SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378453382|ref|YP_005240742.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378453382|ref|YP_005240742.1|
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily RmlC-like cupins 9.78e-69
Family YlbA-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378453382|ref|YP_005240742.1|
Sequence length 269
Comment putative inner membrane protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
Sequence
MANLLSTCTSESGNIQHISPQNAGWEYVGFDVWQLKAGESITLPSDERERCLVLVAGLAS
VKAADSFFYRIGQRMSPFERIPAYSVYLPHHTEAKVTAETDLELAVCSAPGFGELPVRLI
SPQEVGVEHRGKGRNQRLVHNILPDSQLADSLLVVEVYTNEGDTSSWPAHKHDTAVEGQE
TYLEETYYHRFNPPQGFCLQRVYTDDRSLDECMAVYNRDVVKVPKGYHPVATIAGYDNYY
LNVMAGPLRKWRFTWEENHAWINSPDYPR
Download sequence
Identical sequences A0A029GMA6 A0A029J588 A0A0D6HQ81 A0A0F6BAU4 A0A0F7JCN2 A0A0H3NIY1 A0A0M7PR31 A0A0U1GSC0 A0A0W4APS5 A0A221Z4W9 A0A249V3D2 A0A271D288 A0A2C6FEM4 A0A2D1XWR7 A0A2D3AK04 A0A2H9YK26 A0A2I6MD81 A0A2I6NVY1 A0A2I6P8R0 A0A2K2Z247 B5F3E9 B7MQA1 E8XBH4 G4C9Y5 G5LXH9 G5NLS5 G5SKE6 Q8ZK62 S5HHA3 V1W0Q5 V7ISF9
gi|563655709|ref|YP_008863813.1| 272994.SPAB_05566 454166.SeAg_B4702 585397.ECED1_0299 99287.STM4420 gi|378702258|ref|YP_005184216.1| gi|549481536|ref|YP_008616014.1| gi|16767666|ref|NP_463281.1| gi|482906954|ref|YP_007905514.1| gi|379703659|ref|YP_005245387.1| gi|378447731|ref|YP_005235363.1| gi|525948647|ref|YP_008310330.1| gi|525839657|ref|YP_008256994.1| gi|378987090|ref|YP_005250246.1| gi|550903756|ref|YP_008672848.1| gi|383498987|ref|YP_005399676.1| NP_463281.1.58477 WP_000002010.1.100007 WP_000002010.1.100010 WP_000002010.1.100031 WP_000002010.1.100115 WP_000002010.1.10013 WP_000002010.1.100165 WP_000002010.1.100234 WP_000002010.1.100258 WP_000002010.1.100266 WP_000002010.1.100288 WP_000002010.1.100376 WP_000002010.1.100413 WP_000002010.1.100424 WP_000002010.1.100432 WP_000002010.1.100436 WP_000002010.1.100484 WP_000002010.1.100488 WP_000002010.1.100584 WP_000002010.1.100597 WP_000002010.1.10065 WP_000002010.1.100650 WP_000002010.1.100707 WP_000002010.1.100721 WP_000002010.1.100750 WP_000002010.1.10076 WP_000002010.1.100773 WP_000002010.1.100781 WP_000002010.1.100790 WP_000002010.1.100793 WP_000002010.1.100865 WP_000002010.1.100869 WP_000002010.1.100870 WP_000002010.1.100871 WP_000002010.1.100882 WP_000002010.1.100932 WP_000002010.1.101007 WP_000002010.1.101020 WP_000002010.1.101042 WP_000002010.1.101074 WP_000002010.1.101078 WP_000002010.1.101180 WP_000002010.1.101185 WP_000002010.1.101199 WP_000002010.1.101259 WP_000002010.1.101284 WP_000002010.1.101291 WP_000002010.1.101320 WP_000002010.1.101353 WP_000002010.1.101386 WP_000002010.1.101404 WP_000002010.1.101420 WP_000002010.1.101425 WP_000002010.1.101589 WP_000002010.1.101609 WP_000002010.1.101612 WP_000002010.1.101707 WP_000002010.1.101724 WP_000002010.1.101734 WP_000002010.1.101741 WP_000002010.1.101759 WP_000002010.1.101841 WP_000002010.1.101878 WP_000002010.1.10191 WP_000002010.1.101953 WP_000002010.1.10220 WP_000002010.1.10266 WP_000002010.1.10276 WP_000002010.1.10293 WP_000002010.1.10310 WP_000002010.1.10394 WP_000002010.1.10429 WP_000002010.1.10439 WP_000002010.1.10463 WP_000002010.1.10465 WP_000002010.1.10507 WP_000002010.1.10521 WP_000002010.1.10562 WP_000002010.1.10568 WP_000002010.1.10678 WP_000002010.1.10720 WP_000002010.1.10753 WP_000002010.1.10797 WP_000002010.1.10992 WP_000002010.1.11000 WP_000002010.1.11024 WP_000002010.1.11031 WP_000002010.1.11098 WP_000002010.1.11168 WP_000002010.1.11190 WP_000002010.1.11254 WP_000002010.1.11295 WP_000002010.1.11304 WP_000002010.1.1135 WP_000002010.1.11369 WP_000002010.1.11399 WP_000002010.1.11405 WP_000002010.1.11455 WP_000002010.1.11458 WP_000002010.1.11518 WP_000002010.1.11532 WP_000002010.1.11543 WP_000002010.1.11544 WP_000002010.1.11565 WP_000002010.1.11621 WP_000002010.1.11763 WP_000002010.1.11772 WP_000002010.1.11875 WP_000002010.1.11897 WP_000002010.1.12007 WP_000002010.1.12025 WP_000002010.1.12047 WP_000002010.1.12059 WP_000002010.1.12063 WP_000002010.1.12114 WP_000002010.1.12160 WP_000002010.1.12244 WP_000002010.1.12351 WP_000002010.1.12370 WP_000002010.1.12397 WP_000002010.1.12456 WP_000002010.1.1250 WP_000002010.1.12546 WP_000002010.1.12584 WP_000002010.1.1264 WP_000002010.1.12650 WP_000002010.1.12718 WP_000002010.1.12728 WP_000002010.1.12864 WP_000002010.1.12879 WP_000002010.1.12936 WP_000002010.1.12995 WP_000002010.1.13027 WP_000002010.1.13106 WP_000002010.1.13130 WP_000002010.1.13334 WP_000002010.1.13414 WP_000002010.1.13446 