SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453375|ref|YP_005240735.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453375|ref|YP_005240735.1|
Domain Number 1 Region: 95-308
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.3e-47
Family MurCDEF 0.00085
Further Details:      
 
Domain Number 2 Region: 312-447
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.92e-37
Family MurCDEF C-terminal domain 0.0076
Further Details:      
 
Domain Number 3 Region: 1-90
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 6.02e-24
Family MurCD N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378453375|ref|YP_005240735.1|
Sequence length 459
Comment UDP-N-acetylmuramate/L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLEKQGIDLIQGYDASQLDP
QPDLVIIGNAMTRGNPCVEAVLEKNIPFMSGPQWLHDFVLRDRWVLAVAGTHGKTTTAGM
ATWILEACGYKPGFVIGGVPGNFEVSARLGESPFFVIEADEYDCAFFDKRSKFVHYCPRT
LILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIIWPENDINLKQTMALGCWSEQEL
VGEQGHWQAKKLTTDASEWEVWLDGEKVGDVKWGLVGEHNMHNGLMAIAAARHVGVAPAE
AASALGSFINARRRLELRGEANGVTVYDDFAHHPTAILATLAALRGKVGGTARIIAVLEP
RSNTMKMGLCKDDLAPSLGRADEVFLLQPPHIPWQVAEVAEACVQPAHWSGDVDTLAEMV
VKTAQPGDHILVMSNGGFGGIHQKLLDGLAKKAQNVTAY
Download sequence
Identical sequences A0A0D6HQB4 A0A0F6BAT7 A0A0F7JFX2 A0A0H3NPP5 A0A0U1JB91 A0A0W4Q140 A0A1C2ZWQ9 A0A249V3B9 A0A2D1XIJ9 A0A2D1XWS7 A0A2D3AJX6 A0A2H9YK24 A0A2I6MD82 A0A2I6NVZ3 B5F3E3 E8XBG9 Q8ZK66 S5HGE4 V7IPV0
gi|378991680|ref|YP_005254844.1| 454166.SeAg_B4696 99287.STM4416 gi|563655703|ref|YP_008863807.1| gi|378453375|ref|YP_005240735.1| gi|378447727|ref|YP_005235359.1| NP_463277.1.58477 WP_001219833.1.100007 WP_001219833.1.100031 WP_001219833.1.100115 WP_001219833.1.10013 WP_001219833.1.100234 WP_001219833.1.100258 WP_001219833.1.100266 WP_001219833.1.100376 WP_001219833.1.100424 WP_001219833.1.100436 WP_001219833.1.100438 WP_001219833.1.100484 WP_001219833.1.100488 WP_001219833.1.100584 WP_001219833.1.100597 WP_001219833.1.100707 WP_001219833.1.100714 WP_001219833.1.100721 WP_001219833.1.100750 WP_001219833.1.10076 WP_001219833.1.100773 WP_001219833.1.100781 WP_001219833.1.100790 WP_001219833.1.100793 WP_001219833.1.100865 WP_001219833.1.100869 WP_001219833.1.100870 WP_001219833.1.100871 WP_001219833.1.100882 WP_001219833.1.100932 WP_001219833.1.101007 WP_001219833.1.101020 WP_001219833.1.101074 WP_001219833.1.101078 WP_001219833.1.101180 WP_001219833.1.101185 WP_001219833.1.101199 WP_001219833.1.101259 WP_001219833.1.101284 WP_001219833.1.101291 WP_001219833.1.101320 WP_001219833.1.101353 WP_001219833.1.101386 WP_001219833.1.101404 WP_001219833.1.101425 WP_001219833.1.101589 WP_001219833.1.101707 WP_001219833.1.101734 WP_001219833.1.101759 WP_001219833.1.101776 WP_001219833.1.101815 WP_001219833.1.101878 WP_001219833.1.101953 WP_001219833.1.102009 WP_001219833.1.10220 WP_001219833.1.10266 WP_001219833.1.10293 WP_001219833.1.10394 WP_001219833.1.10429 WP_001219833.1.10439 WP_001219833.1.10507 WP_001219833.1.10562 WP_001219833.1.10678 WP_001219833.1.10753 WP_001219833.1.10797 WP_001219833.1.10992 WP_001219833.1.11000 WP_001219833.1.11024 WP_001219833.1.11031 WP_001219833.1.11098 WP_001219833.1.11168 WP_001219833.1.11190 WP_001219833.1.11295 WP_001219833.1.11304 WP_001219833.1.11369 WP_001219833.1.1137 WP_001219833.1.11455 WP_001219833.1.11479 WP_001219833.1.11518 WP_001219833.1.11532 WP_001219833.1.11543 WP_001219833.1.11603 WP_001219833.1.11621 WP_001219833.1.11763 WP_001219833.1.11772 WP_001219833.1.11897 WP_001219833.1.11936 WP_001219833.1.12007 WP_001219833.1.12025 WP_001219833.1.12047 WP_001219833.1.12059 WP_001219833.1.12063 WP_001219833.1.12114 WP_001219833.1.12244 WP_001219833.1.12282 WP_001219833.1.12370 WP_001219833.1.12484 WP_001219833.1.12546 WP_001219833.1.12584 WP_001219833.1.1264 WP_001219833.1.12650 WP_001219833.1.12718 WP_001219833.1.12728 WP_001219833.1.12879 WP_001219833.1.12936 WP_001219833.1.12995 WP_001219833.1.13027 WP_001219833.1.13106 WP_001219833.1.13130 WP_001219833.1.13334 WP_001219833.1.13414 WP_001219833.1.13488 WP_001219833.1.13509 WP_001219833.1.13528 WP_001219833.1.13669 WP_001219833.1.13677 WP_001219833.1.13741 WP_001219833.1.13799 WP_001219833.1.13829 WP_001219833.1.13908 WP_001219833.1.13932 WP_001219833.1.13968 WP_001219833.1.14001 WP_001219833.1.14151 WP_001219833.1.14239 WP_001219833.1.14286 WP_001219833.1.14320 WP_001219833.1.14379 WP_001219833.1.14406 WP_001219833.1.14410 WP_001219833.1.14446 WP_001219833.1.14516 WP_001219833.1.14524 WP_001219833.1.14528 WP_001219833.1.14554 WP_001219833.1.14688 WP_001219833.1.14725 WP_001219833.1.14808 WP_001219833.1.14852 WP_001219833.1.1489 WP_001219833.1.14932 WP_001219833.1.15055 WP_001219833.1.15100 WP_001219833.1.15223 WP_001219833.1.15226 WP_001219833.1.15316 WP_001219833.1.1540 WP_001219833.1.15479 WP_001219833.1.15508 WP_001219833.1.15586 WP_001219833.1.15612 WP_001219833.1.15784 WP_001219833.1.15830 WP_001219833.1.1592 WP_001219833.1.15978 WP_001219833.1.16032 WP_001219833.1.16052 WP_001219833.1.16062 WP_001219833.1.16063 WP_001219833.1.16103 WP_001219833.1.1611 WP_001219833.1.16158 WP_001219833.1.16226 WP_001219833.1.16233 WP_001219833.1.16273 