.43839 WP_001271546.1.43864 WP_001271546.1.43873 WP_001271546.1.43875 WP_001271546.1.43878 WP_001271546.1.43886 WP_001271546.1.43888 WP_001271546.1.43919 WP_001271546.1.43951 WP_001271546.1.43954 WP_001271546.1.43974 WP_001271546.1.44005 WP_001271546.1.44010 WP_001271546.1.4404 WP_001271546.1.44043 WP_001271546.1.44049 WP_001271546.1.4405 WP_001271546.1.44063 WP_001271546.1.44099 WP_001271546.1.44101 WP_001271546.1.44113 WP_001271546.1.44121 WP_001271546.1.44132 WP_001271546.1.44144 WP_001271546.1.44160 WP_001271546.1.44180 WP_001271546.1.44187 WP_001271546.1.44191 WP_001271546.1.44196 WP_001271546.1.4422 WP_001271546.1.4423 WP_001271546.1.44248 WP_001271546.1.44250 WP_001271546.1.44262 WP_001271546.1.44268 WP_001271546.1.4427 WP_001271546.1.44291 WP_001271546.1.44296 WP_001271546.1.44300 WP_001271546.1.44310 WP_001271546.1.44337 WP_001271546.1.44339 WP_001271546.1.44343 WP_001271546.1.44351 WP_001271546.1.44359 WP_001271546.1.44360 WP_001271546.1.44380 WP_001271546.1.44386 WP_001271546.1.44397 WP_001271546.1.4440 WP_001271546.1.44416 WP_001271546.1.44431 WP_001271546.1.44433 WP_001271546.1.44437 WP_001271546.1.44438 WP_001271546.1.44440 WP_001271546.1.44443 WP_001271546.1.44453 WP_001271546.1.44474 WP_001271546.1.44479 WP_001271546.1.44546 WP_001271546.1.44549 WP_001271546.1.44578 WP_001271546.1.44593 WP_001271546.1.44606 WP_001271546.1.44607 WP_001271546.1.44633 WP_001271546.1.44636 WP_001271546.1.44640 WP_001271546.1.4467 WP_001271546.1.44678 WP_001271546.1.4468 WP_001271546.1.44687 WP_001271546.1.44702 WP_001271546.1.44705 WP_001271546.1.44747 WP_001271546.1.44762 WP_001271546.1.44781 WP_001271546.1.44791 WP_001271546.1.44795 WP_001271546.1.44815 WP_001271546.1.44828 WP_001271546.1.44831 WP_001271546.1.44833 WP_001271546.1.4485 WP_001271546.1.44877 WP_001271546.1.44879 WP_001271546.1.44887 WP_001271546.1.449 WP_001271546.1.44917 WP_001271546.1.44927 WP_001271546.1.44933 WP_001271546.1.44943 WP_001271546.1.44950 WP_001271546.1.44966 WP_001271546.1.44971 WP_001271546.1.44978 WP_001271546.1.44985 WP_001271546.1.44996 WP_001271546.1.44997 WP_001271546.1.44998 WP_001271546.1.4500 WP_001271546.1.4501 WP_001271546.1.45027 WP_001271546.1.45038 WP_001271546.1.45045 WP_001271546.1.4505 WP_001271546.1.45067 WP_001271546.1.45072 WP_001271546.1.45074 WP_001271546.1.45079 WP_001271546.1.45093 WP_001271546.1.45098 WP_001271546.1.45123 WP_001271546.1.45134 WP_001271546.1.45136 WP_001271546.1.45138 WP_001271546.1.45145 WP_001271546.1.45154 WP_001271546.1.45173 WP_001271546.1.45177 WP_001271546.1.45184 WP_001271546.1.45229 WP_001271546.1.45241 WP_001271546.1.45251 WP_001271546.1.45259 WP_001271546.1.45268 WP_001271546.1.45302 WP_001271546.1.4531 WP_001271546.1.45322 WP_001271546.1.45344 WP_001271546.1.45349 WP_001271546.1.45351 WP_001271546.1.45365 WP_001271546.1.4540 WP_001271546.1.45402 WP_001271546.1.45432 WP_001271546.1.45434 WP_001271546.1.45435 WP_001271546.1.45462 WP_001271546.1.45522 WP_001271546.1.45523 WP_001271546.1.45535 WP_001271546.1.45544 WP_001271546.1.45549 WP_001271546.1.45550 WP_001271546.1.45566 WP_001271546.1.45569 WP_001271546.1.45571 WP_001271546.1.45582 WP_001271546.1.45583 WP_001271546.1.45585 WP_001271546.1.45596 WP_001271546.1.45622 WP_001271546.1.45648 WP_001271546.1.45660 WP_001271546.1.45690 WP_001271546.1.45706 WP_001271546.1.45781 WP_001271546.1.45797 WP_001271546.1.458 WP_001271546.1.45829 WP_001271546.1.45844 WP_001271546.1.45848 WP_001271546.1.45871 WP_001271546.1.45906 WP_001271546.1.45918 WP_001271546.1.4592 WP_001271546.1.45947 WP_001271546.1.45984 WP_001271546.1.46011 WP_001271546.1.46028 WP_001271546.1.46030 WP_001271546.1.46069 WP_001271546.1.46077 WP_001271546.1.46091 WP_001271546.1.46112 WP_001271546.1.46124 WP_001271546.1.46169 WP_001271546.1.46173 WP_001271546.1.46174 WP_001271546.1.46187 WP_001271546.1.46203 WP_001271546.1.46205 WP_001271546.1.46215 WP_001271546.1.46225 WP_001271546.1.46232 WP_001271546.1.46241 WP_001271546.1.46243 WP_001271546.1.46250 WP_001271546.1.46278 WP_001271546.1.46286 WP_001271546.1.46299 WP_001271546.1.46303 WP_001271546.1.46307 WP_001271546.1.46322 WP_001271546.1.46323 WP_001271546.1.46345 WP_001271546.1.46355 WP_001271546.1.46358 WP_001271546.1.464 WP_001271546.1.46406 WP_001271546.1.46434 WP_001271546.1.46444 WP_001271546.1.46454 WP_001271546.1.46461 WP_001271546.1.46499 WP_001271546.1.46504 WP_001271546.1.46505 WP_001271546.1.46551 WP_001271546.1.46559 WP_001271546.1.46572 WP_001271546.1.46574 WP_001271546.1.46578 WP_001271546.1.46595 WP_001271546.1.46620 WP_001271546.1.46637 WP_001271546.1.46666 WP_001271546.1.46675 WP_001271546.1.46689 WP_001271546.1.46693 WP_001271546.1.46701 WP_001271546.1.4671 WP_001271546.1.46726 WP_001271546.1.46730 WP_001271546.1.46732 WP_001271546.1.4674 WP_001271546.1.46749 WP_001271546.1.46781 WP_001271546.1.46803 WP_001271546.1.46816 WP_001271546.1.46842 WP_001271546.1.4686 WP_001271546.1.4690 WP_001271546.1.46920 WP_001271546.1.46930 WP_001271546.1.46945 WP_001271546.1.46961 WP_001271546.1.46967 WP_001271546.1.46976 WP_001271546.1.47005 WP_001271546.1.47008 WP_001271546.1.47014 WP_001271546.1.47023 WP_001271546.1.47036 WP_001271546.1.47037 WP_001271546.1.47042 WP_001271546.1.47057 WP_001271546.1.47059 WP_001271546.1.47061 WP_001271546.1.47067 WP_001271546.1.47085 WP_001271546.1.47123 WP_001271546.1.47214 WP_001271546.1.47215 WP_001271546.1.47243 WP_001271546.1.47245 WP_001271546.1.47257 WP_001271546.1.47389 WP_001271546.1.47429 WP_001271546.1.47442 WP_001271546.1.47448 WP_001271546.1.47460 WP_001271546.1.4747 WP_001271546.1.47472 WP_001271546.1.47478 WP_001271546.1.47482 WP_001271546.1.47492 WP_001271546.1.47506 WP_001271546.1.47523 WP_001271546.1.47531 WP_001271546.1.47532 WP_001271546.1.47542 WP_001271546.1.47567 WP_001271546.1.47576 WP_001271546.1.47579 WP_001271546.1.4758 WP_001271546.1.47587 WP_001271546.1.47605 WP_001271546.1.47614 WP_001271546.1.47621 WP_001271546.1.47630 WP_001271546.1.47649 WP_001271546.1.47660 WP_001271546.1.4769 WP_001271546.1.4770 WP_001271546.1.47714 WP_001271546.1.4774 WP_001271546.1.4775 WP_001271546.1.47756 WP_001271546.1.47767 WP_001271546.1.47799 WP_001271546.1.4781 WP_001271546.1.47814 WP_001271546.1.47817 WP_001271546.1.47829 WP_001271546.1.47849 WP_001271546.1.47850 WP_001271546.1.47875 WP_001271546.1.47886 WP_001271546.1.47898 WP_001271546.1.47902 WP_001271546.1.47911 WP_001271546.1.47928 WP_001271546.1.4795 WP_001271546.1.47988 WP_001271546.1.47992 WP_001271546.1.48019 WP_001271546.1.48100 WP_001271546.1.48114 WP_001271546.1.48124 WP_001271546.1.48132 WP_001271546.1.48134 WP_001271546.1.48139 WP_001271546.1.48190 WP_001271546.1.48209 WP_001271546.1.48215 WP_001271546.1.48218 WP_001271546.1.48242 WP_001271546.1.48244 WP_001271546.1.48247 WP_001271546.1.48253 WP_001271546.1.48262 WP_001271546.1.48268 WP_001271546.1.48292 WP_001271546.1.483 WP_001271546.1.48324 WP_001271546.1.48367 WP_001271546.1.48377 WP_001271546.1.4839 WP_001271546.1.48399 WP_001271546.1.48426 WP_001271546.1.48430 WP_001271546.1.48436 WP_001271546.1.48455 WP_001271546.1.48493 WP_001271546.1.48510 WP_001271546.1.48524 WP_001271546.1.4853 WP_001271546.1.48570 WP_001271546.1.48586 WP_001271546.1.4859 WP_001271546.1.48591 WP_001271546.1.48610 WP_001271546.1.48631 WP_001271546.1.48647 WP_001271546.1.48651 WP_001271546.1.48663 WP_001271546.1.48690 WP_001271546.1.48734 WP_001271546.1.48751 WP_001271546.1.48755 WP_001271546.1.48756 WP_001271546.1.48768 WP_001271546.1.48774 WP_001271546.1.48778 WP_001271546.1.48788 WP_001271546.1.48797 WP_001271546.1.48841 WP_001271546.1.48849 WP_001271546.1.4885 WP_001271546.1.48855 WP_001271546.1.48876 WP_001271546.1.48886 WP_001271546.1.48894 WP_001271546.1.48896 WP_001271546.1.48908 WP_001271546.1.48918 WP_001271546.1.48919 WP_001271546.1.48931 WP_001271546.1.48955 WP_001271546.1.48963 WP_001271546.1.48973 WP_001271546.1.48985 WP_001271546.1.49004 WP_001271546.1.49005 WP_001271546.1.49012 WP_001271546.1.49041 WP_001271546.1.49084 WP_001271546.1.49090 WP_001271546.1.49102 WP_001271546.1.49106 WP_001271546.1.49113 WP_001271546.1.49117 WP_001271546.1.49121 WP_001271546.1.4914 WP_001271546.1.49140 WP_001271546.1.49153 WP_001271546.1.49155 WP_001271546.1.49162 WP_001271546.1.49166 WP_001271546.1.49175 WP_001271546.1.49204 WP_001271546.1.49214 WP_001271546.1.49226 WP_001271546.1.49233 WP_001271546.1.49239 WP_001271546.1.49256 WP_001271546.1.49262 WP_001271546.1.49276 WP_001271546.1.49290 WP_001271546.1.49304 WP_001271546.1.49309 WP_001271546.1.49311 WP_001271546.1.49334 WP_001271546.1.49340 WP_001271546.1.49355 WP_001271546.1.49358 WP_001271546.1.49366 WP_001271546.1.49429 WP_001271546.1.49430 WP_001271546.1.49434 WP_001271546.1.49443 WP_001271546.1.49450 WP_001271546.1.49472 WP_001271546.1.49490 WP_001271546.1.49494 WP_001271546.1.495 WP_001271546.1.49515 WP_001271546.1.49545 WP_001271546.1.49550 WP_001271546.1.49572 WP_001271546.1.49574 WP_001271546.1.49590 WP_001271546.1.49595 WP_001271546.1.49626 WP_001271546.1.49630 WP_001271546.1.49650 WP_001271546.1.49686 WP_001271546.1.49703 WP_001271546.1.49769 WP_001271546.1.49770 WP_001271546.1.49778 WP_001271546.1.49780 WP_001271546.1.4979 WP_001271546.1.49790 WP_001271546.1.49803 WP_001271546.1.49805 WP_001271546.1.49827 WP_001271546.1.49846 WP_001271546.1.49848 WP_001271546.1.4991 WP_001271546.1.49929 WP_001271546.1.49931 WP_001271546.1.49947 WP_001271546.1.49959 WP_001271546.1.49997 WP_001271546.1.50 WP_001271546.1.50003 WP_001271546.1.50007 WP_001271546.1.50014 WP_001271546.1.50030 WP_001271546.1.50043 WP_001271546.1.50080 WP_001271546.1.5009 WP_001271546.1.50103 WP_001271546.1.50128 WP_001271546.1.50153 WP_001271546.1.50158 WP_001271546.1.50161 WP_001271546.1.50198 WP_001271546.1.50211 WP_001271546.1.50238 WP_001271546.1.50239 WP_001271546.1.50247 WP_001271546.1.50251 WP_001271546.1.50285 WP_001271546.1.50308 WP_001271546.1.50309 WP_001271546.1.50332 WP_001271546.1.50349 WP_001271546.1.50374 WP_001271546.1.50376 WP_001271546.1.50386 WP_001271546.1.50387 WP_001271546.1.50389 WP_001271546.1.50404 WP_001271546.1.50406 WP_001271546.1.50413 WP_001271546.1.50468 WP_001271546.1.50469 WP_001271546.1.50480 WP_001271546.1.50497 WP_001271546.1.5051 WP_001271546.1.50517 WP_001271546.1.50529 WP_001271546.1.50563 WP_001271546.1.50565 WP_001271546.1.50566 WP_001271546.1.50570 WP_001271546.1.50576 WP_001271546.1.50593 WP_001271546.1.50626 WP_001271546.1.50652 WP_001271546.1.50676 WP_001271546.1.50684 WP_001271546.1.50726 WP_001271546.1.50750 WP_001271546.1.50769 WP_001271546.1.50771 WP_001271546.1.50774 WP_001271546.1.50777 WP_001271546.1.50782 WP_001271546.1.50800 WP_001271546.1.50804 WP_001271546.1.50808 WP_001271546.1.50811 WP_001271546.1.50875 WP_001271546.1.5088 WP_001271546.1.50882 WP_001271546.1.50885 WP_001271546.1.50893 WP_001271546.1.509 WP_001271546.1.50905 WP_001271546.1.50908 WP_001271546.1.50918 WP_001271546.1.50929 WP_001271546.1.50941 WP_001271546.1.50954 WP_001271546.1.50960 WP_001271546.1.50970 WP_001271546.1.50999 WP_001271546.1.51014 WP_001271546.1.51022 WP_001271546.1.51025 WP_001271546.1.51036 WP_001271546.1.51040 WP_001271546.1.51048 WP_001271546.1.51066 WP_001271546.1.51100 WP_001271546.1.51117 WP_001271546.1.51131 WP_001271546.1.51134 WP_001271546.1.51139 WP_001271546.1.5114 WP_001271546.1.51178 WP_001271546.1.51179 WP_001271546.1.51182 WP_001271546.1.51186 WP_001271546.1.51224 WP_001271546.1.51227 WP_001271546.1.5125 WP_001271546.1.5127 WP_001271546.1.51285 WP_001271546.1.51305 WP_001271546.1.51308 