WP_000002010.1.13488 WP_000002010.1.13509 WP_000002010.1.13528 WP_000002010.1.13543 WP_000002010.1.13669 WP_000002010.1.13677 WP_000002010.1.13741 WP_000002010.1.13750 WP_000002010.1.13799 WP_000002010.1.13819 WP_000002010.1.13829 WP_000002010.1.13848 WP_000002010.1.1387 WP_000002010.1.13908 WP_000002010.1.13932 WP_000002010.1.13968 WP_000002010.1.14001 WP_000002010.1.14151 WP_000002010.1.14239 WP_000002010.1.14286 WP_000002010.1.14320 WP_000002010.1.14379 WP_000002010.1.14406 WP_000002010.1.14410 WP_000002010.1.14466 WP_000002010.1.14516 WP_000002010.1.14524 WP_000002010.1.14528 WP_000002010.1.14554 WP_000002010.1.14688 WP_000002010.1.14706 WP_000002010.1.14725 WP_000002010.1.14789 WP_000002010.1.14808 WP_000002010.1.14852 WP_000002010.1.14884 WP_000002010.1.1489 WP_000002010.1.14917 WP_000002010.1.14932 WP_000002010.1.14936 WP_000002010.1.15055 WP_000002010.1.15059 WP_000002010.1.15079 WP_000002010.1.15102 WP_000002010.1.15124 WP_000002010.1.15223 WP_000002010.1.15226 WP_000002010.1.15316 WP_000002010.1.15369 WP_000002010.1.1540 WP_000002010.1.15479 WP_000002010.1.15508 WP_000002010.1.15612 WP_000002010.1.15644 WP_000002010.1.15784 WP_000002010.1.15830 WP_000002010.1.15835 WP_000002010.1.15881 WP_000002010.1.15909 WP_000002010.1.15978 WP_000002010.1.15995 WP_000002010.1.1601 WP_000002010.1.16028 WP_000002010.1.16032 WP_000002010.1.16052 WP_000002010.1.16062 WP_000002010.1.16063 WP_000002010.1.16103 WP_000002010.1.1611 WP_000002010.1.16158 WP_000002010.1.16166 WP_000002010.1.16172 WP_000002010.1.16226 WP_000002010.1.16233 WP_000002010.1.16244 WP_000002010.1.16273 WP_000002010.1.16284 WP_000002010.1.16328 WP_000002010.1.1635 WP_000002010.1.16468 WP_000002010.1.16508 WP_000002010.1.16565 WP_000002010.1.16608 WP_000002010.1.16614 WP_000002010.1.16650 WP_000002010.1.16656 WP_000002010.1.16686 WP_000002010.1.16691 WP_000002010.1.167 WP_000002010.1.16732 WP_000002010.1.16735 WP_000002010.1.16786 WP_000002010.1.16819 WP_000002010.1.16826 WP_000002010.1.16858 WP_000002010.1.1689 WP_000002010.1.16896 WP_000002010.1.16910 WP_000002010.1.16916 WP_000002010.1.16942 WP_000002010.1.16944 WP_000002010.1.16965 WP_000002010.1.16998 WP_000002010.1.1700 WP_000002010.1.17031 WP_000002010.1.17188 WP_000002010.1.17307 WP_000002010.1.17390 WP_000002010.1.174 WP_000002010.1.17439 WP_000002010.1.17480 WP_000002010.1.17546 WP_000002010.1.17560 WP_000002010.1.17629 WP_000002010.1.17693 WP_000002010.1.17702 WP_000002010.1.17705 WP_000002010.1.17747 WP_000002010.1.17755 WP_000002010.1.17901 WP_000002010.1.17919 WP_000002010.1.17949 WP_000002010.1.18019 WP_000002010.1.1807 WP_000002010.1.18089 WP_000002010.1.18111 WP_000002010.1.1814 WP_000002010.1.18163 WP_000002010.1.18177 WP_000002010.1.18178 WP_000002010.1.18265 WP_000002010.1.18267 WP_000002010.1.18282 WP_000002010.1.18365 WP_000002010.1.18426 WP_000002010.1.18445 WP_000002010.1.18468 WP_000002010.1.18607 WP_000002010.1.18705 WP_000002010.1.18715 WP_000002010.1.18776 WP_000002010.1.18822 WP_000002010.1.18881 WP_000002010.1.18895 WP_000002010.1.18919 WP_000002010.1.18940 WP_000002010.1.18949 WP_000002010.1.19038 WP_000002010.1.19053 WP_000002010.1.19055 WP_000002010.1.19320 WP_000002010.1.19340 WP_000002010.1.1939 WP_000002010.1.19458 WP_000002010.1.19460 WP_000002010.1.19461 WP_000002010.1.19469 WP_000002010.1.1954 WP_000002010.1.19614 WP_000002010.1.19642 WP_000002010.1.19683 WP_000002010.1.19702 WP_000002010.1.19706 WP_000002010.1.19723 WP_000002010.1.19724 WP_000002010.1.19749 WP_000002010.1.19784 WP_000002010.1.19802 WP_000002010.1.19809 WP_000002010.1.19823 WP_000002010.1.19851 WP_000002010.1.19867 WP_000002010.1.19884 WP_000002010.1.1990 WP_000002010.1.1998 WP_000002010.1.19987 WP_000002010.1.20 WP_000002010.1.20023 WP_000002010.1.20034 WP_000002010.1.20081 WP_000002010.1.20089 WP_000002010.1.2010 WP_000002010.1.20212 WP_000002010.1.20218 WP_000002010.1.20266 WP_000002010.1.20271 WP_000002010.1.20330 WP_000002010.1.20362 WP_000002010.1.20418 WP_000002010.1.20443 WP_000002010.1.20503 WP_000002010.1.20525 WP_000002010.1.2054 WP_000002010.1.20553 WP_000002010.1.20573 WP_000002010.1.20626 WP_000002010.1.20631 WP_000002010.1.20646 WP_000002010.1.20700 WP_000002010.1.20721 WP_000002010.1.20789 WP_000002010.1.20795 WP_000002010.1.20886 WP_000002010.1.20908 WP_000002010.1.2101 WP_000002010.1.21049 WP_000002010.1.21075 WP_000002010.1.21086 WP_000002010.1.21146 WP_000002010.1.21165 WP_000002010.1.21245 WP_000002010.1.21246 WP_000002010.1.21269 WP_000002010.1.21309 