WP_001219833.1.16284 WP_001219833.1.1635 WP_001219833.1.16468 WP_001219833.1.16565 WP_001219833.1.16581 WP_001219833.1.16614 WP_001219833.1.16650 WP_001219833.1.1668 WP_001219833.1.16691 WP_001219833.1.167 WP_001219833.1.16732 WP_001219833.1.16735 WP_001219833.1.16786 WP_001219833.1.16819 WP_001219833.1.16826 WP_001219833.1.16858 WP_001219833.1.16896 WP_001219833.1.16916 WP_001219833.1.16942 WP_001219833.1.16965 WP_001219833.1.1700 WP_001219833.1.17031 WP_001219833.1.17188 WP_001219833.1.17307 WP_001219833.1.17390 WP_001219833.1.174 WP_001219833.1.17480 WP_001219833.1.17546 WP_001219833.1.17629 WP_001219833.1.17702 WP_001219833.1.17703 WP_001219833.1.17705 WP_001219833.1.17747 WP_001219833.1.17919 WP_001219833.1.17949 WP_001219833.1.18019 WP_001219833.1.18089 WP_001219833.1.18111 WP_001219833.1.18163 WP_001219833.1.18177 WP_001219833.1.18192 WP_001219833.1.18267 WP_001219833.1.18282 WP_001219833.1.18365 WP_001219833.1.18426 WP_001219833.1.18445 WP_001219833.1.18468 WP_001219833.1.18607 WP_001219833.1.18705 WP_001219833.1.18715 WP_001219833.1.18776 WP_001219833.1.18822 WP_001219833.1.18881 WP_001219833.1.18919 WP_001219833.1.18940 WP_001219833.1.18949 WP_001219833.1.19030 WP_001219833.1.19038 WP_001219833.1.19053 WP_001219833.1.19240 WP_001219833.1.19320 WP_001219833.1.19340 WP_001219833.1.19357 WP_001219833.1.1939 WP_001219833.1.19458 WP_001219833.1.19461 WP_001219833.1.19469 WP_001219833.1.1954 WP_001219833.1.19614 WP_001219833.1.19642 WP_001219833.1.19683 WP_001219833.1.19702 WP_001219833.1.19706 WP_001219833.1.19724 WP_001219833.1.19749 WP_001219833.1.19784 WP_001219833.1.19802 WP_001219833.1.19809 WP_001219833.1.19867 WP_001219833.1.19884 WP_001219833.1.1998 WP_001219833.1.19987 WP_001219833.1.20023 WP_001219833.1.20034 WP_001219833.1.20081 WP_001219833.1.2010 WP_001219833.1.20212 WP_001219833.1.20266 WP_001219833.1.20271 WP_001219833.1.20330 WP_001219833.1.20362 WP_001219833.1.20418 WP_001219833.1.20443 WP_001219833.1.20525 WP_001219833.1.2054 WP_001219833.1.20553 WP_001219833.1.20626 WP_001219833.1.20646 WP_001219833.1.20700 WP_001219833.1.20721 WP_001219833.1.20760 WP_001219833.1.20789 WP_001219833.1.20795 WP_001219833.1.20886 WP_001219833.1.20908 WP_001219833.1.21049 WP_001219833.1.21075 WP_001219833.1.21089 WP_001219833.1.21146 WP_001219833.1.21245 WP_001219833.1.21246 WP_001219833.1.21269 WP_001219833.1.21400 WP_001219833.1.21404 WP_001219833.1.21497 WP_001219833.1.21499 WP_001219833.1.21548 WP_001219833.1.21603 WP_001219833.1.21692 WP_001219833.1.21730 WP_001219833.1.21751 WP_001219833.1.21757 WP_001219833.1.21877 WP_001219833.1.21981 WP_001219833.1.22024 WP_001219833.1.22030 WP_001219833.1.2205 WP_001219833.1.22062 WP_001219833.1.22067 WP_001219833.1.22069 WP_001219833.1.2221 WP_001219833.1.2224 WP_001219833.1.2235 WP_001219833.1.22379 WP_001219833.1.22427 WP_001219833.1.2246 WP_001219833.1.22485 WP_001219833.1.22537 WP_001219833.1.22620 WP_001219833.1.22623 WP_001219833.1.22676 WP_001219833.1.2283 WP_001219833.1.22870 WP_001219833.1.22979 WP_001219833.1.23053 WP_001219833.1.23080 WP_001219833.1.23102 WP_001219833.1.23114 WP_001219833.1.2314 WP_001219833.1.23148 WP_001219833.1.23192 WP_001219833.1.23258 WP_001219833.1.23259 WP_001219833.1.23274 WP_001219833.1.23309 WP_001219833.1.23444 WP_001219833.1.23460 WP_001219833.1.23466 WP_001219833.1.23472 WP_001219833.1.23634 WP_001219833.1.2364 WP_001219833.1.23643 WP_001219833.1.23670 WP_001219833.1.23675 WP_001219833.1.23685 WP_001219833.1.23819 WP_001219833.1.23932 WP_001219833.1.24017 WP_001219833.1.24206 WP_001219833.1.24259 WP_001219833.1.24308 WP_001219833.1.24325 WP_001219833.1.24376 WP_001219833.1.24444 WP_001219833.1.24450 WP_001219833.1.24555 WP_001219833.1.24696 WP_001219833.1.24737 WP_001219833.1.24779 WP_001219833.1.24837 WP_001219833.1.25008 WP_001219833.1.25015 WP_001219833.1.25072 WP_001219833.1.25205 WP_001219833.1.25206 WP_001219833.1.25229 WP_001219833.1.25454 WP_001219833.1.25493 WP_001219833.1.25514 WP_001219833.1.25546 WP_001219833.1.25668 WP_001219833.1.25690 WP_001219833.1.2570 WP_001219833.1.25703 WP_001219833.1.25740 WP_001219833.1.25793 WP_001219833.1.25809 WP_001219833.1.25814 WP_001219833.1.25825 WP_001219833.1.25932 WP_001219833.1.25988 WP_001219833.1.26030 WP_001219833.1.26213 WP_001219833.1.26282 WP_001219833.1.26311 WP_001219833.1.2634 WP_001219833.1.26384 WP_001219833.1.26429 WP_001219833.1.26440 WP_001219833.1.26493 WP_001219833.1.26551 WP_001219833.1.26567 WP_001219833.1.2660 WP_001219833.1.26787 WP_001219833.1.26883 WP_001219833.1.27010 WP_001219833.1.27055 WP_001219833.1.27173 WP_001219833.1.27206 WP_001219833.1.2723 WP_001219833.1.27279 WP_001219833.1.27423 WP_001219833.1.27556 WP_001219833.1.27561 WP_001219833.1.2763 WP_001219833.1.27665 WP_001219833.1.27707 WP_001219833.1.27761 WP_001219833.1.27776 WP_001219833.1.27857 WP_001219833.1.27977 WP_001219833.1.28002 WP_001219833.1.28094 WP_001219833.1.28126 WP_001219833.1.28170 WP_001219833.1.28225 WP_001219833.1.28267 WP_001219833.1.28302 WP_001219833.1.2835 WP_001219833.1.28370 WP_001219833.1.28393 WP_001219833.1.28538 WP_001219833.1.28575 WP_001219833.1.28625 WP_001219833.1.28655 