WP_001271546.1.51315 WP_001271546.1.51331 WP_001271546.1.51338 WP_001271546.1.51356 WP_001271546.1.5136 WP_001271546.1.5138 WP_001271546.1.51394 WP_001271546.1.51412 WP_001271546.1.51414 WP_001271546.1.51451 WP_001271546.1.51464 WP_001271546.1.51474 WP_001271546.1.51487 WP_001271546.1.51488 WP_001271546.1.51502 WP_001271546.1.51506 WP_001271546.1.51514 WP_001271546.1.51518 WP_001271546.1.51519 WP_001271546.1.51555 WP_001271546.1.51594 WP_001271546.1.51598 WP_001271546.1.51611 WP_001271546.1.51613 WP_001271546.1.51615 WP_001271546.1.51634 WP_001271546.1.51642 WP_001271546.1.51644 WP_001271546.1.51649 WP_001271546.1.51686 WP_001271546.1.51700 WP_001271546.1.51704 WP_001271546.1.51724 WP_001271546.1.51734 WP_001271546.1.51756 WP_001271546.1.51764 WP_001271546.1.51810 WP_001271546.1.51831 WP_001271546.1.51838 WP_001271546.1.51841 WP_001271546.1.5185 WP_001271546.1.51863 WP_001271546.1.51868 WP_001271546.1.51888 WP_001271546.1.51910 WP_001271546.1.51911 WP_001271546.1.51914 WP_001271546.1.51930 WP_001271546.1.51932 WP_001271546.1.51935 WP_001271546.1.51989 WP_001271546.1.51994 WP_001271546.1.520 WP_001271546.1.52047 WP_001271546.1.52052 WP_001271546.1.52057 WP_001271546.1.52101 WP_001271546.1.5211 WP_001271546.1.52114 WP_001271546.1.52121 WP_001271546.1.52123 WP_001271546.1.52129 WP_001271546.1.52148 WP_001271546.1.52156 WP_001271546.1.5216 WP_001271546.1.52161 WP_001271546.1.52170 WP_001271546.1.52191 WP_001271546.1.52202 WP_001271546.1.52209 WP_001271546.1.52255 WP_001271546.1.52301 WP_001271546.1.52321 WP_001271546.1.52336 WP_001271546.1.52339 WP_001271546.1.52346 WP_001271546.1.52353 WP_001271546.1.52356 WP_001271546.1.52361 WP_001271546.1.52438 WP_001271546.1.52446 WP_001271546.1.52456 WP_001271546.1.52469 WP_001271546.1.52527 WP_001271546.1.52528 WP_001271546.1.52571 WP_001271546.1.52582 WP_001271546.1.52586 WP_001271546.1.526 WP_001271546.1.52608 WP_001271546.1.52637 WP_001271546.1.52647 WP_001271546.1.52653 WP_001271546.1.52656 WP_001271546.1.52675 WP_001271546.1.52692 WP_001271546.1.5273 WP_001271546.1.52738 WP_001271546.1.52742 WP_001271546.1.52743 WP_001271546.1.52744 WP_001271546.1.52748 WP_001271546.1.52773 WP_001271546.1.52795 WP_001271546.1.52807 WP_001271546.1.52824 WP_001271546.1.52833 WP_001271546.1.52851 WP_001271546.1.52857 WP_001271546.1.52858 WP_001271546.1.52866 WP_001271546.1.52887 WP_001271546.1.52898 WP_001271546.1.52915 WP_001271546.1.52924 WP_001271546.1.52949 WP_001271546.1.52985 WP_001271546.1.5301 WP_001271546.1.53016 WP_001271546.1.53092 WP_001271546.1.53100 WP_001271546.1.53107 WP_001271546.1.53119 WP_001271546.1.5313 WP_001271546.1.53141 WP_001271546.1.53151 WP_001271546.1.53154 WP_001271546.1.53158 WP_001271546.1.53159 WP_001271546.1.5316 WP_001271546.1.53179 WP_001271546.1.53190 WP_001271546.1.53198 WP_001271546.1.53203 WP_001271546.1.53206 WP_001271546.1.53210 WP_001271546.1.53233 WP_001271546.1.53234 WP_001271546.1.53272 WP_001271546.1.53274 WP_001271546.1.53286 WP_001271546.1.53307 WP_001271546.1.53315 WP_001271546.1.53316 WP_001271546.1.53321 WP_001271546.1.53328 WP_001271546.1.53362 WP_001271546.1.53368 WP_001271546.1.53375 WP_001271546.1.53385 WP_001271546.1.53406 WP_001271546.1.53436 WP_001271546.1.53450 WP_001271546.1.53454 WP_001271546.1.53466 WP_001271546.1.5349 WP_001271546.1.53529 WP_001271546.1.53534 WP_001271546.1.53540 WP_001271546.1.53543 WP_001271546.1.53555 WP_001271546.1.53559 WP_001271546.1.5356 WP_001271546.1.53567 WP_001271546.1.53571 WP_001271546.1.5358 WP_001271546.1.53664 WP_001271546.1.53675 WP_001271546.1.53688 WP_001271546.1.53692 WP_001271546.1.53694 WP_001271546.1.53696 WP_001271546.1.53723 WP_001271546.1.5374 WP_001271546.1.53750 WP_001271546.1.53757 WP_001271546.1.53772 WP_001271546.1.53778 WP_001271546.1.53781 WP_001271546.1.53790 WP_001271546.1.53800 WP_001271546.1.53812 WP_001271546.1.53814 WP_001271546.1.53815 WP_001271546.1.53839 WP_001271546.1.53892 WP_001271546.1.53896 WP_001271546.1.53898 WP_001271546.1.53902 WP_001271546.1.53905 WP_001271546.1.5392 WP_001271546.1.53935 WP_001271546.1.53958 WP_001271546.1.53961 WP_001271546.1.53981 WP_001271546.1.53984 WP_001271546.1.54033 WP_001271546.1.54061 WP_001271546.1.54068 WP_001271546.1.54075 WP_001271546.1.54082 WP_001271546.1.54085 WP_001271546.1.54132 WP_001271546.1.54136 WP_001271546.1.5415 WP_001271546.1.54159 WP_001271546.1.54170 WP_001271546.1.54175 WP_001271546.1.54196 WP_001271546.1.542 WP_001271546.1.54203 WP_001271546.1.54209 WP_001271546.1.54259 WP_001271546.1.54271 WP_001271546.1.54273 WP_001271546.1.54274 WP_001271546.1.54283 WP_001271546.1.5430 WP_001271546.1.54319 WP_001271546.1.54324 WP_001271546.1.54333 WP_001271546.1.54340 WP_001271546.1.54364 WP_001271546.1.54366 WP_001271546.1.54371 WP_001271546.1.54400 WP_001271546.1.54431 WP_001271546.1.54442 WP_001271546.1.54469 WP_001271546.1.54482 WP_001271546.1.54500 WP_001271546.1.54522 WP_001271546.1.54526 WP_001271546.1.54558 WP_001271546.1.5456 WP_001271546.1.54569 WP_001271546.1.54589 WP_001271546.1.5459 WP_001271546.1.54607 WP_001271546.1.54615 WP_001271546.1.5462 WP_001271546.1.54644 WP_001271546.1.54662 WP_001271546.1.54667 WP_001271546.1.54678 WP_001271546.1.54681 WP_001271546.1.54694 WP_001271546.1.54722 WP_001271546.1.54748 WP_001271546.1.54749 WP_001271546.1.54764 WP_001271546.1.54774 WP_001271546.1.5481 WP_001271546.1.54814 WP_001271546.1.54822 WP_001271546.1.54827 WP_001271546.1.54833 WP_001271546.1.54845 WP_001271546.1.5485 WP_001271546.1.54865 WP_001271546.1.54877 WP_001271546.1.5493 WP_001271546.1.54935 WP_001271546.1.54936 WP_001271546.1.54979 WP_001271546.1.54984 WP_001271546.1.54992 WP_001271546.1.55008 WP_001271546.1.55010 WP_001271546.1.55034 WP_001271546.1.55073 WP_001271546.1.55152 WP_001271546.1.55156 WP_001271546.1.55163 WP_001271546.1.55165 WP_001271546.1.55166 WP_001271546.1.5517 WP_001271546.1.55178 WP_001271546.1.55200 WP_001271546.1.55215 WP_001271546.1.55223 WP_001271546.1.55224 WP_001271546.1.5523 WP_001271546.1.5525 WP_001271546.1.5527 WP_001271546.1.55285 WP_001271546.1.55290 WP_001271546.1.55294 WP_001271546.1.55310 WP_001271546.1.55317 WP_001271546.1.55325 WP_001271546.1.55361 WP_001271546.1.55379 WP_001271546.1.5539 WP_001271546.1.55430 WP_001271546.1.55461 WP_001271546.1.55468 WP_001271546.1.55475 WP_001271546.1.55477 WP_001271546.1.55496 WP_001271546.1.55506 WP_001271546.1.5552 WP_001271546.1.55528 WP_001271546.1.55545 WP_001271546.1.5555 WP_001271546.1.55554 WP_001271546.1.55557 WP_001271546.1.55559 WP_001271546.1.5560 WP_001271546.1.55604 WP_001271546.1.55614 WP_001271546.1.55623 WP_001271546.1.55639 WP_001271546.1.55640 WP_001271546.1.55647 WP_001271546.1.55672 WP_001271546.1.55680 WP_001271546.1.55699 WP_001271546.1.55706 WP_001271546.1.55718 WP_001271546.1.5572 WP_001271546.1.55725 WP_001271546.1.55743 WP_001271546.1.55768 WP_001271546.1.5577 WP_001271546.1.55780 WP_001271546.1.55782 WP_001271546.1.55796 WP_001271546.1.55803 WP_001271546.1.55853 WP_001271546.1.55923 WP_001271546.1.55948 WP_001271546.1.55967 WP_001271546.1.55973 WP_001271546.1.55993 WP_001271546.1.55995 WP_001271546.1.56002 WP_001271546.1.56004 WP_001271546.1.56012 WP_001271546.1.56026 WP_001271546.1.56059 WP_001271546.1.56069 WP_001271546.1.56070 WP_001271546.1.56082 WP_001271546.1.56097 WP_001271546.1.56100 WP_001271546.1.56105 WP_001271546.1.56130 WP_001271546.1.56144 WP_001271546.1.56152 WP_001271546.1.56172 WP_001271546.1.5621 WP_001271546.1.56222 WP_001271546.1.56226 WP_001271546.1.56235 WP_001271546.1.56238 WP_001271546.1.56244 WP_001271546.1.56247 WP_001271546.1.56261 WP_001271546.1.56263 WP_001271546.1.56286 WP_001271546.1.56303 WP_001271546.1.56304 WP_001271546.1.56305 WP_001271546.1.56311 WP_001271546.1.5633 WP_001271546.1.56354 WP_001271546.1.56368 WP_001271546.1.56370 WP_001271546.1.56374 WP_001271546.1.56385 WP_001271546.1.56389 WP_001271546.1.56393 WP_001271546.1.56396 WP_001271546.1.56413 WP_001271546.1.56414 WP_001271546.1.56419 WP_001271546.1.56420 WP_001271546.1.56423 WP_001271546.1.56438 WP_001271546.1.56468 WP_001271546.1.56512 WP_001271546.1.56514 WP_001271546.1.56535 WP_001271546.1.56559 WP_001271546.1.56560 WP_001271546.1.56585 WP_001271546.1.56597 WP_001271546.1.56601 WP_001271546.1.56614 WP_001271546.1.56615 WP_001271546.1.56640 WP_001271546.1.56642 WP_001271546.1.56647 WP_001271546.1.56651 WP_001271546.1.56660 WP_001271546.1.56671 WP_001271546.1.5668 WP_001271546.1.56682 WP_001271546.1.56724 WP_001271546.1.56791 WP_001271546.1.56824 WP_001271546.1.56825 WP_001271546.1.56851 WP_001271546.1.56853 WP_001271546.1.56861 WP_001271546.1.56875 WP_001271546.1.56877 WP_001271546.1.56887 WP_001271546.1.56889 WP_001271546.1.56893 WP_001271546.1.56898 WP_001271546.1.56905 WP_001271546.1.56942 WP_001271546.1.56950 WP_001271546.1.56981 WP_001271546.1.57000 WP_001271546.1.57026 WP_001271546.1.57039 WP_001271546.1.57056 WP_001271546.1.57076 WP_001271546.1.57084 WP_001271546.1.57101 WP_001271546.1.5711 WP_001271546.1.57125 WP_001271546.1.57137 WP_001271546.1.57143 WP_001271546.1.57147 WP_001271546.1.57149 WP_001271546.1.57168 WP_001271546.1.57179 WP_001271546.1.57186 WP_001271546.1.57187 WP_001271546.1.57232 WP_001271546.1.57233 WP_001271546.1.57244 WP_001271546.1.57246 WP_001271546.1.57296 WP_001271546.1.57307 WP_001271546.1.57342 WP_001271546.1.57344 WP_001271546.1.57356 WP_001271546.1.57357 WP_001271546.1.57362 WP_001271546.1.57377 WP_001271546.1.57399 WP_001271546.1.57418 WP_001271546.1.57433 WP_001271546.1.57494 WP_001271546.1.57495 WP_001271546.1.57510 WP_001271546.1.57515 WP_001271546.1.57521 WP_001271546.1.57529 WP_001271546.1.5753 WP_001271546.1.57534 WP_001271546.1.57555 WP_001271546.1.57559 WP_001271546.1.57576 WP_001271546.1.57601 WP_001271546.1.57607 WP_001271546.1.5761 WP_001271546.1.57631 WP_001271546.1.57641 WP_001271546.1.57684 WP_001271546.1.57699 WP_001271546.1.57709 WP_001271546.1.57710 WP_001271546.1.57735 WP_001271546.1.5774 WP_001271546.1.57763 WP_001271546.1.57778 WP_001271546.1.57781 WP_001271546.1.57785 WP_001271546.1.57797 WP_001271546.1.57800 WP_001271546.1.5781 WP_001271546.1.57835 WP_001271546.1.57857 WP_001271546.1.57862 WP_001271546.1.57873 WP_001271546.1.57890 WP_001271546.1.57891 WP_001271546.1.57893 WP_001271546.1.57902 WP_001271546.1.57965 WP_001271546.1.57972 WP_001271546.1.57978 WP_001271546.1.58008 WP_001271546.1.5801 WP_001271546.1.58040 WP_001271546.1.58041 WP_001271546.1.58044 WP_001271546.1.58081 WP_001271546.1.5809 WP_001271546.1.58090 WP_001271546.1.58131 WP_001271546.1.58132 WP_001271546.1.58144 WP_001271546.1.58153 WP_001271546.1.58157 WP_001271546.1.58173 WP_001271546.1.58191 WP_001271546.1.58194 WP_001271546.1.58239 WP_001271546.1.58249 WP_001271546.1.58251 WP_001271546.1.58252 WP_001271546.1.58261 WP_001271546.1.58274 WP_001271546.1.5828 WP_001271546.1.58282 WP_001271546.1.58290 WP_001271546.1.58301 WP_001271546.1.58324 WP_001271546.1.58326 WP_001271546.1.58334 WP_001271546.1.58357 WP_001271546.1.58358 WP_001271546.1.5836 WP_001271546.1.58372 WP_001271546.1.58407 WP_001271546.1.58416 WP_001271546.1.58418 WP_001271546.1.58442 WP_001271546.1.58443 WP_001271546.1.58451 WP_001271546.1.5846 WP_001271546.1.58467 WP_001271546.1.58485 WP_001271546.1.58486 WP_001271546.1.58489 WP_001271546.1.58537 WP_001271546.1.5854 WP_001271546.1.58548 WP_001271546.1.58564 WP_001271546.1.58568 WP_001271546.1.5858 WP_001271546.1.58583 WP_001271546.1.58604 WP_001271546.1.58633 WP_001271546.1.58652 WP_001271546.1.58662 WP_001271546.1.58663 WP_001271546.1.58669 WP_001271546.1.58675 