WP_000002010.1.21326 WP_000002010.1.21400 WP_000002010.1.21497 WP_000002010.1.21499 WP_000002010.1.21548 WP_000002010.1.21603 WP_000002010.1.21750 WP_000002010.1.21751 WP_000002010.1.21757 WP_000002010.1.21825 WP_000002010.1.21845 WP_000002010.1.21877 WP_000002010.1.21886 WP_000002010.1.21940 WP_000002010.1.22019 WP_000002010.1.22024 WP_000002010.1.22030 WP_000002010.1.2205 WP_000002010.1.22062 WP_000002010.1.22067 WP_000002010.1.22069 WP_000002010.1.22117 WP_000002010.1.22169 WP_000002010.1.2221 WP_000002010.1.2224 WP_000002010.1.22315 WP_000002010.1.22323 WP_000002010.1.22337 WP_000002010.1.2235 WP_000002010.1.22379 WP_000002010.1.22427 WP_000002010.1.22453 WP_000002010.1.2246 WP_000002010.1.22485 WP_000002010.1.22537 WP_000002010.1.22604 WP_000002010.1.22620 WP_000002010.1.22623 WP_000002010.1.22845 WP_000002010.1.22870 WP_000002010.1.22979 WP_000002010.1.23010 WP_000002010.1.23053 WP_000002010.1.23080 WP_000002010.1.23102 WP_000002010.1.23114 WP_000002010.1.2314 WP_000002010.1.23148 WP_000002010.1.23192 WP_000002010.1.23246 WP_000002010.1.23258 WP_000002010.1.23259 WP_000002010.1.23274 WP_000002010.1.23279 WP_000002010.1.23309 WP_000002010.1.2342 WP_000002010.1.23460 WP_000002010.1.23466 WP_000002010.1.23472 WP_000002010.1.23482 WP_000002010.1.23485 WP_000002010.1.23503 WP_000002010.1.23513 WP_000002010.1.23587 WP_000002010.1.23629 WP_000002010.1.23634 WP_000002010.1.23639 WP_000002010.1.2364 WP_000002010.1.23643 WP_000002010.1.23670 WP_000002010.1.23675 WP_000002010.1.23685 WP_000002010.1.2376 WP_000002010.1.23819 WP_000002010.1.23932 WP_000002010.1.24017 WP_000002010.1.24158 WP_000002010.1.24206 WP_000002010.1.24259 WP_000002010.1.24308 WP_000002010.1.24325 WP_000002010.1.24392 WP_000002010.1.24419 WP_000002010.1.24444 WP_000002010.1.24578 WP_000002010.1.2467 WP_000002010.1.24689 WP_000002010.1.24696 WP_000002010.1.24737 WP_000002010.1.24779 WP_000002010.1.24837 WP_000002010.1.24873 WP_000002010.1.25008 WP_000002010.1.25015 WP_000002010.1.25072 WP_000002010.1.25130 WP_000002010.1.25205 WP_000002010.1.25206 WP_000002010.1.2525 WP_000002010.1.25380 WP_000002010.1.25405 WP_000002010.1.25454 WP_000002010.1.25493 WP_000002010.1.25514 WP_000002010.1.25546 WP_000002010.1.25668 WP_000002010.1.25690 WP_000002010.1.2570 WP_000002010.1.25700 WP_000002010.1.25703 WP_000002010.1.25740 WP_000002010.1.25793 WP_000002010.1.25809 WP_000002010.1.25814 WP_000002010.1.25825 WP_000002010.1.25932 WP_000002010.1.25988 WP_000002010.1.26030 WP_000002010.1.26034 WP_000002010.1.26093 WP_000002010.1.26123 WP_000002010.1.26129 WP_000002010.1.26213 WP_000002010.1.26224 WP_000002010.1.26282 WP_000002010.1.26311 WP_000002010.1.26319 WP_000002010.1.2634 WP_000002010.1.26384 WP_000002010.1.26429 WP_000002010.1.26440 WP_000002010.1.26493 WP_000002010.1.26551 WP_000002010.1.26567 WP_000002010.1.2660 WP_000002010.1.26646 WP_000002010.1.26709 WP_000002010.1.26787 WP_000002010.1.26883 WP_000002010.1.26924 WP_000002010.1.26980 WP_000002010.1.27010 WP_000002010.1.27051 WP_000002010.1.27173 WP_000002010.1.272 WP_000002010.1.27206 WP_000002010.1.2723 WP_000002010.1.27255 WP_000002010.1.27279 WP_000002010.1.27342 WP_000002010.1.27423 WP_000002010.1.27452 WP_000002010.1.27513 WP_000002010.1.27523 WP_000002010.1.2755 WP_000002010.1.27556 WP_000002010.1.27561 WP_000002010.1.27616 WP_000002010.1.2763 WP_000002010.1.27665 WP_000002010.1.27679 WP_000002010.1.27707 WP_000002010.1.27755 WP_000002010.1.27761 WP_000002010.1.2777 WP_000002010.1.27798 WP_000002010.1.27815 WP_000002010.1.27857 WP_000002010.1.27977 WP_000002010.1.28002 WP_000002010.1.28094 WP_000002010.1.28126 WP_000002010.1.28170 WP_000002010.1.28225 WP_000002010.1.28235 WP_000002010.1.2825 WP_000002010.1.28267 WP_000002010.1.28301 WP_000002010.1.28302 WP_000002010.1.2835 WP_000002010.1.28370 WP_000002010.1.28538 WP_000002010.1.28575 WP_000002010.1.28625 WP_000002010.1.28655 WP_000002010.1.28694 WP_000002010.1.287 WP_000002010.1.2879 WP_000002010.1.28811 WP_000002010.1.28830 WP_000002010.1.2890 WP_000002010.1.28902 WP_000002010.1.28938 WP_000002010.1.28946 WP_000002010.1.28977 WP_000002010.1.29006 WP_000002010.1.29010 WP_000002010.1.2910 WP_000002010.1.29190 WP_000002010.1.29454 WP_000002010.1.29530 WP_000002010.1.29588 WP_000002010.1.29601 WP_000002010.1.29606 WP_000002010.1.29615 WP_000002010.1.29619 WP_000002010.1.29682 WP_000002010.1.29704 WP_000002010.1.29732 WP_000002010.1.29774 WP_000002010.1.2984 WP_000002010.1.29845 WP_000002010.1.29923 WP_000002010.1.29969 