WP_001219833.1.28694 WP_001219833.1.287 WP_001219833.1.28775 WP_001219833.1.2879 WP_001219833.1.28811 WP_001219833.1.28830 WP_001219833.1.2890 WP_001219833.1.28902 WP_001219833.1.28938 WP_001219833.1.28946 WP_001219833.1.28977 WP_001219833.1.29006 WP_001219833.1.29010 WP_001219833.1.2910 WP_001219833.1.29130 WP_001219833.1.29265 WP_001219833.1.29588 WP_001219833.1.29601 WP_001219833.1.29606 WP_001219833.1.29615 WP_001219833.1.29619 WP_001219833.1.29704 WP_001219833.1.29732 WP_001219833.1.29775 WP_001219833.1.29969 WP_001219833.1.30006 WP_001219833.1.30018 WP_001219833.1.30027 WP_001219833.1.3017 WP_001219833.1.30180 WP_001219833.1.30331 WP_001219833.1.30437 WP_001219833.1.30469 WP_001219833.1.30505 WP_001219833.1.30507 WP_001219833.1.30535 WP_001219833.1.30547 WP_001219833.1.30573 WP_001219833.1.30602 WP_001219833.1.3066 WP_001219833.1.30696 WP_001219833.1.30794 WP_001219833.1.30803 WP_001219833.1.30833 WP_001219833.1.30835 WP_001219833.1.30934 WP_001219833.1.30972 WP_001219833.1.31 WP_001219833.1.31042 WP_001219833.1.31086 WP_001219833.1.31107 WP_001219833.1.3113 WP_001219833.1.31155 WP_001219833.1.31185 WP_001219833.1.3119 WP_001219833.1.31190 WP_001219833.1.31195 WP_001219833.1.31196 WP_001219833.1.31214 WP_001219833.1.31219 WP_001219833.1.3124 WP_001219833.1.3127 WP_001219833.1.31281 WP_001219833.1.31362 WP_001219833.1.31504 WP_001219833.1.31515 WP_001219833.1.31578 WP_001219833.1.31658 WP_001219833.1.3170 WP_001219833.1.31762 WP_001219833.1.31854 WP_001219833.1.31927 WP_001219833.1.31940 WP_001219833.1.31967 WP_001219833.1.31972 WP_001219833.1.32192 WP_001219833.1.32206 WP_001219833.1.32408 WP_001219833.1.32424 WP_001219833.1.32438 WP_001219833.1.32515 WP_001219833.1.32527 WP_001219833.1.32629 WP_001219833.1.32660 WP_001219833.1.32702 WP_001219833.1.32714 WP_001219833.1.32747 WP_001219833.1.3278 WP_001219833.1.32786 WP_001219833.1.32804 WP_001219833.1.32860 WP_001219833.1.32907 WP_001219833.1.32961 WP_001219833.1.33030 WP_001219833.1.3304 WP_001219833.1.33078 WP_001219833.1.33127 WP_001219833.1.33143 WP_001219833.1.33144 WP_001219833.1.33160 WP_001219833.1.33248 WP_001219833.1.33261 WP_001219833.1.333 WP_001219833.1.33492 WP_001219833.1.33553 WP_001219833.1.33592 WP_001219833.1.33609 WP_001219833.1.33659 WP_001219833.1.33894 WP_001219833.1.34043 WP_001219833.1.34075 WP_001219833.1.34084 WP_001219833.1.34107 WP_001219833.1.34257 WP_001219833.1.34279 WP_001219833.1.34319 WP_001219833.1.34453 WP_001219833.1.34667 WP_001219833.1.34881 WP_001219833.1.34975 WP_001219833.1.34977 WP_001219833.1.35035 WP_001219833.1.35045 WP_001219833.1.35075 WP_001219833.1.35129 WP_001219833.1.35184 WP_001219833.1.35404 WP_001219833.1.35408 WP_001219833.1.3541 WP_001219833.1.35425 WP_001219833.1.35429 WP_001219833.1.35446 WP_001219833.1.35463 WP_001219833.1.35494 WP_001219833.1.35503 WP_001219833.1.35509 WP_001219833.1.35590 WP_001219833.1.35777 WP_001219833.1.35809 WP_001219833.1.35835 WP_001219833.1.35940 WP_001219833.1.35993 WP_001219833.1.36003 WP_001219833.1.3601 WP_001219833.1.3610 WP_001219833.1.36229 WP_001219833.1.36512 WP_001219833.1.36542 WP_001219833.1.36609 WP_001219833.1.36690 WP_001219833.1.3670 WP_001219833.1.36705 WP_001219833.1.3688 WP_001219833.1.36885 WP_001219833.1.36899 WP_001219833.1.36918 WP_001219833.1.36931 WP_001219833.1.37021 WP_001219833.1.37073 WP_001219833.1.37111 WP_001219833.1.37112 WP_001219833.1.37147 WP_001219833.1.37158 WP_001219833.1.37190 WP_001219833.1.37256 WP_001219833.1.3728 WP_001219833.1.37293 WP_001219833.1.37320 WP_001219833.1.37370 WP_001219833.1.37376 WP_001219833.1.3744 WP_001219833.1.37498 WP_001219833.1.37504 WP_001219833.1.37610 WP_001219833.1.37618 WP_001219833.1.37666 WP_001219833.1.37687 WP_001219833.1.37719 WP_001219833.1.37965 WP_001219833.1.37968 WP_001219833.1.37978 WP_001219833.1.38001 WP_001219833.1.38055 WP_001219833.1.38113 WP_001219833.1.38125 WP_001219833.1.38145 WP_001219833.1.3828 WP_001219833.1.383 WP_001219833.1.38393 WP_001219833.1.3848 WP_001219833.1.38609 WP_001219833.1.38613 WP_001219833.1.38673 WP_001219833.1.3869 WP_001219833.1.38693 WP_001219833.1.38740 WP_001219833.1.38773 WP_001219833.1.38797 WP_001219833.1.38882 WP_001219833.1.38898 WP_001219833.1.38913 WP_001219833.1.38995 WP_001219833.1.39003 WP_001219833.1.39082 WP_001219833.1.39136 WP_001219833.1.39197 WP_001219833.1.39229 WP_001219833.1.39311 WP_001219833.1.39385 WP_001219833.1.39405 WP_001219833.1.39420 WP_001219833.1.39449 WP_001219833.1.39503 WP_001219833.1.39512 WP_001219833.1.39553 WP_001219833.1.39556 WP_001219833.1.39629 WP_001219833.1.39763 WP_001219833.1.39862 WP_001219833.1.39921 WP_001219833.1.39923 WP_001219833.1.40017 WP_001219833.1.40072 WP_001219833.1.4011 WP_001219833.1.40205 WP_001219833.1.40208 WP_001219833.1.40240 WP_001219833.1.40257 WP_001219833.1.40292 WP_001219833.1.40305 WP_001219833.1.40311 WP_001219833.1.40395 WP_001219833.1.40465 WP_001219833.1.40492 WP_001219833.1.40508 WP_001219833.1.40583 WP_001219833.1.40710 WP_001219833.1.4075 WP_001219833.1.40788 WP_001219833.1.4087 WP_001219833.1.40877 WP_001219833.1.40910 WP_001219833.1.41017 WP_001219833.1.41048 WP_001219833.1.41050 WP_001219833.1.41086 