WP_001271546.1.58698 WP_001271546.1.587 WP_001271546.1.58724 WP_001271546.1.58729 WP_001271546.1.58744 WP_001271546.1.58745 WP_001271546.1.58749 WP_001271546.1.5875 WP_001271546.1.5878 WP_001271546.1.58796 WP_001271546.1.58803 WP_001271546.1.58807 WP_001271546.1.58831 WP_001271546.1.58834 WP_001271546.1.58836 WP_001271546.1.58847 WP_001271546.1.5886 WP_001271546.1.58861 WP_001271546.1.58883 WP_001271546.1.58884 WP_001271546.1.58898 WP_001271546.1.58926 WP_001271546.1.58932 WP_001271546.1.58949 WP_001271546.1.58963 WP_001271546.1.58970 WP_001271546.1.58974 WP_001271546.1.59006 WP_001271546.1.59012 WP_001271546.1.59020 WP_001271546.1.59043 WP_001271546.1.59056 WP_001271546.1.59061 WP_001271546.1.59064 WP_001271546.1.59068 WP_001271546.1.5907 WP_001271546.1.59084 WP_001271546.1.59094 WP_001271546.1.59097 WP_001271546.1.59125 WP_001271546.1.59136 WP_001271546.1.59142 WP_001271546.1.59148 WP_001271546.1.59163 WP_001271546.1.59204 WP_001271546.1.59224 WP_001271546.1.59236 WP_001271546.1.59276 WP_001271546.1.59282 WP_001271546.1.5929 WP_001271546.1.59294 WP_001271546.1.59295 WP_001271546.1.59299 WP_001271546.1.59313 WP_001271546.1.59335 WP_001271546.1.59336 WP_001271546.1.59375 WP_001271546.1.59381 WP_001271546.1.59412 WP_001271546.1.59420 WP_001271546.1.59427 WP_001271546.1.59439 WP_001271546.1.59458 WP_001271546.1.59486 WP_001271546.1.5949 WP_001271546.1.59490 WP_001271546.1.59501 WP_001271546.1.59508 WP_001271546.1.59510 WP_001271546.1.59512 WP_001271546.1.59521 WP_001271546.1.5953 WP_001271546.1.59538 WP_001271546.1.59548 WP_001271546.1.59562 WP_001271546.1.59587 WP_001271546.1.59604 WP_001271546.1.59636 WP_001271546.1.59641 WP_001271546.1.59646 WP_001271546.1.59648 WP_001271546.1.59684 WP_001271546.1.5969 WP_001271546.1.59694 WP_001271546.1.59709 WP_001271546.1.59710 WP_001271546.1.59751 WP_001271546.1.59755 WP_001271546.1.59771 WP_001271546.1.5979 WP_001271546.1.59827 WP_001271546.1.59829 WP_001271546.1.59830 WP_001271546.1.59847 WP_001271546.1.59848 WP_001271546.1.59863 WP_001271546.1.59928 WP_001271546.1.5993 WP_001271546.1.59953 WP_001271546.1.59969 WP_001271546.1.59979 WP_001271546.1.59994 WP_001271546.1.60004 WP_001271546.1.60008 WP_001271546.1.60015 WP_001271546.1.60021 WP_001271546.1.60045 WP_001271546.1.60052 WP_001271546.1.60069 WP_001271546.1.60076 WP_001271546.1.60106 WP_001271546.1.60114 WP_001271546.1.60126 WP_001271546.1.60137 WP_001271546.1.60140 WP_001271546.1.60154 WP_001271546.1.60155 WP_001271546.1.60168 WP_001271546.1.60192 WP_001271546.1.60199 WP_001271546.1.60209 WP_001271546.1.60212 WP_001271546.1.60213 WP_001271546.1.60226 WP_001271546.1.60231 WP_001271546.1.60253 WP_001271546.1.60285 WP_001271546.1.60320 WP_001271546.1.60322 WP_001271546.1.60324 WP_001271546.1.6033 WP_001271546.1.60330 WP_001271546.1.60356 WP_001271546.1.60370 WP_001271546.1.60379 WP_001271546.1.6038 WP_001271546.1.60380 WP_001271546.1.6041 WP_001271546.1.60424 WP_001271546.1.60425 WP_001271546.1.60464 WP_001271546.1.60469 WP_001271546.1.60481 WP_001271546.1.60486 WP_001271546.1.605 WP_001271546.1.60503 WP_001271546.1.60507 WP_001271546.1.6052 WP_001271546.1.60545 WP_001271546.1.60560 WP_001271546.1.60561 WP_001271546.1.6058 WP_001271546.1.60584 WP_001271546.1.60597 WP_001271546.1.6060 WP_001271546.1.60608 WP_001271546.1.60622 WP_001271546.1.60643 WP_001271546.1.60661 WP_001271546.1.60676 WP_001271546.1.60708 WP_001271546.1.60713 WP_001271546.1.60725 WP_001271546.1.60746 WP_001271546.1.60760 WP_001271546.1.60772 WP_001271546.1.60783 WP_001271546.1.60792 WP_001271546.1.60794 WP_001271546.1.608 WP_001271546.1.60807 WP_001271546.1.60809 WP_001271546.1.60838 WP_001271546.1.60851 WP_001271546.1.60855 WP_001271546.1.60857 WP_001271546.1.6086 WP_001271546.1.60863 WP_001271546.1.60866 WP_001271546.1.60874 WP_001271546.1.60882 WP_001271546.1.60889 WP_001271546.1.60897 WP_001271546.1.6090 WP_001271546.1.60919 WP_001271546.1.60926 WP_001271546.1.60941 WP_001271546.1.60950 WP_001271546.1.60976 WP_001271546.1.60988 WP_001271546.1.60990 WP_001271546.1.6104 WP_001271546.1.61044 WP_001271546.1.61045 WP_001271546.1.61076 WP_001271546.1.61078 WP_001271546.1.6108 WP_001271546.1.61087 WP_001271546.1.61123 WP_001271546.1.6114 WP_001271546.1.61146 WP_001271546.1.61147 WP_001271546.1.61168 WP_001271546.1.61184 WP_001271546.1.61200 WP_001271546.1.61201 WP_001271546.1.61210 WP_001271546.1.61218 WP_001271546.1.61232 WP_001271546.1.61233 WP_001271546.1.6129 WP_001271546.1.61296 WP_001271546.1.61309 WP_001271546.1.61345 WP_001271546.1.61356 WP_001271546.1.61357 WP_001271546.1.61381 WP_001271546.1.61417 WP_001271546.1.6143 WP_001271546.1.61434 WP_001271546.1.61497 WP_001271546.1.61501 WP_001271546.1.61509 WP_001271546.1.61511 WP_001271546.1.61519 WP_001271546.1.61539 WP_001271546.1.61542 WP_001271546.1.61553 WP_001271546.1.61574 WP_001271546.1.61582 WP_001271546.1.61594 WP_001271546.1.61595 WP_001271546.1.61609 WP_001271546.1.6164 WP_001271546.1.61649 WP_001271546.1.61652 WP_001271546.1.61662 WP_001271546.1.61667 WP_001271546.1.61671 WP_001271546.1.61694 WP_001271546.1.61697 WP_001271546.1.61712 WP_001271546.1.61714 WP_001271546.1.61730 WP_001271546.1.61732 WP_001271546.1.61737 WP_001271546.1.61743 WP_001271546.1.61783 WP_001271546.1.61809 WP_001271546.1.61857 WP_001271546.1.61877 WP_001271546.1.6190 WP_001271546.1.61908 WP_001271546.1.61918 WP_001271546.1.61920 WP_001271546.1.61924 WP_001271546.1.61952 WP_001271546.1.61968 WP_001271546.1.62007 WP_001271546.1.62020 WP_001271546.1.62025 WP_001271546.1.62063 WP_001271546.1.62076 WP_001271546.1.6209 WP_001271546.1.6210 WP_001271546.1.62108 WP_001271546.1.62120 WP_001271546.1.62122 WP_001271546.1.62124 WP_001271546.1.62142 WP_001271546.1.62144 WP_001271546.1.62158 WP_001271546.1.62184 WP_001271546.1.62195 WP_001271546.1.62199 WP_001271546.1.62201 WP_001271546.1.62204 WP_001271546.1.62210 WP_001271546.1.62219 WP_001271546.1.62222 WP_001271546.1.62223 WP_001271546.1.62241 WP_001271546.1.62245 WP_001271546.1.62257 WP_001271546.1.62271 WP_001271546.1.62302 WP_001271546.1.62304 WP_001271546.1.62310 WP_001271546.1.62314 WP_001271546.1.62323 WP_001271546.1.62333 WP_001271546.1.62338 WP_001271546.1.62339 WP_001271546.1.62344 WP_001271546.1.62361 WP_001271546.1.62364 WP_001271546.1.62374 WP_001271546.1.62380 WP_001271546.1.62403 WP_001271546.1.62404 WP_001271546.1.62411 WP_001271546.1.62412 WP_001271546.1.62436 WP_001271546.1.62442 WP_001271546.1.62475 WP_001271546.1.62486 WP_001271546.1.62488 WP_001271546.1.62504 WP_001271546.1.62522 WP_001271546.1.6253 WP_001271546.1.62536 WP_001271546.1.62564 WP_001271546.1.62570 WP_001271546.1.62619 WP_001271546.1.62640 WP_001271546.1.62648 WP_001271546.1.62677 WP_001271546.1.62686 WP_001271546.1.62693 WP_001271546.1.627 WP_001271546.1.62725 WP_001271546.1.62745 WP_001271546.1.62751 WP_001271546.1.62757 WP_001271546.1.62798 WP_001271546.1.62825 WP_001271546.1.62828 WP_001271546.1.62853 WP_001271546.1.62903 WP_001271546.1.62910 WP_001271546.1.62913 WP_001271546.1.6292 WP_001271546.1.62932 WP_001271546.1.62955 WP_001271546.1.62960 WP_001271546.1.62976 WP_001271546.1.62983 WP_001271546.1.62988 WP_001271546.1.63016 WP_001271546.1.63025 WP_001271546.1.63043 WP_001271546.1.63045 WP_001271546.1.63063 WP_001271546.1.63069 WP_001271546.1.63087 WP_001271546.1.63102 WP_001271546.1.63118 WP_001271546.1.63129 WP_001271546.1.63135 WP_001271546.1.63169 WP_001271546.1.63181 WP_001271546.1.63186 WP_001271546.1.63203 WP_001271546.1.63229 WP_001271546.1.63234 WP_001271546.1.63243 WP_001271546.1.63250 WP_001271546.1.63256 WP_001271546.1.63290 WP_001271546.1.63297 WP_001271546.1.63358 WP_001271546.1.63382 WP_001271546.1.63422 WP_001271546.1.63432 WP_001271546.1.63448 WP_001271546.1.63455 WP_001271546.1.63461 WP_001271546.1.63479 WP_001271546.1.63497 WP_001271546.1.63499 WP_001271546.1.63509 WP_001271546.1.63513 WP_001271546.1.63514 WP_001271546.1.63525 WP_001271546.1.63529 WP_001271546.1.63532 WP_001271546.1.63568 WP_001271546.1.6357 WP_001271546.1.63577 WP_001271546.1.63583 WP_001271546.1.63585 WP_001271546.1.63592 WP_001271546.1.63603 WP_001271546.1.63633 WP_001271546.1.63663 WP_001271546.1.63664 WP_001271546.1.6367 WP_001271546.1.63677 WP_001271546.1.63690 WP_001271546.1.63718 WP_001271546.1.63731 WP_001271546.1.63736 WP_001271546.1.63748 WP_001271546.1.6375 WP_001271546.1.63757 WP_001271546.1.63766 WP_001271546.1.63781 WP_001271546.1.63782 WP_001271546.1.63797 WP_001271546.1.63816 WP_001271546.1.63824 WP_001271546.1.63831 WP_001271546.1.63834 WP_001271546.1.63851 WP_001271546.1.63860 WP_001271546.1.63863 WP_001271546.1.63864 WP_001271546.1.63866 WP_001271546.1.63876 WP_001271546.1.6389 WP_001271546.1.63901 WP_001271546.1.63903 WP_001271546.1.63912 WP_001271546.1.63934 WP_001271546.1.63955 WP_001271546.1.63958 WP_001271546.1.63963 WP_001271546.1.63977 WP_001271546.1.6399 WP_001271546.1.63992 WP_001271546.1.64007 WP_001271546.1.64010 WP_001271546.1.64018 WP_001271546.1.64032 WP_001271546.1.64034 WP_001271546.1.64036 WP_001271546.1.64046 WP_001271546.1.64072 WP_001271546.1.64085 WP_001271546.1.64087 WP_001271546.1.64109 WP_001271546.1.64121 WP_001271546.1.6415 WP_001271546.1.64157 WP_001271546.1.64208 WP_001271546.1.64217 WP_001271546.1.64229 WP_001271546.1.6423 WP_001271546.1.64242 WP_001271546.1.64244 WP_001271546.1.64266 WP_001271546.1.64293 WP_001271546.1.64294 WP_001271546.1.64332 WP_001271546.1.64350 WP_001271546.1.6437 WP_001271546.1.64374 WP_001271546.1.64376 WP_001271546.1.64385 WP_001271546.1.64387 WP_001271546.1.64389 WP_001271546.1.644 WP_001271546.1.64403 WP_001271546.1.64412 WP_001271546.1.64462 WP_001271546.1.64471 WP_001271546.1.64500 WP_001271546.1.64501 WP_001271546.1.6451 WP_001271546.1.64538 WP_001271546.1.64569 WP_001271546.1.64597 WP_001271546.1.64632 WP_001271546.1.64645 WP_001271546.1.64648 WP_001271546.1.64649 WP_001271546.1.64654 WP_001271546.1.64662 WP_001271546.1.64663 WP_001271546.1.64667 WP_001271546.1.64690 WP_001271546.1.64702 WP_001271546.1.64709 WP_001271546.1.64710 WP_001271546.1.64711 WP_001271546.1.64715 WP_001271546.1.64744 WP_001271546.1.64757 WP_001271546.1.64758 WP_001271546.1.64763 WP_001271546.1.64771 WP_001271546.1.64781 WP_001271546.1.64798 WP_001271546.1.64817 WP_001271546.1.64831 WP_001271546.1.64847 WP_001271546.1.6487 WP_001271546.1.6489 WP_001271546.1.64891 WP_001271546.1.64894 WP_001271546.1.64919 WP_001271546.1.64920 WP_001271546.1.64944 WP_001271546.1.64972 WP_001271546.1.64974 WP_001271546.1.64977 WP_001271546.1.65011 WP_001271546.1.65016 WP_001271546.1.65018 WP_001271546.1.65022 WP_001271546.1.65027 WP_001271546.1.65028 WP_001271546.1.65052 WP_001271546.1.65054 WP_001271546.1.65075 WP_001271546.1.6514 WP_001271546.1.65163 WP_001271546.1.65168 WP_001271546.1.65171 WP_001271546.1.65172 WP_001271546.1.65185 WP_001271546.1.65191 WP_001271546.1.65200 WP_001271546.1.65211 WP_001271546.1.65218 WP_001271546.1.65226 WP_001271546.1.65238 WP_001271546.1.65248 WP_001271546.1.65249 WP_001271546.1.6525 WP_001271546.1.65266 WP_001271546.1.65269 WP_001271546.1.65295 WP_001271546.1.65308 WP_001271546.1.65348 WP_001271546.1.6535 WP_001271546.1.65357 WP_001271546.1.65363 WP_001271546.1.65394 WP_001271546.1.65395 WP_001271546.1.65437 WP_001271546.1.65459 WP_001271546.1.65463 WP_001271546.1.65474 WP_001271546.1.65475 WP_001271546.1.65487 WP_001271546.1.6549 WP_001271546.1.65499 WP_001271546.1.6550 WP_001271546.1.65508 WP_001271546.1.65538 WP_001271546.1.6554 WP_001271546.1.65558 WP_001271546.1.65572 WP_001271546.1.6558 