WP_000002010.1.30006 WP_000002010.1.30018 WP_000002010.1.30027 WP_000002010.1.30086 WP_000002010.1.3017 WP_000002010.1.30179 WP_000002010.1.30180 WP_000002010.1.30238 WP_000002010.1.30331 WP_000002010.1.30386 WP_000002010.1.30437 WP_000002010.1.30469 WP_000002010.1.30505 WP_000002010.1.30507 WP_000002010.1.30535 WP_000002010.1.30547 WP_000002010.1.30573 WP_000002010.1.30602 WP_000002010.1.3066 WP_000002010.1.30696 WP_000002010.1.3076 WP_000002010.1.30794 WP_000002010.1.3080 WP_000002010.1.30819 WP_000002010.1.30833 WP_000002010.1.30835 WP_000002010.1.30972 WP_000002010.1.31 WP_000002010.1.31001 WP_000002010.1.31042 WP_000002010.1.31086 WP_000002010.1.31107 WP_000002010.1.31111 WP_000002010.1.3113 WP_000002010.1.31155 WP_000002010.1.31185 WP_000002010.1.3119 WP_000002010.1.31190 WP_000002010.1.31195 WP_000002010.1.31196 WP_000002010.1.31214 WP_000002010.1.31219 WP_000002010.1.31222 WP_000002010.1.3124 WP_000002010.1.31281 WP_000002010.1.31362 WP_000002010.1.31504 WP_000002010.1.31515 WP_000002010.1.31578 WP_000002010.1.31658 WP_000002010.1.3170 WP_000002010.1.31725 WP_000002010.1.31762 WP_000002010.1.31782 WP_000002010.1.31845 WP_000002010.1.31940 WP_000002010.1.31967 WP_000002010.1.32006 WP_000002010.1.32192 WP_000002010.1.32206 WP_000002010.1.32423 WP_000002010.1.32438 WP_000002010.1.32515 WP_000002010.1.32527 WP_000002010.1.32624 WP_000002010.1.32660 WP_000002010.1.32702 WP_000002010.1.32714 WP_000002010.1.32747 WP_000002010.1.32750 WP_000002010.1.3278 WP_000002010.1.32786 WP_000002010.1.32804 WP_000002010.1.32860 WP_000002010.1.32900 WP_000002010.1.32902 WP_000002010.1.32907 WP_000002010.1.32961 WP_000002010.1.33030 WP_000002010.1.3304 WP_000002010.1.33078 WP_000002010.1.33127 WP_000002010.1.33143 WP_000002010.1.33160 WP_000002010.1.33190 WP_000002010.1.33248 WP_000002010.1.33261 WP_000002010.1.333 WP_000002010.1.33392 WP_000002010.1.33486 WP_000002010.1.33492 WP_000002010.1.33553 WP_000002010.1.33592 WP_000002010.1.33609 WP_000002010.1.33629 WP_000002010.1.33659 WP_000002010.1.33870 WP_000002010.1.33894 WP_000002010.1.34043 WP_000002010.1.34075 WP_000002010.1.34081 WP_000002010.1.34084 WP_000002010.1.34107 WP_000002010.1.34126 WP_000002010.1.34257 WP_000002010.1.34279 WP_000002010.1.34304 WP_000002010.1.34319 WP_000002010.1.34330 WP_000002010.1.3445 WP_000002010.1.34453 WP_000002010.1.34610 WP_000002010.1.34667 WP_000002010.1.3476 WP_000002010.1.34856 WP_000002010.1.34881 WP_000002010.1.34975 WP_000002010.1.34977 WP_000002010.1.35045 WP_000002010.1.35129 WP_000002010.1.35184 WP_000002010.1.35253 WP_000002010.1.35404 WP_000002010.1.35408 WP_000002010.1.3541 WP_000002010.1.35425 WP_000002010.1.35429 WP_000002010.1.35446 WP_000002010.1.35463 WP_000002010.1.35494 WP_000002010.1.35503 WP_000002010.1.35509 WP_000002010.1.3556 WP_000002010.1.35590 WP_000002010.1.35648 WP_000002010.1.35777 WP_000002010.1.35835 WP_000002010.1.35940 WP_000002010.1.36003 WP_000002010.1.3601 WP_000002010.1.3610 WP_000002010.1.36172 WP_000002010.1.36229 WP_000002010.1.36232 WP_000002010.1.36286 WP_000002010.1.36512 WP_000002010.1.36542 WP_000002010.1.36609 WP_000002010.1.36690 WP_000002010.1.3670 WP_000002010.1.36705 WP_000002010.1.36885 WP_000002010.1.36899 WP_000002010.1.36918 WP_000002010.1.36931 WP_000002010.1.36949 WP_000002010.1.36978 WP_000002010.1.37013 WP_000002010.1.37021 WP_000002010.1.37073 WP_000002010.1.37111 WP_000002010.1.37112 WP_000002010.1.37147 WP_000002010.1.37158 WP_000002010.1.37190 WP_000002010.1.37256 WP_000002010.1.37267 WP_000002010.1.3728 WP_000002010.1.37293 WP_000002010.1.37320 WP_000002010.1.37370 WP_000002010.1.37376 WP_000002010.1.3744 WP_000002010.1.37498 WP_000002010.1.37504 WP_000002010.1.3756 WP_000002010.1.37610 WP_000002010.1.37618 WP_000002010.1.37666 WP_000002010.1.37687 WP_000002010.1.37848 WP_000002010.1.37965 WP_000002010.1.37968 WP_000002010.1.37978 WP_000002010.1.38001 WP_000002010.1.38055 WP_000002010.1.38113 WP_000002010.1.38125 WP_000002010.1.38145 WP_000002010.1.3828 WP_000002010.1.383 WP_000002010.1.38341 WP_000002010.1.38393 WP_000002010.1.3848 WP_000002010.1.38609 WP_000002010.1.38613 WP_000002010.1.38673 WP_000002010.1.3869 WP_000002010.1.38693 WP_000002010.1.38740 WP_000002010.1.38773 WP_000002010.1.38881 WP_000002010.1.38882 WP_000002010.1.38895 WP_000002010.1.38913 WP_000002010.1.38942 WP_000002010.1.38995 WP_000002010.1.39003 WP_000002010.1.39113 WP_000002010.1.39136 WP_000002010.1.39140 WP_000002010.1.39197 WP_000002010.1.39229 WP_000002010.1.39385 WP_000002010.1.39405 