WP_001219833.1.4109 WP_001219833.1.41091 WP_001219833.1.41226 WP_001219833.1.41265 WP_001219833.1.41279 WP_001219833.1.41308 WP_001219833.1.41554 WP_001219833.1.41591 WP_001219833.1.41593 WP_001219833.1.41628 WP_001219833.1.41662 WP_001219833.1.41708 WP_001219833.1.41761 WP_001219833.1.4184 WP_001219833.1.41859 WP_001219833.1.41862 WP_001219833.1.41931 WP_001219833.1.41979 WP_001219833.1.41985 WP_001219833.1.41994 WP_001219833.1.41998 WP_001219833.1.42009 WP_001219833.1.42104 WP_001219833.1.42238 WP_001219833.1.42276 WP_001219833.1.42320 WP_001219833.1.42328 WP_001219833.1.42342 WP_001219833.1.42422 WP_001219833.1.42453 WP_001219833.1.42491 WP_001219833.1.4257 WP_001219833.1.4276 WP_001219833.1.42864 WP_001219833.1.4288 WP_001219833.1.42957 WP_001219833.1.43018 WP_001219833.1.43041 WP_001219833.1.43244 WP_001219833.1.43272 WP_001219833.1.43299 WP_001219833.1.43312 WP_001219833.1.4332 WP_001219833.1.43351 WP_001219833.1.43437 WP_001219833.1.43522 WP_001219833.1.43613 WP_001219833.1.43668 WP_001219833.1.43828 WP_001219833.1.43864 WP_001219833.1.43873 WP_001219833.1.43886 WP_001219833.1.44005 WP_001219833.1.44043 WP_001219833.1.44099 WP_001219833.1.44121 WP_001219833.1.44191 WP_001219833.1.44250 WP_001219833.1.44291 WP_001219833.1.44310 WP_001219833.1.44359 WP_001219833.1.44380 WP_001219833.1.44386 WP_001219833.1.4440 WP_001219833.1.44453 WP_001219833.1.44479 WP_001219833.1.44593 WP_001219833.1.44636 WP_001219833.1.44640 WP_001219833.1.4467 WP_001219833.1.44702 WP_001219833.1.44747 WP_001219833.1.4485 WP_001219833.1.44877 WP_001219833.1.44927 WP_001219833.1.44971 WP_001219833.1.44996 WP_001219833.1.45027 WP_001219833.1.45038 WP_001219833.1.45067 WP_001219833.1.45074 WP_001219833.1.45079 WP_001219833.1.45098 WP_001219833.1.45134 WP_001219833.1.45154 WP_001219833.1.45177 WP_001219833.1.45184 WP_001219833.1.45251 WP_001219833.1.45259 WP_001219833.1.45268 WP_001219833.1.45344 WP_001219833.1.45349 WP_001219833.1.45365 WP_001219833.1.45522 WP_001219833.1.45535 WP_001219833.1.45550 WP_001219833.1.45585 WP_001219833.1.45690 WP_001219833.1.45797 WP_001219833.1.458 WP_001219833.1.46011 WP_001219833.1.46028 WP_001219833.1.46069 WP_001219833.1.46112 WP_001219833.1.46173 WP_001219833.1.46174 WP_001219833.1.46187 WP_001219833.1.46203 WP_001219833.1.46232 WP_001219833.1.46243 WP_001219833.1.46286 WP_001219833.1.46358 WP_001219833.1.46499 WP_001219833.1.46574 WP_001219833.1.46595 WP_001219833.1.46620 WP_001219833.1.46666 WP_001219833.1.46675 WP_001219833.1.46804 WP_001219833.1.46930 WP_001219833.1.47005 WP_001219833.1.47057 WP_001219833.1.47214 WP_001219833.1.47429 WP_001219833.1.47442 WP_001219833.1.47448 WP_001219833.1.47460 WP_001219833.1.4747 WP_001219833.1.47472 WP_001219833.1.47478 WP_001219833.1.47492 WP_001219833.1.47614 WP_001219833.1.47621 WP_001219833.1.47649 WP_001219833.1.47767 WP_001219833.1.47799 WP_001219833.1.47814 WP_001219833.1.47992 WP_001219833.1.48209 WP_001219833.1.48215 WP_001219833.1.48242 WP_001219833.1.48253 WP_001219833.1.483 WP_001219833.1.48367 WP_001219833.1.48377 WP_001219833.1.4853 WP_001219833.1.48570 WP_001219833.1.48751 WP_001219833.1.48755 WP_001219833.1.48774 WP_001219833.1.48788 WP_001219833.1.48876 WP_001219833.1.48886 WP_001219833.1.48894 WP_001219833.1.48908 WP_001219833.1.48919 WP_001219833.1.48985 WP_001219833.1.49005 WP_001219833.1.49084 WP_001219833.1.49155 WP_001219833.1.49204 WP_001219833.1.49214 WP_001219833.1.49239 WP_001219833.1.49256 WP_001219833.1.49290 WP_001219833.1.49304 WP_001219833.1.49340 WP_001219833.1.49366 WP_001219833.1.49375 WP_001219833.1.49472 WP_001219833.1.49490 WP_001219833.1.49515 WP_001219833.1.49572 WP_001219833.1.49574 WP_001219833.1.49602 WP_001219833.1.49647 WP_001219833.1.49778 WP_001219833.1.4979 WP_001219833.1.49803 WP_001219833.1.49805 WP_001219833.1.49827 WP_001219833.1.49929 WP_001219833.1.50080 WP_001219833.1.50161 WP_001219833.1.50211 WP_001219833.1.50285 WP_001219833.1.50376 WP_001219833.1.50389 WP_001219833.1.50413 WP_001219833.1.50469 WP_001219833.1.50478 WP_001219833.1.50563 WP_001219833.1.50576 WP_001219833.1.50593 WP_001219833.1.50676 WP_001219833.1.50774 WP_001219833.1.50800 WP_001219833.1.50804 WP_001219833.1.50808 WP_001219833.1.50811 WP_001219833.1.5088 WP_001219833.1.50908 WP_001219833.1.50918 WP_001219833.1.50941 WP_001219833.1.51014 WP_001219833.1.51022 WP_001219833.1.5114 WP_001219833.1.51178 WP_001219833.1.51179 WP_001219833.1.51182 WP_001219833.1.51186 WP_001219833.1.5125 WP_001219833.1.51419 WP_001219833.1.51487 WP_001219833.1.51488 WP_001219833.1.51506 WP_001219833.1.51634 WP_001219833.1.51649 WP_001219833.1.51686 WP_001219833.1.51756 WP_001219833.1.51910 WP_001219833.1.51911 WP_001219833.1.51932 WP_001219833.1.51989 WP_001219833.1.52121 WP_001219833.1.52148 WP_001219833.1.52346 WP_001219833.1.52353 WP_001219833.1.52361 WP_001219833.1.52438 WP_001219833.1.52608 WP_001219833.1.52653 WP_001219833.1.52656 WP_001219833.1.52743 WP_001219833.1.52748 WP_001219833.1.52824 WP_001219833.1.52857 WP_001219833.1.52898 WP_001219833.1.52915 WP_001219833.1.52924 WP_001219833.1.5316 WP_001219833.1.53190 WP_001219833.1.53315 WP_001219833.1.53316 WP_001219833.1.53406 