WP_001271546.1.6560 WP_001271546.1.65601 WP_001271546.1.6561 WP_001271546.1.65633 WP_001271546.1.6565 WP_001271546.1.65650 WP_001271546.1.65687 WP_001271546.1.65696 WP_001271546.1.65697 WP_001271546.1.65698 WP_001271546.1.65699 WP_001271546.1.6572 WP_001271546.1.65737 WP_001271546.1.6575 WP_001271546.1.65755 WP_001271546.1.65771 WP_001271546.1.65782 WP_001271546.1.65790 WP_001271546.1.65795 WP_001271546.1.65812 WP_001271546.1.65818 WP_001271546.1.65838 WP_001271546.1.65846 WP_001271546.1.65849 WP_001271546.1.65863 WP_001271546.1.65876 WP_001271546.1.65881 WP_001271546.1.65883 WP_001271546.1.65901 WP_001271546.1.6594 WP_001271546.1.65940 WP_001271546.1.65945 WP_001271546.1.6595 WP_001271546.1.65956 WP_001271546.1.65968 WP_001271546.1.65985 WP_001271546.1.66021 WP_001271546.1.66031 WP_001271546.1.66049 WP_001271546.1.66052 WP_001271546.1.66064 WP_001271546.1.66074 WP_001271546.1.66082 WP_001271546.1.66085 WP_001271546.1.66109 WP_001271546.1.66122 WP_001271546.1.66129 WP_001271546.1.66145 WP_001271546.1.66167 WP_001271546.1.66171 WP_001271546.1.66183 WP_001271546.1.6620 WP_001271546.1.66216 WP_001271546.1.66234 WP_001271546.1.66235 WP_001271546.1.66250 WP_001271546.1.66270 WP_001271546.1.66272 WP_001271546.1.66273 WP_001271546.1.66289 WP_001271546.1.6630 WP_001271546.1.66314 WP_001271546.1.66315 WP_001271546.1.66324 WP_001271546.1.66330 WP_001271546.1.6634 WP_001271546.1.66358 WP_001271546.1.66361 WP_001271546.1.66362 WP_001271546.1.66365 WP_001271546.1.66368 WP_001271546.1.6638 WP_001271546.1.66385 WP_001271546.1.6640 WP_001271546.1.66400 WP_001271546.1.66428 WP_001271546.1.66446 WP_001271546.1.66462 WP_001271546.1.6647 WP_001271546.1.66480 WP_001271546.1.66492 WP_001271546.1.66506 WP_001271546.1.66534 WP_001271546.1.66539 WP_001271546.1.66600 WP_001271546.1.66630 WP_001271546.1.66665 WP_001271546.1.66678 WP_001271546.1.66681 WP_001271546.1.66684 WP_001271546.1.66698 WP_001271546.1.66702 WP_001271546.1.66733 WP_001271546.1.66755 WP_001271546.1.66759 WP_001271546.1.66779 WP_001271546.1.6680 WP_001271546.1.66800 WP_001271546.1.66801 WP_001271546.1.66807 WP_001271546.1.66820 WP_001271546.1.66824 WP_001271546.1.66825 WP_001271546.1.66834 WP_001271546.1.66860 WP_001271546.1.66876 WP_001271546.1.66901 WP_001271546.1.6692 WP_001271546.1.66937 WP_001271546.1.66953 WP_001271546.1.66955 WP_001271546.1.66959 WP_001271546.1.66962 WP_001271546.1.66981 WP_001271546.1.67 WP_001271546.1.67024 WP_001271546.1.67037 WP_001271546.1.67042 WP_001271546.1.67045 WP_001271546.1.67075 WP_001271546.1.6710 WP_001271546.1.67100 WP_001271546.1.67101 WP_001271546.1.67143 WP_001271546.1.67173 WP_001271546.1.67175 WP_001271546.1.67181 WP_001271546.1.67184 WP_001271546.1.67201 WP_001271546.1.67211 WP_001271546.1.67228 WP_001271546.1.67235 WP_001271546.1.67237 WP_001271546.1.67268 WP_001271546.1.67279 WP_001271546.1.67288 WP_001271546.1.67336 WP_001271546.1.67339 WP_001271546.1.67347 WP_001271546.1.67374 WP_001271546.1.67387 WP_001271546.1.6739 WP_001271546.1.67394 WP_001271546.1.67397 WP_001271546.1.67403 WP_001271546.1.67405 WP_001271546.1.67424 WP_001271546.1.67430 WP_001271546.1.67442 WP_001271546.1.67465 WP_001271546.1.67539 WP_001271546.1.67552 WP_001271546.1.67556 WP_001271546.1.67576 WP_001271546.1.6760 WP_001271546.1.67603 WP_001271546.1.67604 WP_001271546.1.67617 WP_001271546.1.67619 WP_001271546.1.67625 WP_001271546.1.67627 WP_001271546.1.67633 WP_001271546.1.67641 WP_001271546.1.67657 WP_001271546.1.67673 WP_001271546.1.67682 WP_001271546.1.67700 WP_001271546.1.67707 WP_001271546.1.67718 WP_001271546.1.67729 WP_001271546.1.67731 WP_001271546.1.67772 WP_001271546.1.67774 WP_001271546.1.67776 WP_001271546.1.67803 WP_001271546.1.67814 WP_001271546.1.6782 WP_001271546.1.67820 WP_001271546.1.67825 WP_001271546.1.67827 WP_001271546.1.67829 WP_001271546.1.6785 WP_001271546.1.67887 WP_001271546.1.67905 WP_001271546.1.67910 WP_001271546.1.67924 WP_001271546.1.67932 WP_001271546.1.67942 WP_001271546.1.67954 WP_001271546.1.67969 WP_001271546.1.67970 WP_001271546.1.67977 WP_001271546.1.67988 WP_001271546.1.68 WP_001271546.1.68036 WP_001271546.1.68043 WP_001271546.1.68073 WP_001271546.1.68075 WP_001271546.1.6809 WP_001271546.1.68105 WP_001271546.1.68113 WP_001271546.1.68115 WP_001271546.1.68131 WP_001271546.1.68140 WP_001271546.1.68147 WP_001271546.1.68159 WP_001271546.1.68167 WP_001271546.1.68182 WP_001271546.1.6819 WP_001271546.1.68201 WP_001271546.1.68206 WP_001271546.1.68210 WP_001271546.1.6827 WP_001271546.1.68275 WP_001271546.1.68285 WP_001271546.1.6833 WP_001271546.1.68359 WP_001271546.1.68401 WP_001271546.1.68420 WP_001271546.1.68477 WP_001271546.1.68478 WP_001271546.1.6849 WP_001271546.1.685 WP_001271546.1.68514 WP_001271546.1.68532 WP_001271546.1.68547 WP_001271546.1.68564 WP_001271546.1.6857 WP_001271546.1.6858 WP_001271546.1.68589 WP_001271546.1.68591 WP_001271546.1.68629 WP_001271546.1.68652 WP_001271546.1.68655 WP_001271546.1.68656 WP_001271546.1.68658 WP_001271546.1.68677 WP_001271546.1.68688 WP_001271546.1.6869 WP_001271546.1.68690 WP_001271546.1.68742 WP_001271546.1.6875 WP_001271546.1.68770 WP_001271546.1.68778 WP_001271546.1.68787 WP_001271546.1.6879 WP_001271546.1.68809 WP_001271546.1.68816 WP_001271546.1.68818 WP_001271546.1.6882 WP_001271546.1.6883 WP_001271546.1.68893 WP_001271546.1.68894 WP_001271546.1.68895 WP_001271546.1.68914 WP_001271546.1.68928 WP_001271546.1.68958 WP_001271546.1.68966 WP_001271546.1.68975 WP_001271546.1.68999 WP_001271546.1.69001 WP_001271546.1.69006 WP_001271546.1.69011 WP_001271546.1.69029 WP_001271546.1.6904 WP_001271546.1.6905 WP_001271546.1.69053 WP_001271546.1.69058 WP_001271546.1.6907 WP_001271546.1.69080 WP_001271546.1.6913 WP_001271546.1.69131 WP_001271546.1.69139 WP_001271546.1.69146 WP_001271546.1.69151 WP_001271546.1.69170 WP_001271546.1.69210 WP_001271546.1.69236 WP_001271546.1.69255 WP_001271546.1.69270 WP_001271546.1.69273 WP_001271546.1.69282 WP_001271546.1.69288 WP_001271546.1.69296 WP_001271546.1.69320 WP_001271546.1.69346 WP_001271546.1.69357 WP_001271546.1.69359 WP_001271546.1.69371 WP_001271546.1.69376 WP_001271546.1.69385 WP_001271546.1.69396 WP_001271546.1.69397 WP_001271546.1.69433 WP_001271546.1.69465 WP_001271546.1.69466 WP_001271546.1.69485 WP_001271546.1.69515 WP_001271546.1.6954 WP_001271546.1.69554 WP_001271546.1.69564 WP_001271546.1.69575 WP_001271546.1.69588 WP_001271546.1.69597 WP_001271546.1.69611 WP_001271546.1.69616 WP_001271546.1.69636 WP_001271546.1.69642 WP_001271546.1.69644 WP_001271546.1.69656 WP_001271546.1.69657 WP_001271546.1.69690 WP_001271546.1.69696 WP_001271546.1.69704 WP_001271546.1.69710 WP_001271546.1.69754 WP_001271546.1.69758 WP_001271546.1.69760 WP_001271546.1.69767 WP_001271546.1.69785 WP_001271546.1.69787 WP_001271546.1.69790 WP_001271546.1.69807 WP_001271546.1.69808 WP_001271546.1.69817 WP_001271546.1.69839 WP_001271546.1.69848 WP_001271546.1.69890 WP_001271546.1.69923 WP_001271546.1.69948 WP_001271546.1.69953 WP_001271546.1.69965 WP_001271546.1.69975 WP_001271546.1.69977 WP_001271546.1.69982 WP_001271546.1.70003 WP_001271546.1.70010 WP_001271546.1.70028 WP_001271546.1.70047 WP_001271546.1.70049 WP_001271546.1.70058 WP_001271546.1.70061 WP_001271546.1.70087 WP_001271546.1.70088 WP_001271546.1.7010 WP_001271546.1.7014 WP_001271546.1.7016 WP_001271546.1.70169 WP_001271546.1.70183 WP_001271546.1.70205 WP_001271546.1.7021 WP_001271546.1.70240 WP_001271546.1.70241 WP_001271546.1.70248 WP_001271546.1.70249 WP_001271546.1.70261 WP_001271546.1.70262 WP_001271546.1.70269 WP_001271546.1.70272 WP_001271546.1.70281 WP_001271546.1.70289 WP_001271546.1.70290 WP_001271546.1.70303 WP_001271546.1.70314 WP_001271546.1.70321 WP_001271546.1.70326 WP_001271546.1.70327 WP_001271546.1.7033 WP_001271546.1.70355 WP_001271546.1.70427 WP_001271546.1.70433 WP_001271546.1.7044 WP_001271546.1.70440 WP_001271546.1.70447 WP_001271546.1.70485 WP_001271546.1.70488 WP_001271546.1.70491 WP_001271546.1.70523 WP_001271546.1.70531 WP_001271546.1.70545 WP_001271546.1.70547 WP_001271546.1.7055 WP_001271546.1.70580 WP_001271546.1.70596 WP_001271546.1.7060 WP_001271546.1.70623 WP_001271546.1.70643 WP_001271546.1.70644 WP_001271546.1.70662 WP_001271546.1.70671 WP_001271546.1.70678 WP_001271546.1.70679 WP_001271546.1.70683 WP_001271546.1.70685 WP_001271546.1.70692 WP_001271546.1.70708 WP_001271546.1.70712 WP_001271546.1.70717 WP_001271546.1.70731 WP_001271546.1.70732 WP_001271546.1.70733 WP_001271546.1.70761 WP_001271546.1.70772 WP_001271546.1.70785 WP_001271546.1.70792 WP_001271546.1.70797 WP_001271546.1.70837 WP_001271546.1.70845 WP_001271546.1.70846 WP_001271546.1.70869 WP_001271546.1.70883 WP_001271546.1.70899 WP_001271546.1.70914 WP_001271546.1.70922 WP_001271546.1.70929 WP_001271546.1.7093 WP_001271546.1.70948 WP_001271546.1.70959 WP_001271546.1.70969 WP_001271546.1.70971 WP_001271546.1.70977 WP_001271546.1.70981 WP_001271546.1.70985 WP_001271546.1.70986 WP_001271546.1.70995 WP_001271546.1.71007 WP_001271546.1.71010 WP_001271546.1.71023 WP_001271546.1.71039 WP_001271546.1.71057 WP_001271546.1.71069 WP_001271546.1.71081 WP_001271546.1.71088 WP_001271546.1.7110 WP_001271546.1.71116 WP_001271546.1.71117 WP_001271546.1.71120 WP_001271546.1.71146 WP_001271546.1.71150 WP_001271546.1.71165 WP_001271546.1.71171 WP_001271546.1.71172 WP_001271546.1.71184 WP_001271546.1.71186 WP_001271546.1.71188 WP_001271546.1.71201 WP_001271546.1.71202 WP_001271546.1.71243 WP_001271546.1.71248 WP_001271546.1.71268 WP_001271546.1.71299 WP_001271546.1.71305 WP_001271546.1.71306 WP_001271546.1.71337 WP_001271546.1.7134 WP_001271546.1.71363 WP_001271546.1.71368 WP_001271546.1.71378 WP_001271546.1.714 WP_001271546.1.71401 WP_001271546.1.71407 WP_001271546.1.71418 WP_001271546.1.7142 WP_001271546.1.71446 WP_001271546.1.71450 WP_001271546.1.71452 WP_001271546.1.71455 WP_001271546.1.71456 WP_001271546.1.71481 WP_001271546.1.71487 WP_001271546.1.71500 WP_001271546.1.71523 WP_001271546.1.71542 WP_001271546.1.71566 WP_001271546.1.71583 WP_001271546.1.71600 WP_001271546.1.71626 WP_001271546.1.71636 WP_001271546.1.71640 WP_001271546.1.71649 WP_001271546.1.71651 WP_001271546.1.71653 WP_001271546.1.71656 WP_001271546.1.71667 WP_001271546.1.71691 WP_001271546.1.71702 WP_001271546.1.71716 WP_001271546.1.7174 WP_001271546.1.71746 WP_001271546.1.71750 WP_001271546.1.71756 WP_001271546.1.71798 WP_001271546.1.71845 WP_001271546.1.71848 WP_001271546.1.71872 WP_001271546.1.71881 WP_001271546.1.71908 WP_001271546.1.71923 WP_001271546.1.71929 WP_001271546.1.71941 WP_001271546.1.71950 WP_001271546.1.71952 WP_001271546.1.71954 WP_001271546.1.71973 WP_001271546.1.71979 WP_001271546.1.71984 WP_001271546.1.71985 WP_001271546.1.720 WP_001271546.1.72003 WP_001271546.1.72065 WP_001271546.1.72068 WP_001271546.1.72073 WP_001271546.1.72100 WP_001271546.1.72105 WP_001271546.1.72107 WP_001271546.1.72119 WP_001271546.1.72121 WP_001271546.1.72182 WP_001271546.1.72188 WP_001271546.1.72190 WP_001271546.1.72203 WP_001271546.1.72220 WP_001271546.1.72221 WP_001271546.1.72226 WP_001271546.1.72234 WP_001271546.1.72243 WP_001271546.1.72254 WP_001271546.1.72269 WP_001271546.1.72277 WP_001271546.1.72281 WP_001271546.1.72283 WP_001271546.1.72300 WP_001271546.1.72307 WP_001271546.1.72325 WP_001271546.1.72339 WP_001271546.1.72350 WP_001271546.1.72351 WP_001271546.1.72372 WP_001271546.1.72376 WP_001271546.1.72382 WP_001271546.1.72383 WP_001271546.1.72403 WP_001271546.1.72412 WP_001271546.1.7243 WP_001271546.1.72438 WP_001271546.1.72461 