WP_000002010.1.39420 WP_000002010.1.39449 WP_000002010.1.39466 WP_000002010.1.39471 WP_000002010.1.39503 WP_000002010.1.39512 WP_000002010.1.39553 WP_000002010.1.39556 WP_000002010.1.39629 WP_000002010.1.39722 WP_000002010.1.39763 WP_000002010.1.39862 WP_000002010.1.39921 WP_000002010.1.39923 WP_000002010.1.40017 WP_000002010.1.40072 WP_000002010.1.40073 WP_000002010.1.4011 WP_000002010.1.40155 WP_000002010.1.40171 WP_000002010.1.40208 WP_000002010.1.40240 WP_000002010.1.40254 WP_000002010.1.40257 WP_000002010.1.40292 WP_000002010.1.40305 WP_000002010.1.40311 WP_000002010.1.40374 WP_000002010.1.40380 WP_000002010.1.40395 WP_000002010.1.40465 WP_000002010.1.40492 WP_000002010.1.40508 WP_000002010.1.40710 WP_000002010.1.4075 WP_000002010.1.40771 WP_000002010.1.40788 WP_000002010.1.4087 WP_000002010.1.40877 WP_000002010.1.40910 WP_000002010.1.40935 WP_000002010.1.40979 WP_000002010.1.41017 WP_000002010.1.41086 WP_000002010.1.4109 WP_000002010.1.41091 WP_000002010.1.41225 WP_000002010.1.41226 WP_000002010.1.41265 WP_000002010.1.41279 WP_000002010.1.41299 WP_000002010.1.41308 WP_000002010.1.41345 WP_000002010.1.41375 WP_000002010.1.41438 WP_000002010.1.41516 WP_000002010.1.41554 WP_000002010.1.41572 WP_000002010.1.41591 WP_000002010.1.41593 WP_000002010.1.41628 WP_000002010.1.41662 WP_000002010.1.41708 WP_000002010.1.41724 WP_000002010.1.41761 WP_000002010.1.41789 WP_000002010.1.4184 WP_000002010.1.41859 WP_000002010.1.41862 WP_000002010.1.41882 WP_000002010.1.41931 WP_000002010.1.41979 WP_000002010.1.42104 WP_000002010.1.42238 WP_000002010.1.42320 WP_000002010.1.4239 WP_000002010.1.42404 WP_000002010.1.42422 WP_000002010.1.42453 WP_000002010.1.4257 WP_000002010.1.42707 WP_000002010.1.4276 WP_000002010.1.42864 WP_000002010.1.4288 WP_000002010.1.4289 WP_000002010.1.42957 WP_000002010.1.42981 WP_000002010.1.43018 WP_000002010.1.43041 WP_000002010.1.43086 WP_000002010.1.43244 WP_000002010.1.43272 WP_000002010.1.43312 WP_000002010.1.43334 WP_000002010.1.43351 WP_000002010.1.43437 WP_000002010.1.43438 WP_000002010.1.43522 WP_000002010.1.43528 WP_000002010.1.43613 WP_000002010.1.43668 WP_000002010.1.43676 WP_000002010.1.43710 WP_000002010.1.4373 WP_000002010.1.43828 WP_000002010.1.43864 WP_000002010.1.43886 WP_000002010.1.44005 WP_000002010.1.4404 WP_000002010.1.44043 WP_000002010.1.44099 WP_000002010.1.44121 WP_000002010.1.44191 WP_000002010.1.44250 WP_000002010.1.44291 WP_000002010.1.44310 WP_000002010.1.44359 WP_000002010.1.44386 WP_000002010.1.4440 WP_000002010.1.44453 WP_000002010.1.44479 WP_000002010.1.44593 WP_000002010.1.44636 WP_000002010.1.44640 WP_000002010.1.4467 WP_000002010.1.44702 WP_000002010.1.44747 WP_000002010.1.44791 WP_000002010.1.4485 WP_000002010.1.44877 WP_000002010.1.44927 WP_000002010.1.44971 WP_000002010.1.44996 WP_000002010.1.45027 WP_000002010.1.45038 WP_000002010.1.45067 WP_000002010.1.45074 WP_000002010.1.45079 WP_000002010.1.45098 WP_000002010.1.45123 WP_000002010.1.45134 WP_000002010.1.45138 WP_000002010.1.45154 WP_000002010.1.45177 WP_000002010.1.45184 WP_000002010.1.45259 WP_000002010.1.45322 WP_000002010.1.45344 WP_000002010.1.45349 WP_000002010.1.45351 WP_000002010.1.45365 WP_000002010.1.45535 WP_000002010.1.45550 WP_000002010.1.45585 WP_000002010.1.45660 WP_000002010.1.45690 WP_000002010.1.45797 WP_000002010.1.458 WP_000002010.1.46011 WP_000002010.1.46028 WP_000002010.1.46069 WP_000002010.1.46112 WP_000002010.1.46173 WP_000002010.1.46174 WP_000002010.1.46187 WP_000002010.1.46203 WP_000002010.1.46232 WP_000002010.1.46286 WP_000002010.1.46303 WP_000002010.1.46345 WP_000002010.1.46358 WP_000002010.1.46499 WP_000002010.1.46574 WP_000002010.1.46595 WP_000002010.1.46637 WP_000002010.1.46666 WP_000002010.1.46675 WP_000002010.1.46689 WP_000002010.1.46693 WP_000002010.1.46732 WP_000002010.1.46803 WP_000002010.1.46804 WP_000002010.1.46930 WP_000002010.1.47005 WP_000002010.1.47024 WP_000002010.1.47057 WP_000002010.1.47214 WP_000002010.1.47429 WP_000002010.1.47442 WP_000002010.1.47448 WP_000002010.1.47460 WP_000002010.1.4747 WP_000002010.1.47472 WP_000002010.1.47478 WP_000002010.1.47492 WP_000002010.1.47587 WP_000002010.1.47614 WP_000002010.1.47621 WP_000002010.1.47649 WP_000002010.1.4769 WP_000002010.1.4775 WP_000002010.1.47767 WP_000002010.1.47799 WP_000002010.1.47814 WP_000002010.1.47817 WP_000002010.1.47849 WP_000002010.1.47902 WP_000002010.1.47928 WP_000002010.1.48132 WP_000002010.1.48209 WP_000002010.1.48215 WP_000002010.1.48218 WP_000002010.1.48242 WP_000002010.1.48244 