WP_001219833.1.53436 WP_001219833.1.53466 WP_001219833.1.53529 WP_001219833.1.53543 WP_001219833.1.53675 WP_001219833.1.53757 WP_001219833.1.53812 WP_001219833.1.53814 WP_001219833.1.5392 WP_001219833.1.53935 WP_001219833.1.54033 WP_001219833.1.54075 WP_001219833.1.5415 WP_001219833.1.54159 WP_001219833.1.54196 WP_001219833.1.54209 WP_001219833.1.54271 WP_001219833.1.54273 WP_001219833.1.54274 WP_001219833.1.54319 WP_001219833.1.54333 WP_001219833.1.54364 WP_001219833.1.54400 WP_001219833.1.54569 WP_001219833.1.54607 WP_001219833.1.54644 WP_001219833.1.54662 WP_001219833.1.54722 WP_001219833.1.54749 WP_001219833.1.54764 WP_001219833.1.54822 WP_001219833.1.55008 WP_001219833.1.55152 WP_001219833.1.55156 WP_001219833.1.55166 WP_001219833.1.55224 WP_001219833.1.5525 WP_001219833.1.55285 WP_001219833.1.55475 WP_001219833.1.55477 WP_001219833.1.55554 WP_001219833.1.55614 WP_001219833.1.55623 WP_001219833.1.55647 WP_001219833.1.55680 WP_001219833.1.55718 WP_001219833.1.55743 WP_001219833.1.55768 WP_001219833.1.55782 WP_001219833.1.55803 WP_001219833.1.55993 WP_001219833.1.56002 WP_001219833.1.56004 WP_001219833.1.56012 WP_001219833.1.56059 WP_001219833.1.56097 WP_001219833.1.56100 WP_001219833.1.56105 WP_001219833.1.56238 WP_001219833.1.56286 WP_001219833.1.56303 WP_001219833.1.56304 WP_001219833.1.56354 WP_001219833.1.56370 WP_001219833.1.56414 WP_001219833.1.56438 WP_001219833.1.56468 WP_001219833.1.56512 WP_001219833.1.56560 WP_001219833.1.56597 WP_001219833.1.56601 WP_001219833.1.56614 WP_001219833.1.56615 WP_001219833.1.56642 WP_001219833.1.56671 WP_001219833.1.56682 WP_001219833.1.56853 WP_001219833.1.56877 WP_001219833.1.56893 WP_001219833.1.57076 WP_001219833.1.57168 WP_001219833.1.57187 WP_001219833.1.57232 WP_001219833.1.57307 WP_001219833.1.57344 WP_001219833.1.57377 WP_001219833.1.57418 WP_001219833.1.57433 WP_001219833.1.57515 WP_001219833.1.57521 WP_001219833.1.57529 WP_001219833.1.5753 WP_001219833.1.57576 WP_001219833.1.57601 WP_001219833.1.57607 WP_001219833.1.57710 WP_001219833.1.57763 WP_001219833.1.57778 WP_001219833.1.57890 WP_001219833.1.57891 WP_001219833.1.57978 WP_001219833.1.5801 WP_001219833.1.58040 WP_001219833.1.58041 WP_001219833.1.58131 WP_001219833.1.58239 WP_001219833.1.58251 WP_001219833.1.58372 WP_001219833.1.58416 WP_001219833.1.58418 WP_001219833.1.5854 WP_001219833.1.58548 WP_001219833.1.5858 WP_001219833.1.58662 WP_001219833.1.58669 WP_001219833.1.58745 WP_001219833.1.58803 WP_001219833.1.58834 WP_001219833.1.5886 WP_001219833.1.58861 WP_001219833.1.59006 WP_001219833.1.59094 WP_001219833.1.59148 WP_001219833.1.59224 WP_001219833.1.5929 WP_001219833.1.59295 WP_001219833.1.59321 WP_001219833.1.59336 WP_001219833.1.59375 WP_001219833.1.59381 WP_001219833.1.59458 WP_001219833.1.59490 WP_001219833.1.59508 WP_001219833.1.59521 WP_001219833.1.5953 WP_001219833.1.59641 WP_001219833.1.59684 WP_001219833.1.59694 WP_001219833.1.59710 WP_001219833.1.59771 WP_001219833.1.5979 WP_001219833.1.59830 WP_001219833.1.59953 WP_001219833.1.59979 WP_001219833.1.60008 WP_001219833.1.60021 WP_001219833.1.60069 WP_001219833.1.60106 WP_001219833.1.60140 WP_001219833.1.60155 WP_001219833.1.60213 WP_001219833.1.60226 WP_001219833.1.60285 WP_001219833.1.60464 WP_001219833.1.60469 WP_001219833.1.60503 WP_001219833.1.60507 WP_001219833.1.60622 WP_001219833.1.60760 WP_001219833.1.60851 WP_001219833.1.60857 WP_001219833.1.60863 WP_001219833.1.60874 WP_001219833.1.60919 WP_001219833.1.60941 WP_001219833.1.61045 WP_001219833.1.61078 WP_001219833.1.61087 WP_001219833.1.61114 WP_001219833.1.6114 WP_001219833.1.61201 WP_001219833.1.61232 WP_001219833.1.6129 WP_001219833.1.61296 WP_001219833.1.61345 WP_001219833.1.61417 WP_001219833.1.61497 WP_001219833.1.61609 WP_001219833.1.6164 WP_001219833.1.61667 WP_001219833.1.61712 WP_001219833.1.61714 WP_001219833.1.61730 WP_001219833.1.61732 WP_001219833.1.61857 WP_001219833.1.61918 WP_001219833.1.61952 WP_001219833.1.62007 WP_001219833.1.62025 WP_001219833.1.62108 WP_001219833.1.62144 WP_001219833.1.62204 WP_001219833.1.62219 WP_001219833.1.62241 WP_001219833.1.62304 WP_001219833.1.62361 WP_001219833.1.62364 WP_001219833.1.62403 WP_001219833.1.62570 WP_001219833.1.62677 WP_001219833.1.62798 WP_001219833.1.62853 WP_001219833.1.62910 WP_001219833.1.62955 WP_001219833.1.63063 WP_001219833.1.63118 WP_001219833.1.63135 WP_001219833.1.63256 WP_001219833.1.63290 WP_001219833.1.63382 WP_001219833.1.63432 WP_001219833.1.63461 WP_001219833.1.63479 WP_001219833.1.63499 WP_001219833.1.63513 WP_001219833.1.63532 WP_001219833.1.63568 WP_001219833.1.63577 WP_001219833.1.63664 WP_001219833.1.63690 WP_001219833.1.63718 WP_001219833.1.6375 WP_001219833.1.63781 WP_001219833.1.63782 WP_001219833.1.63834 WP_001219833.1.63860 WP_001219833.1.63866 WP_001219833.1.63912 WP_001219833.1.63934 WP_001219833.1.63958 WP_001219833.1.63977 WP_001219833.1.64007 WP_001219833.1.64034 WP_001219833.1.64046 WP_001219833.1.6423 WP_001219833.1.64244 WP_001219833.1.64374 WP_001219833.1.64403 WP_001219833.1.6451 WP_001219833.1.64649 WP_001219833.1.64702 WP_001219833.1.64757 WP_001219833.1.64781 WP_001219833.1.64831 WP_001219833.1.6489 