WP_001271546.1.72470 WP_001271546.1.72527 WP_001271546.1.72532 WP_001271546.1.7255 WP_001271546.1.72594 WP_001271546.1.72602 WP_001271546.1.72625 WP_001271546.1.72629 WP_001271546.1.72631 WP_001271546.1.72638 WP_001271546.1.72642 WP_001271546.1.72667 WP_001271546.1.72671 WP_001271546.1.72674 WP_001271546.1.72689 WP_001271546.1.72716 WP_001271546.1.72718 WP_001271546.1.72724 WP_001271546.1.72728 WP_001271546.1.72789 WP_001271546.1.72793 WP_001271546.1.72797 WP_001271546.1.72827 WP_001271546.1.72828 WP_001271546.1.72843 WP_001271546.1.72850 WP_001271546.1.72865 WP_001271546.1.72871 WP_001271546.1.72872 WP_001271546.1.72887 WP_001271546.1.72892 WP_001271546.1.72894 WP_001271546.1.72896 WP_001271546.1.72897 WP_001271546.1.72944 WP_001271546.1.72946 WP_001271546.1.7295 WP_001271546.1.72968 WP_001271546.1.72969 WP_001271546.1.72975 WP_001271546.1.72987 WP_001271546.1.7304 WP_001271546.1.73052 WP_001271546.1.73062 WP_001271546.1.73068 WP_001271546.1.73102 WP_001271546.1.7311 WP_001271546.1.73114 WP_001271546.1.73125 WP_001271546.1.73144 WP_001271546.1.7315 WP_001271546.1.7316 WP_001271546.1.73164 WP_001271546.1.73177 WP_001271546.1.73180 WP_001271546.1.73200 WP_001271546.1.73242 WP_001271546.1.73258 WP_001271546.1.73270 WP_001271546.1.73285 WP_001271546.1.7332 WP_001271546.1.73328 WP_001271546.1.7333 WP_001271546.1.7334 WP_001271546.1.73352 WP_001271546.1.73362 WP_001271546.1.73377 WP_001271546.1.73379 WP_001271546.1.73389 WP_001271546.1.7341 WP_001271546.1.73425 WP_001271546.1.73461 WP_001271546.1.73481 WP_001271546.1.73488 WP_001271546.1.73504 WP_001271546.1.7353 WP_001271546.1.73535 WP_001271546.1.73544 WP_001271546.1.7356 WP_001271546.1.73561 WP_001271546.1.73581 WP_001271546.1.73596 WP_001271546.1.73598 WP_001271546.1.7361 WP_001271546.1.73617 WP_001271546.1.73648 WP_001271546.1.73667 WP_001271546.1.73669 WP_001271546.1.73701 WP_001271546.1.73708 WP_001271546.1.7374 WP_001271546.1.73753 WP_001271546.1.73758 WP_001271546.1.73764 WP_001271546.1.73768 WP_001271546.1.73794 WP_001271546.1.73804 WP_001271546.1.73831 WP_001271546.1.73847 WP_001271546.1.73849 WP_001271546.1.7386 WP_001271546.1.7387 WP_001271546.1.73901 WP_001271546.1.73924 WP_001271546.1.73926 WP_001271546.1.7394 WP_001271546.1.73945 WP_001271546.1.73948 WP_001271546.1.73956 WP_001271546.1.73958 WP_001271546.1.73965 WP_001271546.1.73999 WP_001271546.1.74024 WP_001271546.1.74028 WP_001271546.1.74030 WP_001271546.1.74038 WP_001271546.1.74040 WP_001271546.1.74043 WP_001271546.1.74049 WP_001271546.1.7405 WP_001271546.1.74058 WP_001271546.1.74070 WP_001271546.1.74077 WP_001271546.1.74089 WP_001271546.1.74117 WP_001271546.1.74135 WP_001271546.1.74174 WP_001271546.1.74181 WP_001271546.1.74191 WP_001271546.1.74207 WP_001271546.1.74214 WP_001271546.1.74228 WP_001271546.1.74241 WP_001271546.1.74248 WP_001271546.1.74285 WP_001271546.1.743 WP_001271546.1.7430 WP_001271546.1.74300 WP_001271546.1.74317 WP_001271546.1.7433 WP_001271546.1.74379 WP_001271546.1.74402 WP_001271546.1.74410 WP_001271546.1.74414 WP_001271546.1.74415 WP_001271546.1.74418 WP_001271546.1.74422 WP_001271546.1.74428 WP_001271546.1.7444 WP_001271546.1.74454 WP_001271546.1.74466 WP_001271546.1.74469 WP_001271546.1.74481 WP_001271546.1.745 WP_001271546.1.74500 WP_001271546.1.74529 WP_001271546.1.74545 WP_001271546.1.74570 WP_001271546.1.74578 WP_001271546.1.7458 WP_001271546.1.74616 WP_001271546.1.74620 WP_001271546.1.74621 WP_001271546.1.74639 WP_001271546.1.74644 WP_001271546.1.74647 WP_001271546.1.74661 WP_001271546.1.74673 WP_001271546.1.74677 WP_001271546.1.74699 WP_001271546.1.74702 WP_001271546.1.74741 WP_001271546.1.74745 WP_001271546.1.74757 WP_001271546.1.74806 WP_001271546.1.74826 WP_001271546.1.74831 WP_001271546.1.74876 WP_001271546.1.74894 WP_001271546.1.7491 WP_001271546.1.74929 WP_001271546.1.74939 WP_001271546.1.74946 WP_001271546.1.74972 WP_001271546.1.74973 WP_001271546.1.74992 WP_001271546.1.74996 WP_001271546.1.75009 WP_001271546.1.75051 WP_001271546.1.75056 WP_001271546.1.7507 WP_001271546.1.75089 WP_001271546.1.75114 WP_001271546.1.75116 WP_001271546.1.75129 WP_001271546.1.75134 WP_001271546.1.75148 WP_001271546.1.75150 WP_001271546.1.75159 WP_001271546.1.75168 WP_001271546.1.75177 WP_001271546.1.75180 WP_001271546.1.75187 WP_001271546.1.75237 WP_001271546.1.75273 WP_001271546.1.75288 WP_001271546.1.75296 WP_001271546.1.75301 WP_001271546.1.7531 WP_001271546.1.75334 WP_001271546.1.75362 WP_001271546.1.75371 WP_001271546.1.75385 WP_001271546.1.75392 WP_001271546.1.75400 WP_001271546.1.75402 WP_001271546.1.75413 WP_001271546.1.7543 WP_001271546.1.75433 WP_001271546.1.75450 WP_001271546.1.75494 WP_001271546.1.75532 WP_001271546.1.75565 WP_001271546.1.75585 WP_001271546.1.75593 WP_001271546.1.75607 WP_001271546.1.75609 WP_001271546.1.75610 WP_001271546.1.75626 WP_001271546.1.75633 WP_001271546.1.75664 WP_001271546.1.75703 WP_001271546.1.75716 WP_001271546.1.75718 WP_001271546.1.75740 WP_001271546.1.75745 WP_001271546.1.75751 WP_001271546.1.75760 WP_001271546.1.75764 WP_001271546.1.75793 WP_001271546.1.75794 WP_001271546.1.75810 WP_001271546.1.75828 WP_001271546.1.75837 WP_001271546.1.75844 WP_001271546.1.75863 WP_001271546.1.75873 WP_001271546.1.75874 WP_001271546.1.75884 WP_001271546.1.75886 WP_001271546.1.75898 WP_001271546.1.75902 WP_001271546.1.75932 WP_001271546.1.75945 WP_001271546.1.75957 WP_001271546.1.76 WP_001271546.1.76020 WP_001271546.1.76024 WP_001271546.1.76055 WP_001271546.1.76081 WP_001271546.1.76097 WP_001271546.1.76102 WP_001271546.1.76108 WP_001271546.1.76115 WP_001271546.1.76116 WP_001271546.1.76122 WP_001271546.1.76137 WP_001271546.1.76156 WP_001271546.1.76162 WP_001271546.1.76164 WP_001271546.1.76170 WP_001271546.1.76186 WP_001271546.1.76197 WP_001271546.1.76208 WP_001271546.1.76252 WP_001271546.1.76256 WP_001271546.1.7629 WP_001271546.1.76301 WP_001271546.1.76327 WP_001271546.1.76339 WP_001271546.1.7634 WP_001271546.1.76345 WP_001271546.1.76346 WP_001271546.1.76364 WP_001271546.1.76366 WP_001271546.1.76417 WP_001271546.1.76434 WP_001271546.1.76445 WP_001271546.1.76451 WP_001271546.1.7646 WP_001271546.1.76471 WP_001271546.1.76495 WP_001271546.1.76510 WP_001271546.1.76529 WP_001271546.1.76532 WP_001271546.1.76548 WP_001271546.1.7655 WP_001271546.1.76558 WP_001271546.1.7657 WP_001271546.1.76572 WP_001271546.1.76576 WP_001271546.1.7660 WP_001271546.1.76611 WP_001271546.1.76641 WP_001271546.1.76651 WP_001271546.1.76653 WP_001271546.1.76673 WP_001271546.1.76706 WP_001271546.1.7672 WP_001271546.1.76721 WP_001271546.1.76724 WP_001271546.1.76738 WP_001271546.1.76756 WP_001271546.1.76760 WP_001271546.1.76776 WP_001271546.1.76788 WP_001271546.1.76799 WP_001271546.1.76806 WP_001271546.1.7684 WP_001271546.1.76854 WP_001271546.1.76866 WP_001271546.1.76875 WP_001271546.1.76880 WP_001271546.1.76899 WP_001271546.1.76913 WP_001271546.1.76916 WP_001271546.1.76932 WP_001271546.1.76968 WP_001271546.1.76973 WP_001271546.1.76988 WP_001271546.1.77016 WP_001271546.1.77017 WP_001271546.1.77033 WP_001271546.1.77038 WP_001271546.1.77047 WP_001271546.1.77067 WP_001271546.1.77080 WP_001271546.1.77087 WP_001271546.1.77090 WP_001271546.1.77111 WP_001271546.1.7712 WP_001271546.1.77177 WP_001271546.1.77180 WP_001271546.1.77184 WP_001271546.1.77193 WP_001271546.1.77241 WP_001271546.1.77244 WP_001271546.1.77267 WP_001271546.1.77271 WP_001271546.1.77292 WP_001271546.1.77299 WP_001271546.1.77306 WP_001271546.1.77313 WP_001271546.1.77349 WP_001271546.1.77356 WP_001271546.1.77384 WP_001271546.1.77390 WP_001271546.1.77414 WP_001271546.1.77431 WP_001271546.1.77436 WP_001271546.1.77440 WP_001271546.1.77475 WP_001271546.1.77496 WP_001271546.1.77501 WP_001271546.1.77512 WP_001271546.1.77513 WP_001271546.1.77514 WP_001271546.1.77529 WP_001271546.1.77543 WP_001271546.1.77549 WP_001271546.1.77555 WP_001271546.1.77563 WP_001271546.1.77565 WP_001271546.1.77575 WP_001271546.1.77596 WP_001271546.1.77629 WP_001271546.1.77646 WP_001271546.1.77653 WP_001271546.1.77692 WP_001271546.1.77702 WP_001271546.1.77710 WP_001271546.1.77713 WP_001271546.1.7772 WP_001271546.1.77729 WP_001271546.1.77754 WP_001271546.1.77761 WP_001271546.1.7782 WP_001271546.1.77825 WP_001271546.1.77837 WP_001271546.1.7784 WP_001271546.1.77846 WP_001271546.1.77851 WP_001271546.1.77861 WP_001271546.1.77871 WP_001271546.1.77898 WP_001271546.1.77900 WP_001271546.1.77918 WP_001271546.1.7792 WP_001271546.1.77923 WP_001271546.1.7793 WP_001271546.1.77951 WP_001271546.1.77960 WP_001271546.1.77971 WP_001271546.1.77975 WP_001271546.1.77983 WP_001271546.1.77987 WP_001271546.1.77989 WP_001271546.1.78 WP_001271546.1.78016 WP_001271546.1.7802 WP_001271546.1.78026 WP_001271546.1.78033 WP_001271546.1.78035 WP_001271546.1.78048 WP_001271546.1.78051 WP_001271546.1.78053 WP_001271546.1.78076 WP_001271546.1.78096 WP_001271546.1.78100 WP_001271546.1.78107 WP_001271546.1.78110 WP_001271546.1.78120 WP_001271546.1.7814 WP_001271546.1.78166 WP_001271546.1.78168 WP_001271546.1.78180 WP_001271546.1.78192 WP_001271546.1.78195 WP_001271546.1.78201 WP_001271546.1.78245 WP_001271546.1.78259 WP_001271546.1.78291 WP_001271546.1.78301 WP_001271546.1.78309 WP_001271546.1.78320 WP_001271546.1.78352 WP_001271546.1.78366 WP_001271546.1.78372 WP_001271546.1.78382 WP_001271546.1.78383 WP_001271546.1.78388 WP_001271546.1.78407 WP_001271546.1.78410 WP_001271546.1.78443 WP_001271546.1.78495 WP_001271546.1.78496 WP_001271546.1.78501 WP_001271546.1.78502 WP_001271546.1.78602 WP_001271546.1.78603 WP_001271546.1.7861 WP_001271546.1.78618 WP_001271546.1.7862 WP_001271546.1.78626 WP_001271546.1.78632 WP_001271546.1.78658 WP_001271546.1.78661 WP_001271546.1.78673 WP_001271546.1.78674 WP_001271546.1.78676 WP_001271546.1.78697 WP_001271546.1.78734 WP_001271546.1.78735 WP_001271546.1.78738 WP_001271546.1.78761 WP_001271546.1.7877 WP_001271546.1.78771 WP_001271546.1.78789 WP_001271546.1.78802 WP_001271546.1.78815 WP_001271546.1.78830 WP_001271546.1.78835 WP_001271546.1.78838 WP_001271546.1.78862 WP_001271546.1.78871 WP_001271546.1.78874 WP_001271546.1.78877 WP_001271546.1.78881 WP_001271546.1.78896 WP_001271546.1.789 WP_001271546.1.7891 WP_001271546.1.78913 WP_001271546.1.78918 WP_001271546.1.7893 WP_001271546.1.78930 WP_001271546.1.78951 WP_001271546.1.78959 WP_001271546.1.78993 WP_001271546.1.79011 WP_001271546.1.79012 WP_001271546.1.79032 WP_001271546.1.79069 WP_001271546.1.79074 WP_001271546.1.79081 WP_001271546.1.79098 WP_001271546.1.79099 WP_001271546.1.79140 WP_001271546.1.79151 WP_001271546.1.79155 WP_001271546.1.79164 WP_001271546.1.79167 WP_001271546.1.79189 WP_001271546.1.79203 WP_001271546.1.79204 WP_001271546.1.79235 WP_001271546.1.79280 WP_001271546.1.79289 WP_001271546.1.79297 WP_001271546.1.79300 WP_001271546.1.79302 WP_001271546.1.79335 WP_001271546.1.79370 WP_001271546.1.79397 WP_001271546.1.794 WP_001271546.1.79427 WP_001271546.1.79456 WP_001271546.1.79462 WP_001271546.1.79466 WP_001271546.1.79468 WP_001271546.1.79472 WP_001271546.1.79490 WP_001271546.1.79495 WP_001271546.1.79529 WP_001271546.1.79531 WP_001271546.1.79532 WP_001271546.1.79547 WP_001271546.1.7956 WP_001271546.1.79570 WP_001271546.1.79580 WP_001271546.1.79586 WP_001271546.1.79635 WP_001271546.1.7964 WP_001271546.1.79642 WP_001271546.1.79645 WP_001271546.1.79654 WP_001271546.1.79659 WP_001271546.1.79668 WP_001271546.1.7970 WP_001271546.1.79708 WP_001271546.1.7972 WP_001271546.1.79722 WP_001271546.1.79734 WP_001271546.1.79738 WP_001271546.1.79757 WP_001271546.1.79772 WP_001271546.1.79778 