WP_000002010.1.48247 WP_000002010.1.48253 WP_000002010.1.483 WP_000002010.1.48367 WP_000002010.1.48377 WP_000002010.1.48399 WP_000002010.1.4853 WP_000002010.1.48570 WP_000002010.1.48751 WP_000002010.1.48774 WP_000002010.1.48788 WP_000002010.1.4885 WP_000002010.1.48876 WP_000002010.1.48886 WP_000002010.1.48894 WP_000002010.1.48896 WP_000002010.1.48908 WP_000002010.1.48919 WP_000002010.1.48985 WP_000002010.1.49005 WP_000002010.1.49084 WP_000002010.1.49155 WP_000002010.1.49175 WP_000002010.1.49204 WP_000002010.1.49214 WP_000002010.1.49239 WP_000002010.1.49256 WP_000002010.1.49262 WP_000002010.1.49290 WP_000002010.1.49304 WP_000002010.1.49340 WP_000002010.1.49366 WP_000002010.1.49375 WP_000002010.1.49472 WP_000002010.1.49490 WP_000002010.1.49515 WP_000002010.1.49550 WP_000002010.1.49572 WP_000002010.1.49574 WP_000002010.1.49590 WP_000002010.1.49595 WP_000002010.1.49602 WP_000002010.1.49630 WP_000002010.1.49647 WP_000002010.1.4979 WP_000002010.1.49803 WP_000002010.1.49805 WP_000002010.1.49929 WP_000002010.1.50080 WP_000002010.1.50161 WP_000002010.1.50211 WP_000002010.1.50285 WP_000002010.1.50376 WP_000002010.1.50386 WP_000002010.1.50389 WP_000002010.1.50413 WP_000002010.1.50469 WP_000002010.1.50478 WP_000002010.1.50517 WP_000002010.1.50563 WP_000002010.1.50576 WP_000002010.1.5058 WP_000002010.1.50676 WP_000002010.1.50774 WP_000002010.1.50800 WP_000002010.1.50804 WP_000002010.1.50808 WP_000002010.1.50811 WP_000002010.1.5088 WP_000002010.1.50908 WP_000002010.1.50918 WP_000002010.1.50941 WP_000002010.1.50954 WP_000002010.1.51014 WP_000002010.1.51022 WP_000002010.1.51036 WP_000002010.1.51131 WP_000002010.1.5114 WP_000002010.1.51179 WP_000002010.1.51182 WP_000002010.1.51186 WP_000002010.1.5125 WP_000002010.1.51338 WP_000002010.1.5138 WP_000002010.1.51394 WP_000002010.1.51419 WP_000002010.1.51487 WP_000002010.1.51488 WP_000002010.1.51506 WP_000002010.1.51613 WP_000002010.1.51634 WP_000002010.1.51649 WP_000002010.1.51686 WP_000002010.1.51704 WP_000002010.1.51756 WP_000002010.1.51910 WP_000002010.1.51911 WP_000002010.1.51914 WP_000002010.1.51932 WP_000002010.1.51989 WP_000002010.1.52047 WP_000002010.1.52121 WP_000002010.1.52148 WP_000002010.1.52156 WP_000002010.1.52161 WP_000002010.1.52255 WP_000002010.1.52346 WP_000002010.1.52353 WP_000002010.1.52356 WP_000002010.1.52361 WP_000002010.1.52438 WP_000002010.1.52446 WP_000002010.1.52608 WP_000002010.1.52637 WP_000002010.1.52653 WP_000002010.1.52656 WP_000002010.1.52738 WP_000002010.1.52743 WP_000002010.1.52748 WP_000002010.1.52824 WP_000002010.1.52857 WP_000002010.1.52898 WP_000002010.1.52915 WP_000002010.1.52924 WP_000002010.1.53100 WP_000002010.1.53158 WP_000002010.1.5316 WP_000002010.1.53190 WP_000002010.1.53315 WP_000002010.1.53316 WP_000002010.1.53406 WP_000002010.1.53436 WP_000002010.1.53466 WP_000002010.1.53543 WP_000002010.1.53675 WP_000002010.1.53696 WP_000002010.1.53757 WP_000002010.1.53772 WP_000002010.1.53790 WP_000002010.1.53812 WP_000002010.1.53814 WP_000002010.1.5392 WP_000002010.1.53935 WP_000002010.1.54033 WP_000002010.1.54075 WP_000002010.1.54085 WP_000002010.1.5415 WP_000002010.1.542 WP_000002010.1.54209 WP_000002010.1.54271 WP_000002010.1.54273 WP_000002010.1.54274 WP_000002010.1.54319 WP_000002010.1.54324 WP_000002010.1.54333 WP_000002010.1.54364 WP_000002010.1.54400 WP_000002010.1.54569 WP_000002010.1.54644 WP_000002010.1.54662 WP_000002010.1.54694 WP_000002010.1.54722 WP_000002010.1.54749 WP_000002010.1.54764 WP_000002010.1.54774 WP_000002010.1.54822 WP_000002010.1.5485 WP_000002010.1.54984 WP_000002010.1.55008 WP_000002010.1.55152 WP_000002010.1.55156 WP_000002010.1.55166 WP_000002010.1.55178 WP_000002010.1.55224 WP_000002010.1.5525 WP_000002010.1.55285 WP_000002010.1.55294 WP_000002010.1.55461 WP_000002010.1.55475 WP_000002010.1.55477 WP_000002010.1.55496 WP_000002010.1.5552 WP_000002010.1.55528 WP_000002010.1.55623 WP_000002010.1.55647 WP_000002010.1.55706 WP_000002010.1.55718 WP_000002010.1.55743 WP_000002010.1.55768 WP_000002010.1.55782 WP_000002010.1.55796 WP_000002010.1.55803 WP_000002010.1.55993 WP_000002010.1.55995 WP_000002010.1.56002 WP_000002010.1.56004 WP_000002010.1.56012 WP_000002010.1.56059 WP_000002010.1.56082 WP_000002010.1.56097 WP_000002010.1.56100 WP_000002010.1.56105 WP_000002010.1.56238 WP_000002010.1.56286 WP_000002010.1.56303 WP_000002010.1.56304 WP_000002010.1.5633 WP_000002010.1.56338 WP_000002010.1.56354 WP_000002010.1.56368 WP_000002010.1.56370 WP_000002010.1.56385 WP_000002010.1.56389 