WP_001219833.1.64919 WP_001219833.1.64920 WP_001219833.1.64977 WP_001219833.1.65016 WP_001219833.1.65018 WP_001219833.1.65028 WP_001219833.1.65171 WP_001219833.1.65248 WP_001219833.1.6525 WP_001219833.1.6535 WP_001219833.1.65474 WP_001219833.1.65538 WP_001219833.1.65572 WP_001219833.1.65633 WP_001219833.1.6565 WP_001219833.1.65696 WP_001219833.1.6575 WP_001219833.1.65782 WP_001219833.1.6594 WP_001219833.1.66085 WP_001219833.1.66250 WP_001219833.1.66272 WP_001219833.1.6630 WP_001219833.1.66314 WP_001219833.1.66362 WP_001219833.1.6638 WP_001219833.1.6640 WP_001219833.1.66492 WP_001219833.1.66600 WP_001219833.1.66698 WP_001219833.1.66702 WP_001219833.1.66779 WP_001219833.1.6680 WP_001219833.1.66807 WP_001219833.1.66834 WP_001219833.1.66901 WP_001219833.1.66962 WP_001219833.1.67037 WP_001219833.1.67045 WP_001219833.1.67175 WP_001219833.1.67268 WP_001219833.1.67288 WP_001219833.1.67347 WP_001219833.1.67465 WP_001219833.1.67552 WP_001219833.1.67603 WP_001219833.1.67637 WP_001219833.1.67682 WP_001219833.1.67707 WP_001219833.1.67731 WP_001219833.1.67829 WP_001219833.1.6785 WP_001219833.1.67887 WP_001219833.1.67905 WP_001219833.1.67942 WP_001219833.1.67969 WP_001219833.1.67970 WP_001219833.1.68036 WP_001219833.1.68073 WP_001219833.1.68147 WP_001219833.1.68201 WP_001219833.1.68206 WP_001219833.1.6827 WP_001219833.1.68275 WP_001219833.1.6849 WP_001219833.1.685 WP_001219833.1.68532 WP_001219833.1.68547 WP_001219833.1.68655 WP_001219833.1.68656 WP_001219833.1.68778 WP_001219833.1.68787 WP_001219833.1.6879 WP_001219833.1.6883 WP_001219833.1.68894 WP_001219833.1.68928 WP_001219833.1.68975 WP_001219833.1.69006 WP_001219833.1.6905 WP_001219833.1.6907 WP_001219833.1.6913 WP_001219833.1.69146 WP_001219833.1.69255 WP_001219833.1.69296 WP_001219833.1.69397 WP_001219833.1.69554 WP_001219833.1.69564 WP_001219833.1.69588 WP_001219833.1.69636 WP_001219833.1.69644 WP_001219833.1.69696 WP_001219833.1.69704 WP_001219833.1.69790 WP_001219833.1.70087 WP_001219833.1.70169 WP_001219833.1.7021 WP_001219833.1.70241 WP_001219833.1.70248 WP_001219833.1.70269 WP_001219833.1.70289 WP_001219833.1.70321 WP_001219833.1.70327 WP_001219833.1.70447 WP_001219833.1.70485 WP_001219833.1.70488 WP_001219833.1.7055 WP_001219833.1.70580 WP_001219833.1.70643 WP_001219833.1.70683 WP_001219833.1.70733 WP_001219833.1.70761 WP_001219833.1.70797 WP_001219833.1.70869 WP_001219833.1.70883 WP_001219833.1.70899 WP_001219833.1.70922 WP_001219833.1.70948 WP_001219833.1.71007 WP_001219833.1.71010 WP_001219833.1.71069 WP_001219833.1.7110 WP_001219833.1.71116 WP_001219833.1.71120 WP_001219833.1.71146 WP_001219833.1.71150 WP_001219833.1.71165 WP_001219833.1.71188 WP_001219833.1.71202 WP_001219833.1.71243 WP_001219833.1.71268 WP_001219833.1.71306 WP_001219833.1.71337 WP_001219833.1.7134 WP_001219833.1.71378 WP_001219833.1.714 WP_001219833.1.71401 WP_001219833.1.71407 WP_001219833.1.71446 WP_001219833.1.71691 WP_001219833.1.71702 WP_001219833.1.7174 WP_001219833.1.71750 WP_001219833.1.71756 WP_001219833.1.71845 WP_001219833.1.71881 WP_001219833.1.71908 WP_001219833.1.71952 WP_001219833.1.71973 WP_001219833.1.72105 WP_001219833.1.72203 WP_001219833.1.72220 WP_001219833.1.72226 WP_001219833.1.72243 WP_001219833.1.72281 WP_001219833.1.72372 WP_001219833.1.72594 WP_001219833.1.72671 WP_001219833.1.72689 WP_001219833.1.72793 WP_001219833.1.72843 WP_001219833.1.72871 WP_001219833.1.72892 WP_001219833.1.72968 WP_001219833.1.72975 WP_001219833.1.73062 WP_001219833.1.7315 WP_001219833.1.73164 WP_001219833.1.73200 WP_001219833.1.7334 WP_001219833.1.73377 WP_001219833.1.73481 WP_001219833.1.73512 WP_001219833.1.7356 WP_001219833.1.73561 WP_001219833.1.73581 WP_001219833.1.73596 WP_001219833.1.73617 WP_001219833.1.73667 WP_001219833.1.73753 WP_001219833.1.73758 WP_001219833.1.73831 WP_001219833.1.7386 WP_001219833.1.7387 WP_001219833.1.73901 WP_001219833.1.73924 WP_001219833.1.73926 WP_001219833.1.74029 WP_001219833.1.74049 WP_001219833.1.74089 WP_001219833.1.74181 WP_001219833.1.74191 WP_001219833.1.74228 WP_001219833.1.7433 WP_001219833.1.74379 WP_001219833.1.74410 WP_001219833.1.74418 WP_001219833.1.74428 WP_001219833.1.7444 WP_001219833.1.74454 WP_001219833.1.74466 WP_001219833.1.74529 WP_001219833.1.74545 WP_001219833.1.7458 WP_001219833.1.74745 WP_001219833.1.75129 WP_001219833.1.75187 WP_001219833.1.75288 WP_001219833.1.75301 WP_001219833.1.75334 WP_001219833.1.75362 WP_001219833.1.75385 WP_001219833.1.75392 WP_001219833.1.75402 WP_001219833.1.75740 WP_001219833.1.75760 WP_001219833.1.75764 WP_001219833.1.75828 WP_001219833.1.75837 WP_001219833.1.75874 WP_001219833.1.75932 WP_001219833.1.75945 WP_001219833.1.76020 WP_001219833.1.76097 WP_001219833.1.76102 WP_001219833.1.76170 WP_001219833.1.76197 WP_001219833.1.76252 WP_001219833.1.76364 WP_001219833.1.76434 WP_001219833.1.76445 WP_001219833.1.76532 WP_001219833.1.7657 WP_001219833.1.7660 WP_001219833.1.76673 WP_001219833.1.76706 WP_001219833.1.7672 WP_001219833.1.76721 WP_001219833.1.76756 WP_001219833.1.76760 WP_001219833.1.76799 WP_001219833.1.76806 WP_001219833.1.7684 WP_001219833.1.76875 WP_001219833.1.76880 WP_001219833.1.76899 