WP_001271546.1.7979 WP_001271546.1.7982 WP_001271546.1.79832 WP_001271546.1.79845 WP_001271546.1.79867 WP_001271546.1.79880 WP_001271546.1.79892 WP_001271546.1.79910 WP_001271546.1.79914 WP_001271546.1.79916 WP_001271546.1.79929 WP_001271546.1.79934 WP_001271546.1.7994 WP_001271546.1.79942 WP_001271546.1.79945 WP_001271546.1.79966 WP_001271546.1.79974 WP_001271546.1.79977 WP_001271546.1.79996 WP_001271546.1.80045 WP_001271546.1.80065 WP_001271546.1.80077 WP_001271546.1.80103 WP_001271546.1.80137 WP_001271546.1.80182 WP_001271546.1.80229 WP_001271546.1.80236 WP_001271546.1.8024 WP_001271546.1.80249 WP_001271546.1.80250 WP_001271546.1.80254 WP_001271546.1.80273 WP_001271546.1.80282 WP_001271546.1.80293 WP_001271546.1.80296 WP_001271546.1.80307 WP_001271546.1.80333 WP_001271546.1.80354 WP_001271546.1.80363 WP_001271546.1.80366 WP_001271546.1.80368 WP_001271546.1.80380 WP_001271546.1.80386 WP_001271546.1.80400 WP_001271546.1.80441 WP_001271546.1.80443 WP_001271546.1.80448 WP_001271546.1.80462 WP_001271546.1.80473 WP_001271546.1.80479 WP_001271546.1.80480 WP_001271546.1.8049 WP_001271546.1.80492 WP_001271546.1.80496 WP_001271546.1.80529 WP_001271546.1.80542 WP_001271546.1.80569 WP_001271546.1.80586 WP_001271546.1.80609 WP_001271546.1.80629 WP_001271546.1.80638 WP_001271546.1.80651 WP_001271546.1.80664 WP_001271546.1.80667 WP_001271546.1.80674 WP_001271546.1.80696 WP_001271546.1.80707 WP_001271546.1.80723 WP_001271546.1.80725 WP_001271546.1.80741 WP_001271546.1.80750 WP_001271546.1.80757 WP_001271546.1.80760 WP_001271546.1.80780 WP_001271546.1.80803 WP_001271546.1.80819 WP_001271546.1.80827 WP_001271546.1.80831 WP_001271546.1.80840 WP_001271546.1.80850 WP_001271546.1.80857 WP_001271546.1.80868 WP_001271546.1.80874 WP_001271546.1.80876 WP_001271546.1.80881 WP_001271546.1.80913 WP_001271546.1.80927 WP_001271546.1.80939 WP_001271546.1.8096 WP_001271546.1.80973 WP_001271546.1.80984 WP_001271546.1.81037 WP_001271546.1.81041 WP_001271546.1.8106 WP_001271546.1.81062 WP_001271546.1.81067 WP_001271546.1.81069 WP_001271546.1.81084 WP_001271546.1.81107 WP_001271546.1.81109 WP_001271546.1.81110 WP_001271546.1.81118 WP_001271546.1.81131 WP_001271546.1.81149 WP_001271546.1.81175 WP_001271546.1.81187 WP_001271546.1.8119 WP_001271546.1.81193 WP_001271546.1.81197 WP_001271546.1.81225 WP_001271546.1.81231 WP_001271546.1.81262 WP_001271546.1.81268 WP_001271546.1.81269 WP_001271546.1.8127 WP_001271546.1.81271 WP_001271546.1.81275 WP_001271546.1.8130 WP_001271546.1.81302 WP_001271546.1.81305 WP_001271546.1.8131 WP_001271546.1.81320 WP_001271546.1.81321 WP_001271546.1.81328 WP_001271546.1.81333 WP_001271546.1.8134 WP_001271546.1.81342 WP_001271546.1.81354 WP_001271546.1.81364 WP_001271546.1.81388 WP_001271546.1.81404 WP_001271546.1.81409 WP_001271546.1.81410 WP_001271546.1.81425 WP_001271546.1.81455 WP_001271546.1.81472 WP_001271546.1.81494 WP_001271546.1.81504 WP_001271546.1.81528 WP_001271546.1.81548 WP_001271546.1.81557 WP_001271546.1.81568 WP_001271546.1.81612 WP_001271546.1.81667 WP_001271546.1.81668 WP_001271546.1.81676 WP_001271546.1.8168 WP_001271546.1.81681 WP_001271546.1.8170 WP_001271546.1.81727 WP_001271546.1.81735 WP_001271546.1.81736 WP_001271546.1.81743 WP_001271546.1.81746 WP_001271546.1.81750 WP_001271546.1.81760 WP_001271546.1.81763 WP_001271546.1.81768 WP_001271546.1.81785 WP_001271546.1.81795 WP_001271546.1.81798 WP_001271546.1.81855 WP_001271546.1.81902 WP_001271546.1.81921 WP_001271546.1.81931 WP_001271546.1.81936 WP_001271546.1.81941 WP_001271546.1.81949 WP_001271546.1.8196 WP_001271546.1.81965 WP_001271546.1.81974 WP_001271546.1.81977 WP_001271546.1.81995 WP_001271546.1.82037 WP_001271546.1.82070 WP_001271546.1.82076 WP_001271546.1.82099 WP_001271546.1.82131 WP_001271546.1.82141 WP_001271546.1.82144 WP_001271546.1.82149 WP_001271546.1.82156 WP_001271546.1.8218 WP_001271546.1.82180 WP_001271546.1.82192 WP_001271546.1.82201 WP_001271546.1.82214 WP_001271546.1.82225 WP_001271546.1.82232 WP_001271546.1.82258 WP_001271546.1.82269 WP_001271546.1.82337 WP_001271546.1.82347 WP_001271546.1.82352 WP_001271546.1.8236 WP_001271546.1.82369 WP_001271546.1.82395 WP_001271546.1.8240 WP_001271546.1.82401 WP_001271546.1.82408 WP_001271546.1.82416 WP_001271546.1.8242 WP_001271546.1.82434 WP_001271546.1.82456 WP_001271546.1.82464 WP_001271546.1.82465 WP_001271546.1.8247 WP_001271546.1.82473 WP_001271546.1.82474 WP_001271546.1.82479 WP_001271546.1.82503 WP_001271546.1.82515 WP_001271546.1.82529 WP_001271546.1.82530 WP_001271546.1.82553 WP_001271546.1.82562 WP_001271546.1.82569 WP_001271546.1.82570 WP_001271546.1.82584 WP_001271546.1.82636 WP_001271546.1.82637 WP_001271546.1.82646 WP_001271546.1.82648 WP_001271546.1.82670 WP_001271546.1.82676 WP_001271546.1.82692 WP_001271546.1.82731 WP_001271546.1.82761 WP_001271546.1.82763 WP_001271546.1.82812 WP_001271546.1.8282 WP_001271546.1.82841 WP_001271546.1.82843 WP_001271546.1.82850 WP_001271546.1.82867 WP_001271546.1.82872 WP_001271546.1.82886 WP_001271546.1.82895 WP_001271546.1.82899 WP_001271546.1.82908 WP_001271546.1.82937 WP_001271546.1.8294 WP_001271546.1.82944 WP_001271546.1.82946 WP_001271546.1.82956 WP_001271546.1.82959 WP_001271546.1.82964 WP_001271546.1.82992 WP_001271546.1.83005 WP_001271546.1.83006 WP_001271546.1.83007 WP_001271546.1.8304 WP_001271546.1.83061 WP_001271546.1.83092 WP_001271546.1.83119 WP_001271546.1.83128 WP_001271546.1.83139 WP_001271546.1.83163 WP_001271546.1.83180 WP_001271546.1.83204 WP_001271546.1.8322 WP_001271546.1.83221 WP_001271546.1.83229 WP_001271546.1.83235 WP_001271546.1.83247 WP_001271546.1.83252 WP_001271546.1.83258 WP_001271546.1.83280 WP_001271546.1.83290 WP_001271546.1.83301 WP_001271546.1.83305 WP_001271546.1.83331 WP_001271546.1.83333 WP_001271546.1.83354 WP_001271546.1.83356 WP_001271546.1.83360 WP_001271546.1.83365 WP_001271546.1.83378 WP_001271546.1.83382 WP_001271546.1.83388 WP_001271546.1.83407 WP_001271546.1.83413 WP_001271546.1.83491 WP_001271546.1.83510 WP_001271546.1.83516 WP_001271546.1.83523 WP_001271546.1.8354 WP_001271546.1.83558 WP_001271546.1.83572 WP_001271546.1.83598 WP_001271546.1.83650 WP_001271546.1.83651 WP_001271546.1.83657 WP_001271546.1.83677 WP_001271546.1.83710 WP_001271546.1.83721 WP_001271546.1.83739 WP_001271546.1.8375 WP_001271546.1.83759 WP_001271546.1.83760 WP_001271546.1.83806 WP_001271546.1.83854 WP_001271546.1.83897 WP_001271546.1.83923 WP_001271546.1.83960 WP_001271546.1.83979 WP_001271546.1.8399 WP_001271546.1.83994 WP_001271546.1.83995 WP_001271546.1.84 WP_001271546.1.84000 WP_001271546.1.84001 WP_001271546.1.84011 WP_001271546.1.84031 WP_001271546.1.8406 WP_001271546.1.84075 WP_001271546.1.84076 WP_001271546.1.84077 WP_001271546.1.84083 WP_001271546.1.84086 WP_001271546.1.84100 WP_001271546.1.84103 WP_001271546.1.84106 WP_001271546.1.84110 WP_001271546.1.84115 WP_001271546.1.84127 WP_001271546.1.84150 WP_001271546.1.84154 WP_001271546.1.84168 WP_001271546.1.84179 WP_001271546.1.84205 WP_001271546.1.84209 WP_001271546.1.84229 WP_001271546.1.84230 WP_001271546.1.8425 WP_001271546.1.84252 WP_001271546.1.84283 WP_001271546.1.84291 WP_001271546.1.84300 WP_001271546.1.8431 WP_001271546.1.84325 WP_001271546.1.84345 WP_001271546.1.84355 WP_001271546.1.84359 WP_001271546.1.84369 WP_001271546.1.84373 WP_001271546.1.84392 WP_001271546.1.84397 WP_001271546.1.84401 WP_001271546.1.84403 WP_001271546.1.8441 WP_001271546.1.84435 WP_001271546.1.84459 WP_001271546.1.84461 WP_001271546.1.84475 WP_001271546.1.84497 WP_001271546.1.84515 WP_001271546.1.84523 WP_001271546.1.84532 WP_001271546.1.84551 WP_001271546.1.84554 WP_001271546.1.84567 WP_001271546.1.84572 WP_001271546.1.84598 WP_001271546.1.84631 WP_001271546.1.84644 WP_001271546.1.84659 WP_001271546.1.84683 WP_001271546.1.84693 WP_001271546.1.84711 WP_001271546.1.84721 WP_001271546.1.84727 WP_001271546.1.84744 WP_001271546.1.84745 WP_001271546.1.84773 WP_001271546.1.84814 WP_001271546.1.84872 WP_001271546.1.84876 WP_001271546.1.84879 WP_001271546.1.84899 WP_001271546.1.849 WP_001271546.1.84945 WP_001271546.1.84967 WP_001271546.1.8497 WP_001271546.1.84983 WP_001271546.1.850 WP_001271546.1.85004 WP_001271546.1.85014 WP_001271546.1.8502 WP_001271546.1.85031 WP_001271546.1.85039 WP_001271546.1.85040 WP_001271546.1.85079 WP_001271546.1.85094 WP_001271546.1.85120 WP_001271546.1.85126 WP_001271546.1.85134 WP_001271546.1.85147 WP_001271546.1.85153 WP_001271546.1.85178 WP_001271546.1.85180 WP_001271546.1.85190 WP_001271546.1.85192 WP_001271546.1.85217 WP_001271546.1.8526 WP_001271546.1.85271 WP_001271546.1.85273 WP_001271546.1.85301 WP_001271546.1.8533 WP_001271546.1.85338 WP_001271546.1.85339 WP_001271546.1.8537 WP_001271546.1.85408 WP_001271546.1.85433 WP_001271546.1.8545 WP_001271546.1.85456 WP_001271546.1.85469 WP_001271546.1.85481 WP_001271546.1.85483 WP_001271546.1.85511 WP_001271546.1.85512 WP_001271546.1.8552 WP_001271546.1.85541 WP_001271546.1.8556 WP_001271546.1.85568 WP_001271546.1.8557 WP_001271546.1.85606 WP_001271546.1.85615 WP_001271546.1.85617 WP_001271546.1.85635 WP_001271546.1.85646 WP_001271546.1.85654 WP_001271546.1.85663 WP_001271546.1.85665 WP_001271546.1.85669 WP_001271546.1.85671 WP_001271546.1.85672 WP_001271546.1.85675 WP_001271546.1.85688 WP_001271546.1.85703 WP_001271546.1.85723 WP_001271546.1.85728 WP_001271546.1.85742 WP_001271546.1.85746 WP_001271546.1.85759 WP_001271546.1.85777 WP_001271546.1.85780 WP_001271546.1.85784 WP_001271546.1.85797 WP_001271546.1.85811 WP_001271546.1.85854 WP_001271546.1.85855 WP_001271546.1.85864 WP_001271546.1.85886 WP_001271546.1.859 WP_001271546.1.85900 WP_001271546.1.85904 WP_001271546.1.8591 WP_001271546.1.85917 WP_001271546.1.8594 WP_001271546.1.85943 WP_001271546.1.85976 WP_001271546.1.85977 WP_001271546.1.85982 WP_001271546.1.860 WP_001271546.1.86007 WP_001271546.1.86010 WP_001271546.1.86017 WP_001271546.1.86043 WP_001271546.1.8605 WP_001271546.1.86084 WP_001271546.1.86092 WP_001271546.1.8610 WP_001271546.1.86126 WP_001271546.1.86138 WP_001271546.1.8614 WP_001271546.1.86156 WP_001271546.1.86157 WP_001271546.1.86159 WP_001271546.1.8616 WP_001271546.1.86173 WP_001271546.1.86206 WP_001271546.1.86224 WP_001271546.1.86240 WP_001271546.1.86259 WP_001271546.1.86284 WP_001271546.1.86285 WP_001271546.1.86306 WP_001271546.1.86310 WP_001271546.1.86316 WP_001271546.1.86323 WP_001271546.1.86335 WP_001271546.1.86342 WP_001271546.1.86347 WP_001271546.1.86356 WP_001271546.1.86380 WP_001271546.1.86389 WP_001271546.1.8640 WP_001271546.1.8642 WP_001271546.1.86426 WP_001271546.1.86442 WP_001271546.1.86450 WP_001271546.1.86453 WP_001271546.1.86466 WP_001271546.1.86469 WP_001271546.1.8647 WP_001271546.1.86489 WP_001271546.1.86514 WP_001271546.1.86530 WP_001271546.1.86580 WP_001271546.1.86588 WP_001271546.1.86593 WP_001271546.1.86601 WP_001271546.1.86610 WP_001271546.1.86634 WP_001271546.1.86656 WP_001271546.1.86658 WP_001271546.1.86661 WP_001271546.1.86663 WP_001271546.1.86676 WP_001271546.1.86699 WP_001271546.1.8671 WP_001271546.1.8672 WP_001271546.1.86744 WP_001271546.1.86770 WP_001271546.1.8678 WP_001271546.1.86794 WP_001271546.1.86800 WP_001271546.1.86807 WP_001271546.1.86810 WP_001271546.1.86811 WP_001271546.1.86815 WP_001271546.1.8684 WP_001271546.1.86859 WP_001271546.1.86860 WP_001271546.1.86895 WP_001271546.1.86902 WP_001271546.1.86906 WP_001271546.1.8691 WP_001271546.1.86915 WP_001271546.1.86921 WP_001271546.1.86945 WP_001271546.1.86982 WP_001271546.1.86989 WP_001271546.1.87023 WP_001271546.1.87034 