WP_000002010.1.56396 WP_000002010.1.56414 WP_000002010.1.56438 WP_000002010.1.56468 WP_000002010.1.56512 WP_000002010.1.56560 WP_000002010.1.56597 WP_000002010.1.56601 WP_000002010.1.56614 WP_000002010.1.56615 WP_000002010.1.56642 WP_000002010.1.56651 WP_000002010.1.56671 WP_000002010.1.56682 WP_000002010.1.56824 WP_000002010.1.56853 WP_000002010.1.56875 WP_000002010.1.56877 WP_000002010.1.56893 WP_000002010.1.57076 WP_000002010.1.57125 WP_000002010.1.57168 WP_000002010.1.57187 WP_000002010.1.57232 WP_000002010.1.57307 WP_000002010.1.57344 WP_000002010.1.57377 WP_000002010.1.57418 WP_000002010.1.57433 WP_000002010.1.57510 WP_000002010.1.57515 WP_000002010.1.57529 WP_000002010.1.5753 WP_000002010.1.57555 WP_000002010.1.57576 WP_000002010.1.57601 WP_000002010.1.57607 WP_000002010.1.57763 WP_000002010.1.57781 WP_000002010.1.57797 WP_000002010.1.5781 WP_000002010.1.57862 WP_000002010.1.57890 WP_000002010.1.57891 WP_000002010.1.57978 WP_000002010.1.5801 WP_000002010.1.58040 WP_000002010.1.58041 WP_000002010.1.58131 WP_000002010.1.58157 WP_000002010.1.58239 WP_000002010.1.58251 WP_000002010.1.58357 WP_000002010.1.58416 WP_000002010.1.58418 WP_000002010.1.5854 WP_000002010.1.58548 WP_000002010.1.5858 WP_000002010.1.58604 WP_000002010.1.58662 WP_000002010.1.58669 WP_000002010.1.58729 WP_000002010.1.58744 WP_000002010.1.58745 WP_000002010.1.58803 WP_000002010.1.58831 WP_000002010.1.5886 WP_000002010.1.59006 WP_000002010.1.59094 WP_000002010.1.59097 WP_000002010.1.59136 WP_000002010.1.59148 WP_000002010.1.59224 WP_000002010.1.59236 WP_000002010.1.5929 WP_000002010.1.59321 WP_000002010.1.59336 WP_000002010.1.59375 WP_000002010.1.59381 WP_000002010.1.59439 WP_000002010.1.59458 WP_000002010.1.59490 WP_000002010.1.59508 WP_000002010.1.59521 WP_000002010.1.5953 WP_000002010.1.59641 WP_000002010.1.59684 WP_000002010.1.59694 WP_000002010.1.59710 WP_000002010.1.59771 WP_000002010.1.5979 WP_000002010.1.59830 WP_000002010.1.59953 WP_000002010.1.59979 WP_000002010.1.60008 WP_000002010.1.60021 WP_000002010.1.60052 WP_000002010.1.60069 WP_000002010.1.60106 WP_000002010.1.60140 WP_000002010.1.60155 WP_000002010.1.60226 WP_000002010.1.60231 WP_000002010.1.60285 WP_000002010.1.60379 WP_000002010.1.60464 WP_000002010.1.60469 WP_000002010.1.60503 WP_000002010.1.6052 WP_000002010.1.60597 WP_000002010.1.60608 WP_000002010.1.60622 WP_000002010.1.60760 WP_000002010.1.60863 WP_000002010.1.60874 WP_000002010.1.60919 WP_000002010.1.60926 WP_000002010.1.60941 WP_000002010.1.61045 WP_000002010.1.61078 WP_000002010.1.6108 WP_000002010.1.61114 WP_000002010.1.6114 WP_000002010.1.61146 WP_000002010.1.61201 WP_000002010.1.61218 WP_000002010.1.61232 WP_000002010.1.6129 WP_000002010.1.61296 WP_000002010.1.61345 WP_000002010.1.61417 WP_000002010.1.61497 WP_000002010.1.61509 WP_000002010.1.61519 WP_000002010.1.61574 WP_000002010.1.61609 WP_000002010.1.6164 WP_000002010.1.61662 WP_000002010.1.61712 WP_000002010.1.61714 WP_000002010.1.61730 WP_000002010.1.61732 WP_000002010.1.61783 WP_000002010.1.61857 WP_000002010.1.61918 WP_000002010.1.61952 WP_000002010.1.62007 WP_000002010.1.62025 WP_000002010.1.62076 WP_000002010.1.62108 WP_000002010.1.62144 WP_000002010.1.62204 WP_000002010.1.62219 WP_000002010.1.62222 WP_000002010.1.62241 WP_000002010.1.62304 WP_000002010.1.62361 WP_000002010.1.62364 WP_000002010.1.62374 WP_000002010.1.62403 WP_000002010.1.6253 WP_000002010.1.62570 WP_000002010.1.62693 WP_000002010.1.62798 WP_000002010.1.62853 WP_000002010.1.62903 WP_000002010.1.62910 WP_000002010.1.62955 WP_000002010.1.63063 WP_000002010.1.63118 WP_000002010.1.63135 WP_000002010.1.63150 WP_000002010.1.63181 WP_000002010.1.63203 WP_000002010.1.63243 WP_000002010.1.63256 WP_000002010.1.63290 WP_000002010.1.63382 WP_000002010.1.63422 WP_000002010.1.63432 WP_000002010.1.63461 WP_000002010.1.63479 WP_000002010.1.63499 WP_000002010.1.63513 WP_000002010.1.63532 WP_000002010.1.63568 WP_000002010.1.63577 WP_000002010.1.63664 WP_000002010.1.63690 WP_000002010.1.63718 WP_000002010.1.63731 WP_000002010.1.6375 WP_000002010.1.63757 WP_000002010.1.63766 WP_000002010.1.63781 WP_000002010.1.63782 WP_000002010.1.63834 WP_000002010.1.63860 WP_000002010.1.63866 WP_000002010.1.63912 WP_000002010.1.63934 WP_000002010.1.63958 WP_000002010.1.63977 WP_000002010.1.64007 WP_000002010.1.64034 WP_000002010.1.64046 WP_000002010.1.64072 WP_000002010.1.64208 WP_000002010.1.6423 WP_000002010.1.64244 WP_000002010.1.64374 WP_000002010.1.64403 WP_000002010.1.6451 WP_000002010.1.64645 