WP_001219833.1.77038 WP_001219833.1.77047 WP_001219833.1.77080 WP_001219833.1.7712 WP_001219833.1.77180 WP_001219833.1.77184 WP_001219833.1.77241 WP_001219833.1.77244 WP_001219833.1.77292 WP_001219833.1.77349 WP_001219833.1.77414 WP_001219833.1.77514 WP_001219833.1.77549 WP_001219833.1.77555 WP_001219833.1.77692 WP_001219833.1.77761 WP_001219833.1.7782 WP_001219833.1.77851 WP_001219833.1.77918 WP_001219833.1.77960 WP_001219833.1.78016 WP_001219833.1.78026 WP_001219833.1.78076 WP_001219833.1.78096 WP_001219833.1.78100 WP_001219833.1.78110 WP_001219833.1.78120 WP_001219833.1.7814 WP_001219833.1.78201 WP_001219833.1.78383 WP_001219833.1.78407 WP_001219833.1.7861 WP_001219833.1.78618 WP_001219833.1.78673 WP_001219833.1.78715 WP_001219833.1.78735 WP_001219833.1.78789 WP_001219833.1.78802 WP_001219833.1.78830 WP_001219833.1.78871 WP_001219833.1.78874 WP_001219833.1.78881 WP_001219833.1.78913 WP_001219833.1.78918 WP_001219833.1.78930 WP_001219833.1.79151 WP_001219833.1.79167 WP_001219833.1.79189 WP_001219833.1.79203 WP_001219833.1.79335 WP_001219833.1.79370 WP_001219833.1.79427 WP_001219833.1.79462 WP_001219833.1.79472 WP_001219833.1.79490 WP_001219833.1.79495 WP_001219833.1.79529 WP_001219833.1.7956 WP_001219833.1.79635 WP_001219833.1.7964 WP_001219833.1.79645 WP_001219833.1.79659 WP_001219833.1.79668 WP_001219833.1.79708 WP_001219833.1.7972 WP_001219833.1.79778 WP_001219833.1.79845 WP_001219833.1.79867 WP_001219833.1.79942 WP_001219833.1.79974 WP_001219833.1.80077 WP_001219833.1.80137 WP_001219833.1.80182 WP_001219833.1.80250 WP_001219833.1.80296 WP_001219833.1.80366 WP_001219833.1.80441 WP_001219833.1.80443 WP_001219833.1.80473 WP_001219833.1.80529 WP_001219833.1.80542 WP_001219833.1.80586 WP_001219833.1.80723 WP_001219833.1.80725 WP_001219833.1.80780 WP_001219833.1.80827 WP_001219833.1.80831 WP_001219833.1.80840 WP_001219833.1.80850 WP_001219833.1.80881 WP_001219833.1.80939 WP_001219833.1.80959 WP_001219833.1.8096 WP_001219833.1.80973 WP_001219833.1.81037 WP_001219833.1.81069 WP_001219833.1.81149 WP_001219833.1.81175 WP_001219833.1.8119 WP_001219833.1.8127 WP_001219833.1.81354 WP_001219833.1.81410 WP_001219833.1.81425 WP_001219833.1.81727 WP_001219833.1.81736 WP_001219833.1.81743 WP_001219833.1.81750 WP_001219833.1.81760 WP_001219833.1.81785 WP_001219833.1.81795 WP_001219833.1.81902 WP_001219833.1.8196 WP_001219833.1.81974 WP_001219833.1.81977 WP_001219833.1.82037 WP_001219833.1.82337 WP_001219833.1.82352 WP_001219833.1.82479 WP_001219833.1.82503 WP_001219833.1.82515 WP_001219833.1.82529 WP_001219833.1.82637 WP_001219833.1.82676 WP_001219833.1.82761 WP_001219833.1.8282 WP_001219833.1.82841 WP_001219833.1.82899 WP_001219833.1.82908 WP_001219833.1.82944 WP_001219833.1.82956 WP_001219833.1.83092 WP_001219833.1.83163 WP_001219833.1.83247 WP_001219833.1.83258 WP_001219833.1.83305 WP_001219833.1.83365 WP_001219833.1.83388 WP_001219833.1.83407 WP_001219833.1.83413 WP_001219833.1.83491 WP_001219833.1.83523 WP_001219833.1.8354 WP_001219833.1.83650 WP_001219833.1.83710 WP_001219833.1.83721 WP_001219833.1.83739 WP_001219833.1.83760 WP_001219833.1.83854 WP_001219833.1.83979 WP_001219833.1.83995 WP_001219833.1.84001 WP_001219833.1.84100 WP_001219833.1.84103 WP_001219833.1.84209 WP_001219833.1.84229 WP_001219833.1.84283 WP_001219833.1.84355 WP_001219833.1.84392 WP_001219833.1.84403 WP_001219833.1.8441 WP_001219833.1.84475 WP_001219833.1.84532 WP_001219833.1.84551 WP_001219833.1.84659 WP_001219833.1.84693 WP_001219833.1.84711 WP_001219833.1.84899 WP_001219833.1.8497 WP_001219833.1.850 WP_001219833.1.85031 WP_001219833.1.85134 WP_001219833.1.85178 WP_001219833.1.85180 WP_001219833.1.85190 WP_001219833.1.85192 WP_001219833.1.85217 WP_001219833.1.8533 WP_001219833.1.85408 WP_001219833.1.8545 WP_001219833.1.85483 WP_001219833.1.85541 WP_001219833.1.85615 WP_001219833.1.85617 WP_001219833.1.85663 WP_001219833.1.85672 WP_001219833.1.85777 WP_001219833.1.85784 WP_001219833.1.85855 WP_001219833.1.85864 WP_001219833.1.85886 WP_001219833.1.85900 WP_001219833.1.85904 WP_001219833.1.85943 WP_001219833.1.85976 WP_001219833.1.86120 WP_001219833.1.86284 WP_001219833.1.86306 WP_001219833.1.86356 WP_001219833.1.86442 WP_001219833.1.86450 WP_001219833.1.86453 WP_001219833.1.86469 WP_001219833.1.86580 WP_001219833.1.86588 WP_001219833.1.86656 WP_001219833.1.86661 WP_001219833.1.86676 WP_001219833.1.8678 WP_001219833.1.86810 WP_001219833.1.8684 WP_001219833.1.86895 WP_001219833.1.86906 WP_001219833.1.8691 WP_001219833.1.86921 WP_001219833.1.87095 WP_001219833.1.87219 WP_001219833.1.87282 WP_001219833.1.87323 WP_001219833.1.8736 WP_001219833.1.87460 WP_001219833.1.87493 WP_001219833.1.87552 WP_001219833.1.87779 WP_001219833.1.87875 WP_001219833.1.87933 WP_001219833.1.87945 WP_001219833.1.88014 WP_001219833.1.88019 WP_001219833.1.88073 WP_001219833.1.8809 WP_001219833.1.88165 WP_001219833.1.88214 WP_001219833.1.88264 WP_001219833.1.88291 WP_001219833.1.88293 WP_001219833.1.88303 WP_001219833.1.8837 WP_001219833.1.88393 WP_001219833.1.88609 WP_001219833.1.88624 WP_001219833.1.88651 WP_001219833.1.88683 WP_001219833.1.88703 WP_001219833.1.88762 WP_001219833.1.88776 