WP_001271546.1.87038 WP_001271546.1.87041 WP_001271546.1.87051 WP_001271546.1.87095 WP_001271546.1.87136 WP_001271546.1.87143 WP_001271546.1.87148 WP_001271546.1.87155 WP_001271546.1.87187 WP_001271546.1.87219 WP_001271546.1.8722 WP_001271546.1.87220 WP_001271546.1.87258 WP_001271546.1.87265 WP_001271546.1.87276 WP_001271546.1.87282 WP_001271546.1.87283 WP_001271546.1.87293 WP_001271546.1.87323 WP_001271546.1.87346 WP_001271546.1.8736 WP_001271546.1.87365 WP_001271546.1.87370 WP_001271546.1.87376 WP_001271546.1.87420 WP_001271546.1.87460 WP_001271546.1.87484 WP_001271546.1.87493 WP_001271546.1.87500 WP_001271546.1.87528 WP_001271546.1.87552 WP_001271546.1.87560 WP_001271546.1.87583 WP_001271546.1.87584 WP_001271546.1.8760 WP_001271546.1.87600 WP_001271546.1.87609 WP_001271546.1.87612 WP_001271546.1.87615 WP_001271546.1.87618 WP_001271546.1.87626 WP_001271546.1.87651 WP_001271546.1.87653 WP_001271546.1.87659 WP_001271546.1.8767 WP_001271546.1.87687 WP_001271546.1.87695 WP_001271546.1.87698 WP_001271546.1.87706 WP_001271546.1.87712 WP_001271546.1.87739 WP_001271546.1.87741 WP_001271546.1.87742 WP_001271546.1.87760 WP_001271546.1.87779 WP_001271546.1.87813 WP_001271546.1.87852 WP_001271546.1.87875 WP_001271546.1.87891 WP_001271546.1.87899 WP_001271546.1.87905 WP_001271546.1.8792 WP_001271546.1.87933 WP_001271546.1.87936 WP_001271546.1.87945 WP_001271546.1.87949 WP_001271546.1.87999 WP_001271546.1.8800 WP_001271546.1.88014 WP_001271546.1.88019 WP_001271546.1.88025 WP_001271546.1.88026 WP_001271546.1.8805 WP_001271546.1.88052 WP_001271546.1.8806 WP_001271546.1.88073 WP_001271546.1.8809 WP_001271546.1.88092 WP_001271546.1.881 WP_001271546.1.88136 WP_001271546.1.88145 WP_001271546.1.88165 WP_001271546.1.88174 WP_001271546.1.88185 WP_001271546.1.88199 WP_001271546.1.88214 WP_001271546.1.88222 WP_001271546.1.88244 WP_001271546.1.88264 WP_001271546.1.88275 WP_001271546.1.88291 WP_001271546.1.88293 WP_001271546.1.88299 WP_001271546.1.88303 WP_001271546.1.88313 WP_001271546.1.88356 WP_001271546.1.88359 WP_001271546.1.8837 WP_001271546.1.88393 WP_001271546.1.88407 WP_001271546.1.88414 WP_001271546.1.88423 WP_001271546.1.88444 WP_001271546.1.88446 WP_001271546.1.88458 WP_001271546.1.88474 WP_001271546.1.88483 WP_001271546.1.8849 WP_001271546.1.88501 WP_001271546.1.88508 WP_001271546.1.88538 WP_001271546.1.88547 WP_001271546.1.88597 WP_001271546.1.886 WP_001271546.1.88609 WP_001271546.1.88620 WP_001271546.1.88624 WP_001271546.1.88647 WP_001271546.1.88648 WP_001271546.1.88651 WP_001271546.1.88675 WP_001271546.1.88683 WP_001271546.1.88692 WP_001271546.1.88698 WP_001271546.1.88703 WP_001271546.1.88707 WP_001271546.1.88727 WP_001271546.1.88731 WP_001271546.1.88762 WP_001271546.1.88772 WP_001271546.1.88776 WP_001271546.1.88792 WP_001271546.1.88817 WP_001271546.1.88845 WP_001271546.1.88850 WP_001271546.1.88854 WP_001271546.1.8889 WP_001271546.1.88892 WP_001271546.1.88894 WP_001271546.1.88902 WP_001271546.1.8891 WP_001271546.1.88942 WP_001271546.1.88957 WP_001271546.1.88966 WP_001271546.1.88967 WP_001271546.1.88968 WP_001271546.1.88970 WP_001271546.1.88980 WP_001271546.1.88981 WP_001271546.1.88982 WP_001271546.1.88995 WP_001271546.1.88998 WP_001271546.1.89008 WP_001271546.1.89054 WP_001271546.1.89114 WP_001271546.1.89116 WP_001271546.1.89119 WP_001271546.1.89120 WP_001271546.1.89138 WP_001271546.1.89174 WP_001271546.1.89177 WP_001271546.1.89182 WP_001271546.1.89188 WP_001271546.1.89215 WP_001271546.1.89221 WP_001271546.1.89291 WP_001271546.1.89298 WP_001271546.1.89304 WP_001271546.1.89308 WP_001271546.1.89311 WP_001271546.1.89314 WP_001271546.1.89328 WP_001271546.1.89332 WP_001271546.1.89343 WP_001271546.1.89354 WP_001271546.1.89362 WP_001271546.1.89395 WP_001271546.1.8940 WP_001271546.1.89408 WP_001271546.1.89425 WP_001271546.1.89449 WP_001271546.1.89452 WP_001271546.1.89462 WP_001271546.1.8947 WP_001271546.1.89503 WP_001271546.1.89512 WP_001271546.1.89527 WP_001271546.1.89570 WP_001271546.1.8958 WP_001271546.1.89591 WP_001271546.1.89604 WP_001271546.1.89606 WP_001271546.1.8961 WP_001271546.1.89612 WP_001271546.1.89622 WP_001271546.1.89632 WP_001271546.1.89634 WP_001271546.1.89647 WP_001271546.1.89657 WP_001271546.1.89659 WP_001271546.1.89668 WP_001271546.1.89680 WP_001271546.1.89706 WP_001271546.1.89713 WP_001271546.1.89733 WP_001271546.1.89746 WP_001271546.1.89764 WP_001271546.1.89765 WP_001271546.1.89777 WP_001271546.1.89789 WP_001271546.1.89796 WP_001271546.1.89804 WP_001271546.1.89815 WP_001271546.1.89817 WP_001271546.1.89832 WP_001271546.1.89845 WP_001271546.1.89870 WP_001271546.1.89888 WP_001271546.1.89902 WP_001271546.1.89911 WP_001271546.1.89914 WP_001271546.1.89940 WP_001271546.1.8995 WP_001271546.1.89952 WP_001271546.1.8996 WP_001271546.1.89965 WP_001271546.1.89975 WP_001271546.1.90007 WP_001271546.1.9002 WP_001271546.1.9003 WP_001271546.1.90033 WP_001271546.1.90084 WP_001271546.1.90097 WP_001271546.1.90108 WP_001271546.1.9011 WP_001271546.1.90193 WP_001271546.1.90196 WP_001271546.1.90211 WP_001271546.1.90220 WP_001271546.1.90240 WP_001271546.1.90248 WP_001271546.1.90252 WP_001271546.1.90274 WP_001271546.1.90280 WP_001271546.1.90293 WP_001271546.1.90302 WP_001271546.1.90311 WP_001271546.1.90330 WP_001271546.1.90338 WP_001271546.1.90348 WP_001271546.1.90363 WP_001271546.1.90365 WP_001271546.1.90409 WP_001271546.1.90417 WP_001271546.1.90421 WP_001271546.1.90428 WP_001271546.1.90440 WP_001271546.1.90453 WP_001271546.1.90458 WP_001271546.1.90472 WP_001271546.1.90489 WP_001271546.1.90513 WP_001271546.1.90521 WP_001271546.1.90522 WP_001271546.1.90540 WP_001271546.1.90557 WP_001271546.1.90563 WP_001271546.1.90566 WP_001271546.1.90582 WP_001271546.1.90585 WP_001271546.1.90617 WP_001271546.1.90620 WP_001271546.1.90625 WP_001271546.1.9064 WP_001271546.1.90641 WP_001271546.1.90701 WP_001271546.1.90713 WP_001271546.1.90734 WP_001271546.1.90748 WP_001271546.1.90752 WP_001271546.1.90759 WP_001271546.1.90792 WP_001271546.1.90794 WP_001271546.1.90796 WP_001271546.1.90811 WP_001271546.1.90814 WP_001271546.1.90859 WP_001271546.1.90866 WP_001271546.1.90876 WP_001271546.1.90878 WP_001271546.1.9089 WP_001271546.1.9091 WP_001271546.1.9093 WP_001271546.1.90959 WP_001271546.1.90973 WP_001271546.1.90983 WP_001271546.1.90984 WP_001271546.1.90991 WP_001271546.1.91003 WP_001271546.1.91023 WP_001271546.1.91049 WP_001271546.1.91056 WP_001271546.1.91067 WP_001271546.1.91069 WP_001271546.1.91107 WP_001271546.1.91156 WP_001271546.1.91164 WP_001271546.1.91179 WP_001271546.1.91189 WP_001271546.1.91205 WP_001271546.1.91215 WP_001271546.1.91239 WP_001271546.1.91278 WP_001271546.1.91282 WP_001271546.1.91291 WP_001271546.1.9131 WP_001271546.1.91312 WP_001271546.1.91313 WP_001271546.1.91331 WP_001271546.1.91334 WP_001271546.1.9135 WP_001271546.1.9137 WP_001271546.1.91372 WP_001271546.1.91381 WP_001271546.1.91405 WP_001271546.1.91424 WP_001271546.1.91453 WP_001271546.1.91459 WP_001271546.1.91470 WP_001271546.1.91473 WP_001271546.1.91474 WP_001271546.1.91493 WP_001271546.1.91505 WP_001271546.1.91506 WP_001271546.1.91512 WP_001271546.1.91524 WP_001271546.1.91528 WP_001271546.1.91557 WP_001271546.1.91564 WP_001271546.1.91579 WP_001271546.1.91580 WP_001271546.1.91597 WP_001271546.1.91621 WP_001271546.1.91625 WP_001271546.1.91628 WP_001271546.1.91655 WP_001271546.1.9166 WP_001271546.1.91702 WP_001271546.1.91715 WP_001271546.1.91724 WP_001271546.1.91732 WP_001271546.1.91736 WP_001271546.1.91742 WP_001271546.1.91772 WP_001271546.1.91776 WP_001271546.1.91788 WP_001271546.1.91795 WP_001271546.1.91806 WP_001271546.1.91864 WP_001271546.1.9187 WP_001271546.1.91870 WP_001271546.1.91880 WP_001271546.1.91898 WP_001271546.1.91903 WP_001271546.1.91904 WP_001271546.1.91914 WP_001271546.1.91974 WP_001271546.1.91984 WP_001271546.1.92013 WP_001271546.1.92018 WP_001271546.1.92039 WP_001271546.1.92044 WP_001271546.1.92047 WP_001271546.1.92060 WP_001271546.1.92067 WP_001271546.1.92068 WP_001271546.1.92082 WP_001271546.1.92087 WP_001271546.1.92093 WP_001271546.1.92098 WP_001271546.1.92099 WP_001271546.1.92108 WP_001271546.1.92122 WP_001271546.1.92129 WP_001271546.1.92156 WP_001271546.1.92165 WP_001271546.1.92171 WP_001271546.1.92172 WP_001271546.1.92183 WP_001271546.1.92208 WP_001271546.1.92213 WP_001271546.1.9222 WP_001271546.1.92240 WP_001271546.1.92243 WP_001271546.1.92268 WP_001271546.1.92270 WP_001271546.1.92299 WP_001271546.1.92310 WP_001271546.1.92318 WP_001271546.1.92327 WP_001271546.1.92375 WP_001271546.1.92394 WP_001271546.1.92399 WP_001271546.1.92408 WP_001271546.1.92411 WP_001271546.1.92439 WP_001271546.1.92443 WP_001271546.1.92452 WP_001271546.1.92470 WP_001271546.1.92477 WP_001271546.1.92482 WP_001271546.1.92529 WP_001271546.1.9253 WP_001271546.1.92531 WP_001271546.1.92545 WP_001271546.1.92557 WP_001271546.1.92562 WP_001271546.1.92570 WP_001271546.1.92575 WP_001271546.1.92588 WP_001271546.1.926 WP_001271546.1.92628 WP_001271546.1.92633 WP_001271546.1.92646 WP_001271546.1.92649 WP_001271546.1.92659 WP_001271546.1.92669 WP_001271546.1.92671 WP_001271546.1.92676 WP_001271546.1.92705 WP_001271546.1.9271 WP_001271546.1.92729 WP_001271546.1.92734 WP_001271546.1.92738 WP_001271546.1.92754 WP_001271546.1.92758 WP_001271546.1.9276 WP_001271546.1.92786 WP_001271546.1.92806 WP_001271546.1.92810 WP_001271546.1.92823 WP_001271546.1.92827 WP_001271546.1.92832 WP_001271546.1.92836 WP_001271546.1.92842 WP_001271546.1.92843 WP_001271546.1.92875 WP_001271546.1.92879 WP_001271546.1.92883 WP_001271546.1.92890 WP_001271546.1.92893 WP_001271546.1.92895 WP_001271546.1.92926 WP_001271546.1.92929 WP_001271546.1.92936 WP_001271546.1.92939 WP_001271546.1.92947 WP_001271546.1.92975 WP_001271546.1.92987 WP_001271546.1.92988 WP_001271546.1.93007 WP_001271546.1.93022 WP_001271546.1.93059 WP_001271546.1.93061 WP_001271546.1.93076 WP_001271546.1.93086 WP_001271546.1.93101 WP_001271546.1.93103 WP_001271546.1.93105 WP_001271546.1.93111 WP_001271546.1.93118 WP_001271546.1.93121 WP_001271546.1.93136 WP_001271546.1.93155 WP_001271546.1.93168 WP_001271546.1.93184 WP_001271546.1.93213 WP_001271546.1.93215 WP_001271546.1.93221 WP_001271546.1.93223 WP_001271546.1.93239 WP_001271546.1.93275 WP_001271546.1.93302 WP_001271546.1.93322 WP_001271546.1.93339 WP_001271546.1.93350 WP_001271546.1.9336 WP_001271546.1.93365 WP_001271546.1.93376 WP_001271546.1.93387 WP_001271546.1.93410 WP_001271546.1.93469 WP_001271546.1.93511 WP_001271546.1.93512 WP_001271546.1.93524 WP_001271546.1.93543 WP_001271546.1.93577 WP_001271546.1.93596 WP_001271546.1.93604 WP_001271546.1.93635 WP_001271546.1.93648 WP_001271546.1.93650 WP_001271546.1.93656 WP_001271546.1.93657 WP_001271546.1.93662 WP_001271546.1.93671 WP_001271546.1.93691 WP_001271546.1.937 WP_001271546.1.93705 WP_001271546.1.9374 WP_001271546.1.93741 WP_001271546.1.9375 WP_001271546.1.93754 WP_001271546.1.93761 WP_001271546.1.93767 WP_001271546.1.93780 WP_001271546.1.9380 WP_001271546.1.93803 WP_001271546.1.93804 WP_001271546.1.93809 WP_001271546.1.93828 WP_001271546.1.93837 WP_001271546.1.93842 WP_001271546.1.93843 WP_001271546.1.93875 WP_001271546.1.9389 WP_001271546.1.93909 WP_001271546.1.93919 WP_001271546.1.93937 WP_001271546.1.93938 WP_001271546.1.93956 WP_001271546.1.93984 WP_001271546.1.93986 WP_001271546.1.9399 WP_001271546.1.93994 WP_001271546.1.94017 WP_001271546.1.94039 WP_001271546.1.94056 WP_001271546.1.94064 WP_001271546.1.94070 WP_001271546.1.94071 WP_001271546.1.94072 WP_001271546.1.94079 WP_001271546.1.94097 WP_001271546.1.94107 