WP_001219833.1.88792 WP_001219833.1.88845 WP_001219833.1.88902 WP_001219833.1.8891 WP_001219833.1.88970 WP_001219833.1.88981 WP_001219833.1.89008 WP_001219833.1.89116 WP_001219833.1.89138 WP_001219833.1.89304 WP_001219833.1.89462 WP_001219833.1.89512 WP_001219833.1.89527 WP_001219833.1.89570 WP_001219833.1.89580 WP_001219833.1.89604 WP_001219833.1.89622 WP_001219833.1.89659 WP_001219833.1.89815 WP_001219833.1.89902 WP_001219833.1.89940 WP_001219833.1.8996 WP_001219833.1.9002 WP_001219833.1.90097 WP_001219833.1.90211 WP_001219833.1.90220 WP_001219833.1.90252 WP_001219833.1.90417 WP_001219833.1.90453 WP_001219833.1.90458 WP_001219833.1.90521 WP_001219833.1.90557 WP_001219833.1.90585 WP_001219833.1.90620 WP_001219833.1.90641 WP_001219833.1.90686 WP_001219833.1.90734 WP_001219833.1.91003 WP_001219833.1.91023 WP_001219833.1.91042 WP_001219833.1.91069 WP_001219833.1.91107 WP_001219833.1.91278 WP_001219833.1.9131 WP_001219833.1.91381 WP_001219833.1.91470 WP_001219833.1.91473 WP_001219833.1.91512 WP_001219833.1.91564 WP_001219833.1.91580 WP_001219833.1.91628 WP_001219833.1.91724 WP_001219833.1.91732 WP_001219833.1.91788 WP_001219833.1.91864 WP_001219833.1.91903 WP_001219833.1.92013 WP_001219833.1.92060 WP_001219833.1.92093 WP_001219833.1.92099 WP_001219833.1.92108 WP_001219833.1.92149 WP_001219833.1.92171 WP_001219833.1.92183 WP_001219833.1.92208 WP_001219833.1.92268 WP_001219833.1.92310 WP_001219833.1.92318 WP_001219833.1.92394 WP_001219833.1.92443 WP_001219833.1.92482 WP_001219833.1.92531 WP_001219833.1.92562 WP_001219833.1.92669 WP_001219833.1.92671 WP_001219833.1.92729 WP_001219833.1.92738 WP_001219833.1.92758 WP_001219833.1.92827 WP_001219833.1.92875 WP_001219833.1.92895 WP_001219833.1.92975 WP_001219833.1.93061 WP_001219833.1.93086 WP_001219833.1.93101 WP_001219833.1.93136 WP_001219833.1.93155 WP_001219833.1.93275 WP_001219833.1.93365 WP_001219833.1.93376 WP_001219833.1.93543 WP_001219833.1.93648 WP_001219833.1.93650 WP_001219833.1.93656 WP_001219833.1.93662 WP_001219833.1.937 WP_001219833.1.93705 WP_001219833.1.93803 WP_001219833.1.93804 WP_001219833.1.9389 WP_001219833.1.93994 WP_001219833.1.94072 WP_001219833.1.94162 WP_001219833.1.94167 WP_001219833.1.94168 WP_001219833.1.94198 WP_001219833.1.9432 WP_001219833.1.94379 WP_001219833.1.94380 WP_001219833.1.94412 WP_001219833.1.94458 WP_001219833.1.94562 WP_001219833.1.94565 WP_001219833.1.94584 WP_001219833.1.9463 WP_001219833.1.94674 WP_001219833.1.94717 WP_001219833.1.94722 WP_001219833.1.94796 WP_001219833.1.94849 WP_001219833.1.94862 WP_001219833.1.94959 WP_001219833.1.94971 WP_001219833.1.94986 WP_001219833.1.9503 WP_001219833.1.95051 WP_001219833.1.95085 WP_001219833.1.95121 WP_001219833.1.95282 WP_001219833.1.9530 WP_001219833.1.95320 WP_001219833.1.95465 WP_001219833.1.95546 WP_001219833.1.95579 WP_001219833.1.95623 WP_001219833.1.95630 WP_001219833.1.95729 WP_001219833.1.95744 WP_001219833.1.95911 WP_001219833.1.96042 WP_001219833.1.96139 WP_001219833.1.96190 WP_001219833.1.96317 WP_001219833.1.96335 WP_001219833.1.96343 WP_001219833.1.9644 WP_001219833.1.96469 WP_001219833.1.96497 WP_001219833.1.96500 WP_001219833.1.96555 WP_001219833.1.96563 WP_001219833.1.96642 WP_001219833.1.96732 WP_001219833.1.96758 WP_001219833.1.96761 WP_001219833.1.96771 WP_001219833.1.97005 WP_001219833.1.97015 WP_001219833.1.97145 WP_001219833.1.97190 WP_001219833.1.97369 WP_001219833.1.97496 WP_001219833.1.97594 WP_001219833.1.97597 WP_001219833.1.97613 WP_001219833.1.97620 WP_001219833.1.97626 WP_001219833.1.97691 WP_001219833.1.97727 WP_001219833.1.97732 WP_001219833.1.97736 WP_001219833.1.9775 WP_001219833.1.97846 WP_001219833.1.97983 WP_001219833.1.98006 WP_001219833.1.98019 WP_001219833.1.98022 WP_001219833.1.98110 WP_001219833.1.98146 WP_001219833.1.98219 WP_001219833.1.98314 WP_001219833.1.98402 WP_001219833.1.9841 WP_001219833.1.98438 WP_001219833.1.98483 WP_001219833.1.98495 WP_001219833.1.98531 WP_001219833.1.98577 WP_001219833.1.98677 WP_001219833.1.98751 WP_001219833.1.98760 WP_001219833.1.98763 WP_001219833.1.98843 WP_001219833.1.98899 WP_001219833.1.98931 WP_001219833.1.99098 WP_001219833.1.99107 WP_001219833.1.99184 WP_001219833.1.99276 WP_001219833.1.99278 WP_001219833.1.99370 WP_001219833.1.99637 WP_001219833.1.99657 WP_001219833.1.99660 WP_001219833.1.99712 WP_001219833.1.99783 WP_001219833.1.99813 WP_001219833.1.99824 WP_001219833.1.99889 WP_001219833.1.99958 gi|378987084|ref|YP_005250240.1| gi|482906950|ref|YP_007905510.1| 391501 APC25582 gi|550903752|ref|YP_008672844.1| gi|379703654|ref|YP_005245382.1| gi|16767662|ref|NP_463277.1| gi|197248271|ref|YP_002149331.1| gi|525948651|ref|YP_008310336.1| gi|525856300|ref|YP_008259047.1| gi|525839661|ref|YP_008257000.1| gi|378702254|ref|YP_005184212.1| gi|526218826|ref|YP_008264085.1| gi|549726926|ref|YP_008647116.1| ABAM02000001|CDS_302165-303544 ABAN01000009|CDS_134244-132865 ABAO01000006|CDS_25141-26520 ABFH02000001|CDS_486423-485044 AE006468|CDS_4656671-4658050 CP001138|CDS_4589003-4590382 CP001363|CDS_4669501-4670880 FN424405|CDS_4678658-4680037 NZ_ACBF01000003|CDS_70417-71796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]