WP_001271546.1.94132 WP_001271546.1.94142 WP_001271546.1.94162 WP_001271546.1.94167 WP_001271546.1.94168 WP_001271546.1.94181 WP_001271546.1.94198 WP_001271546.1.94215 WP_001271546.1.94303 WP_001271546.1.9432 WP_001271546.1.94352 WP_001271546.1.94354 WP_001271546.1.94365 WP_001271546.1.94379 WP_001271546.1.94380 WP_001271546.1.94383 WP_001271546.1.94390 WP_001271546.1.9440 WP_001271546.1.94412 WP_001271546.1.94415 WP_001271546.1.94458 WP_001271546.1.94461 WP_001271546.1.94473 WP_001271546.1.94492 WP_001271546.1.94510 WP_001271546.1.94527 WP_001271546.1.94557 WP_001271546.1.94562 WP_001271546.1.94565 WP_001271546.1.94573 WP_001271546.1.94579 WP_001271546.1.94584 WP_001271546.1.94586 WP_001271546.1.94588 WP_001271546.1.94593 WP_001271546.1.94598 WP_001271546.1.94622 WP_001271546.1.9463 WP_001271546.1.94649 WP_001271546.1.94650 WP_001271546.1.94655 WP_001271546.1.94659 WP_001271546.1.94662 WP_001271546.1.94669 WP_001271546.1.94670 WP_001271546.1.94674 WP_001271546.1.94700 WP_001271546.1.94717 WP_001271546.1.94722 WP_001271546.1.94745 WP_001271546.1.94782 WP_001271546.1.94785 WP_001271546.1.94796 WP_001271546.1.94798 WP_001271546.1.9481 WP_001271546.1.94815 WP_001271546.1.94817 WP_001271546.1.94820 WP_001271546.1.94835 WP_001271546.1.94849 WP_001271546.1.94850 WP_001271546.1.94851 WP_001271546.1.94862 WP_001271546.1.94864 WP_001271546.1.94947 WP_001271546.1.94952 WP_001271546.1.94959 WP_001271546.1.94967 WP_001271546.1.94971 WP_001271546.1.94982 WP_001271546.1.94983 WP_001271546.1.94986 WP_001271546.1.95006 WP_001271546.1.9503 WP_001271546.1.95051 WP_001271546.1.95055 WP_001271546.1.95076 WP_001271546.1.95085 WP_001271546.1.95094 WP_001271546.1.95099 WP_001271546.1.95121 WP_001271546.1.95133 WP_001271546.1.95136 WP_001271546.1.95152 WP_001271546.1.9516 WP_001271546.1.95165 WP_001271546.1.95171 WP_001271546.1.95235 WP_001271546.1.95239 WP_001271546.1.95246 WP_001271546.1.95248 WP_001271546.1.95249 WP_001271546.1.9525 WP_001271546.1.95255 WP_001271546.1.95265 WP_001271546.1.9527 WP_001271546.1.95277 WP_001271546.1.95282 WP_001271546.1.95289 WP_001271546.1.95298 WP_001271546.1.9530 WP_001271546.1.95320 WP_001271546.1.95338 WP_001271546.1.95388 WP_001271546.1.95404 WP_001271546.1.95412 WP_001271546.1.95434 WP_001271546.1.95447 WP_001271546.1.95456 WP_001271546.1.95465 WP_001271546.1.95530 WP_001271546.1.95546 WP_001271546.1.95547 WP_001271546.1.95558 WP_001271546.1.95579 WP_001271546.1.95590 WP_001271546.1.95607 WP_001271546.1.95623 WP_001271546.1.95625 WP_001271546.1.95630 WP_001271546.1.95641 WP_001271546.1.95656 WP_001271546.1.95670 WP_001271546.1.95675 WP_001271546.1.95691 WP_001271546.1.95701 WP_001271546.1.95703 WP_001271546.1.95716 WP_001271546.1.95729 WP_001271546.1.9574 WP_001271546.1.95744 WP_001271546.1.95757 WP_001271546.1.95776 WP_001271546.1.95803 WP_001271546.1.95805 WP_001271546.1.95826 WP_001271546.1.95840 WP_001271546.1.9586 WP_001271546.1.95866 WP_001271546.1.95884 WP_001271546.1.95890 WP_001271546.1.95901 WP_001271546.1.95906 WP_001271546.1.95911 WP_001271546.1.95939 WP_001271546.1.95940 WP_001271546.1.95963 WP_001271546.1.96004 WP_001271546.1.96025 WP_001271546.1.96042 WP_001271546.1.96044 WP_001271546.1.96045 WP_001271546.1.96054 WP_001271546.1.9609 WP_001271546.1.96094 WP_001271546.1.96107 WP_001271546.1.96127 WP_001271546.1.96139 WP_001271546.1.96141 WP_001271546.1.96144 WP_001271546.1.96162 WP_001271546.1.96172 WP_001271546.1.96188 WP_001271546.1.96190 WP_001271546.1.96203 WP_001271546.1.96206 WP_001271546.1.96211 WP_001271546.1.96212 WP_001271546.1.9624 WP_001271546.1.96260 WP_001271546.1.9627 WP_001271546.1.96317 WP_001271546.1.96319 WP_001271546.1.9633 WP_001271546.1.96335 WP_001271546.1.96340 WP_001271546.1.96343 WP_001271546.1.96348 WP_001271546.1.96349 WP_001271546.1.96359 WP_001271546.1.96380 WP_001271546.1.96404 WP_001271546.1.96429 WP_001271546.1.9644 WP_001271546.1.96469 WP_001271546.1.96490 WP_001271546.1.96497 WP_001271546.1.96500 WP_001271546.1.96521 WP_001271546.1.96533 WP_001271546.1.96537 WP_001271546.1.96539 WP_001271546.1.96552 WP_001271546.1.96555 WP_001271546.1.96563 WP_001271546.1.96584 WP_001271546.1.96588 WP_001271546.1.96590 WP_001271546.1.96600 WP_001271546.1.96610 WP_001271546.1.96625 WP_001271546.1.96635 WP_001271546.1.9664 WP_001271546.1.96640 WP_001271546.1.96642 WP_001271546.1.96662 WP_001271546.1.96675 WP_001271546.1.9670 WP_001271546.1.96721 WP_001271546.1.96731 WP_001271546.1.96732 WP_001271546.1.96735 WP_001271546.1.9674 WP_001271546.1.96750 WP_001271546.1.96758 WP_001271546.1.96761 WP_001271546.1.96771 WP_001271546.1.96792 WP_001271546.1.96798 WP_001271546.1.96801 WP_001271546.1.96803 WP_001271546.1.96810 WP_001271546.1.9686 WP_001271546.1.96876 WP_001271546.1.96890 WP_001271546.1.96902 WP_001271546.1.96917 WP_001271546.1.96925 WP_001271546.1.96938 WP_001271546.1.96946 WP_001271546.1.96957 WP_001271546.1.96978 WP_001271546.1.96993 WP_001271546.1.97005 WP_001271546.1.97015 WP_001271546.1.97026 WP_001271546.1.97028 WP_001271546.1.97043 WP_001271546.1.97047 WP_001271546.1.97079 WP_001271546.1.97089 WP_001271546.1.97103 WP_001271546.1.97109 WP_001271546.1.97143 WP_001271546.1.97145 WP_001271546.1.97184 WP_001271546.1.97185 WP_001271546.1.97190 WP_001271546.1.97224 WP_001271546.1.97260 WP_001271546.1.97287 WP_001271546.1.97291 WP_001271546.1.97297 WP_001271546.1.97318 WP_001271546.1.97322 WP_001271546.1.97328 WP_001271546.1.97337 WP_001271546.1.97368 WP_001271546.1.97369 WP_001271546.1.97386 WP_001271546.1.97413 WP_001271546.1.97422 WP_001271546.1.97441 WP_001271546.1.97477 WP_001271546.1.97480 WP_001271546.1.97487 WP_001271546.1.97496 WP_001271546.1.97497 WP_001271546.1.97505 WP_001271546.1.97547 WP_001271546.1.97594 WP_001271546.1.97597 WP_001271546.1.97599 WP_001271546.1.97606 WP_001271546.1.97613 WP_001271546.1.97615 WP_001271546.1.97620 WP_001271546.1.97626 WP_001271546.1.97628 WP_001271546.1.97631 WP_001271546.1.97640 WP_001271546.1.97646 WP_001271546.1.97648 WP_001271546.1.97656 WP_001271546.1.97690 WP_001271546.1.97691 WP_001271546.1.97693 WP_001271546.1.97704 WP_001271546.1.97725 WP_001271546.1.97726 WP_001271546.1.97727 WP_001271546.1.97732 WP_001271546.1.97736 WP_001271546.1.9774 WP_001271546.1.9775 WP_001271546.1.97768 WP_001271546.1.97772 WP_001271546.1.97800 WP_001271546.1.97819 WP_001271546.1.97840 WP_001271546.1.97846 WP_001271546.1.97873 WP_001271546.1.97907 WP_001271546.1.9793 WP_001271546.1.97938 WP_001271546.1.97981 WP_001271546.1.97983 WP_001271546.1.97986 WP_001271546.1.9799 WP_001271546.1.97991 WP_001271546.1.98006 WP_001271546.1.98019 WP_001271546.1.98022 WP_001271546.1.98036 WP_001271546.1.9805 WP_001271546.1.98080 WP_001271546.1.98086 WP_001271546.1.98107 WP_001271546.1.9811 WP_001271546.1.98110 WP_001271546.1.98119 WP_001271546.1.98124 WP_001271546.1.98146 WP_001271546.1.98158 WP_001271546.1.98170 WP_001271546.1.98201 WP_001271546.1.98219 WP_001271546.1.98236 WP_001271546.1.98250 WP_001271546.1.9826 WP_001271546.1.98263 WP_001271546.1.98266 WP_001271546.1.98314 WP_001271546.1.98338 WP_001271546.1.98392 WP_001271546.1.98402 WP_001271546.1.98403 WP_001271546.1.9841 WP_001271546.1.98418 WP_001271546.1.98438 WP_001271546.1.98440 WP_001271546.1.98446 WP_001271546.1.98448 WP_001271546.1.98457 WP_001271546.1.98472 WP_001271546.1.98495 WP_001271546.1.9850 WP_001271546.1.98502 WP_001271546.1.98513 WP_001271546.1.98531 WP_001271546.1.98551 WP_001271546.1.98558 WP_001271546.1.98570 WP_001271546.1.98577 WP_001271546.1.98607 WP_001271546.1.98608 WP_001271546.1.98627 WP_001271546.1.9863 WP_001271546.1.98676 WP_001271546.1.98677 WP_001271546.1.98726 WP_001271546.1.98731 WP_001271546.1.98751 WP_001271546.1.98760 WP_001271546.1.98762 WP_001271546.1.98763 WP_001271546.1.9877 WP_001271546.1.98779 WP_001271546.1.98801 WP_001271546.1.98818 WP_001271546.1.98843 WP_001271546.1.9887 WP_001271546.1.98899 WP_001271546.1.98931 WP_001271546.1.98947 WP_001271546.1.9898 WP_001271546.1.9899 WP_001271546.1.99040 WP_001271546.1.99057 WP_001271546.1.99071 WP_001271546.1.99072 WP_001271546.1.99073 WP_001271546.1.99083 WP_001271546.1.99097 WP_001271546.1.99098 WP_001271546.1.99107 WP_001271546.1.99163 WP_001271546.1.99164 WP_001271546.1.99184 WP_001271546.1.9919 WP_001271546.1.99197 WP_001271546.1.99198 WP_001271546.1.99215 WP_001271546.1.99219 WP_001271546.1.99255 WP_001271546.1.99267 WP_001271546.1.99276 WP_001271546.1.99278 WP_001271546.1.99327 WP_001271546.1.99335 WP_001271546.1.99339 WP_001271546.1.99350 WP_001271546.1.99360 WP_001271546.1.99363 WP_001271546.1.99369 WP_001271546.1.99370 WP_001271546.1.99388 WP_001271546.1.99397 WP_001271546.1.99426 WP_001271546.1.99456 WP_001271546.1.99463 WP_001271546.1.99469 WP_001271546.1.99483 WP_001271546.1.99490 WP_001271546.1.99493 WP_001271546.1.99531 WP_001271546.1.9954 WP_001271546.1.99546 WP_001271546.1.99561 WP_001271546.1.99577 WP_001271546.1.99579 WP_001271546.1.99595 WP_001271546.1.99613 WP_001271546.1.99626 WP_001271546.1.99630 WP_001271546.1.99637 WP_001271546.1.99646 WP_001271546.1.99657 WP_001271546.1.99660 WP_001271546.1.99671 WP_001271546.1.99676 WP_001271546.1.99712 WP_001271546.1.99725 WP_001271546.1.99764 WP_001271546.1.99783 WP_001271546.1.99813 WP_001271546.1.99824 WP_001271546.1.99829 WP_001271546.1.99837 WP_001271546.1.99841 WP_001271546.1.99858 WP_001271546.1.99889 WP_001271546.1.9992 WP_001271546.1.99924 WP_001271546.1.99958 WP_001271546.1.99961 WP_001271546.1.99996 gi|386589673|ref|YP_006086073.1| gi|378957901|ref|YP_005215388.1| gi|194451819|ref|YP_002048396.1| gi|161505144|ref|YP_001572256.1| gi|378447666|ref|YP_005235298.1| gi|197365070|ref|YP_002144707.1| gi|409248046|ref|YP_006888738.1| gi|207859499|ref|YP_002246150.1| gi|525828109|ref|YP_008250884.1| gi|16767599|ref|NP_463214.1| gi|525839715|ref|YP_008257064.1| gi|538364932|ref|YP_008508217.1| gi|378987022|ref|YP_005250178.1| APC24179 gi|525856246|ref|YP_008258985.1| ABAK02000001|CDS_3909476-3910021 ABAM02000001|CDS_240291-240836 ABAN01000038|CDS_1613-1068 ABAO01000048|CDS_1548-1003 ABEH02000001|CDS_185449-185994 ABEI01000006|CDS_204003-204548 ABEJ01000008|CDS_166894-167439 ABEL01000020|CDS_14325-13780 ABEW01000009|CDS_196004-196549 ABFF01000021|CDS_37539-36994 ABFG01000009|CDS_38488-37943 ABFH02000001|CDS_547469-546924 AE006468|CDS_4594797-4595342 AE014613|CDS_4554281-4554826 AE017220|CDS_4529497-4530042 AL513382|CDS_4571379-4571924 AM933172|CDS_4450091-4450636 CP000026|CDS_4344625-4345170 CP000880|CDS_3178870-3178325 CP000886|CDS_4608566-4609111 CP001113|CDS_4594213-4594758 CP001120|CDS_4648734-4649279 CP001127|CDS_4494312-4494857 CP001138|CDS_4527579-4528124 CP001144|CDS_4607310-4607855 CP001363|CDS_4607628-4608173 FM200053|CDS_4340312-4340857 FN424405|CDS_4616785-4617330 NZ_ACBF01000003|CDS_8531-9076 209261.t4402 220341.STY4710 272994.SPAB_05483 295319.SPA4167 321314.SC4229 41514.SARI_03281 423368.SNSL254_A4711 439843.SeSA_A4619 439851.SeD_A4747 454166.SeAg_B4628 454169.SeHA_C4768 550537.SEN4120 554290.SSPA3870 99287.STM4350 gi|29144651|ref|NP_807993.1| gi|452121914|ref|YP_007472162.1| gi|537439470|ref|YP_008483847.1| gi|549481478|ref|YP_008615946.1| gi|198244671|ref|YP_002218237.1| gi|525948705|ref|YP_008310398.1| gi|525815638|ref|YP_008245656.1| gi|56416144|ref|YP_153219.1| gi|549726864|ref|YP_008647054.1| gi|161617623|ref|YP_001591588.1| gi|378453305|ref|YP_005240665.1| gi|197248139|ref|YP_002149267.1| gi|378702193|ref|YP_005184151.1| gi|16763172|ref|NP_458789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]