WP_000002010.1.64649 WP_000002010.1.64674 WP_000002010.1.64702 WP_000002010.1.64757 WP_000002010.1.64781 WP_000002010.1.64831 WP_000002010.1.6489 WP_000002010.1.64919 WP_000002010.1.64920 WP_000002010.1.65016 WP_000002010.1.65018 WP_000002010.1.65022 WP_000002010.1.65027 WP_000002010.1.65028 WP_000002010.1.65168 WP_000002010.1.65171 WP_000002010.1.65238 WP_000002010.1.65248 WP_000002010.1.6525 WP_000002010.1.6535 WP_000002010.1.65394 WP_000002010.1.65474 WP_000002010.1.65508 WP_000002010.1.65558 WP_000002010.1.65572 WP_000002010.1.6560 WP_000002010.1.65633 WP_000002010.1.6565 WP_000002010.1.65696 WP_000002010.1.6575 WP_000002010.1.65782 WP_000002010.1.6594 WP_000002010.1.65968 WP_000002010.1.66085 WP_000002010.1.66129 WP_000002010.1.66272 WP_000002010.1.6630 WP_000002010.1.66314 WP_000002010.1.66358 WP_000002010.1.66362 WP_000002010.1.66365 WP_000002010.1.6638 WP_000002010.1.6640 WP_000002010.1.66462 WP_000002010.1.66492 WP_000002010.1.66600 WP_000002010.1.66698 WP_000002010.1.66779 WP_000002010.1.6680 WP_000002010.1.66807 WP_000002010.1.66834 WP_000002010.1.66876 WP_000002010.1.66901 WP_000002010.1.66962 WP_000002010.1.67037 WP_000002010.1.67045 WP_000002010.1.67175 WP_000002010.1.67181 WP_000002010.1.67268 WP_000002010.1.67288 WP_000002010.1.67347 WP_000002010.1.67424 WP_000002010.1.67465 WP_000002010.1.67552 WP_000002010.1.67603 WP_000002010.1.67637 WP_000002010.1.67682 WP_000002010.1.67707 WP_000002010.1.67731 WP_000002010.1.67814 WP_000002010.1.67829 WP_000002010.1.6785 WP_000002010.1.67887 WP_000002010.1.67905 WP_000002010.1.67942 WP_000002010.1.67969 WP_000002010.1.67970 WP_000002010.1.67977 WP_000002010.1.68036 WP_000002010.1.68073 WP_000002010.1.68115 WP_000002010.1.68147 WP_000002010.1.68201 WP_000002010.1.68206 WP_000002010.1.68210 WP_000002010.1.6827 WP_000002010.1.68275 WP_000002010.1.68478 WP_000002010.1.6849 WP_000002010.1.685 WP_000002010.1.68532 WP_000002010.1.68547 WP_000002010.1.6857 WP_000002010.1.68589 WP_000002010.1.68655 WP_000002010.1.68656 WP_000002010.1.68658 WP_000002010.1.68690 WP_000002010.1.68778 WP_000002010.1.68787 WP_000002010.1.6879 WP_000002010.1.68894 WP_000002010.1.68928 WP_000002010.1.68958 WP_000002010.1.68966 WP_000002010.1.68975 WP_000002010.1.69006 WP_000002010.1.69011 WP_000002010.1.69029 WP_000002010.1.6907 WP_000002010.1.6913 WP_000002010.1.69146 WP_000002010.1.69255 WP_000002010.1.69296 WP_000002010.1.69320 WP_000002010.1.69346 WP_000002010.1.69397 WP_000002010.1.69438 WP_000002010.1.69515 WP_000002010.1.69554 WP_000002010.1.69564 WP_000002010.1.69592 WP_000002010.1.69597 WP_000002010.1.69636 WP_000002010.1.69644 WP_000002010.1.69696 WP_000002010.1.69704 WP_000002010.1.69754 WP_000002010.1.69787 WP_000002010.1.69790 WP_000002010.1.69807 WP_000002010.1.69977 WP_000002010.1.69982 WP_000002010.1.70003 WP_000002010.1.70028 WP_000002010.1.70087 WP_000002010.1.7016 WP_000002010.1.70169 WP_000002010.1.7021 WP_000002010.1.70241 WP_000002010.1.70248 WP_000002010.1.70269 WP_000002010.1.70289 WP_000002010.1.70321 WP_000002010.1.70327 WP_000002010.1.70447 WP_000002010.1.70485 WP_000002010.1.70488 WP_000002010.1.7055 WP_000002010.1.70580 WP_000002010.1.70643 WP_000002010.1.70683 WP_000002010.1.70732 WP_000002010.1.70733 WP_000002010.1.70761 WP_000002010.1.70883 WP_000002010.1.70899 WP_000002010.1.70914 WP_000002010.1.70922 WP_000002010.1.70948 WP_000002010.1.70969 WP_000002010.1.7110 WP_000002010.1.71116 WP_000002010.1.71146 WP_000002010.1.71165 WP_000002010.1.71171 WP_000002010.1.71188 WP_000002010.1.71202 WP_000002010.1.71243 WP_000002010.1.71248 WP_000002010.1.71268 WP_000002010.1.71306 WP_000002010.1.71337 WP_000002010.1.7134 WP_000002010.1.71378 WP_000002010.1.714 WP_000002010.1.71401 WP_000002010.1.71446 WP_000002010.1.71691 WP_000002010.1.71702 WP_000002010.1.7174 WP_000002010.1.71750 WP_000002010.1.71756 WP_000002010.1.71845 WP_000002010.1.71881 WP_000002010.1.71908 WP_000002010.1.71929 WP_000002010.1.71952 WP_000002010.1.71973 WP_000002010.1.72068 WP_000002010.1.72105 WP_000002010.1.72107 WP_000002010.1.72119 WP_000002010.1.72203 WP_000002010.1.72220 WP_000002010.1.72226 WP_000002010.1.72234 WP_000002010.1.72243 WP_000002010.1.72351 WP_000002010.1.72372 WP_000002010.1.72376 WP_000002010.1.72412 WP_000002010.1.72594 WP_000002010.1.72629 WP_000002010.1.72689 WP_000002010.1.72793 WP_000002010.1.72871 WP_000002010.1.72887 WP_000002010.1.72892 WP_000002010.1.72897 WP_000002010.1.72968 WP_000002010.1.72975 WP_000002010.1.73062 WP_000002010.1.7315 WP_000002010.1.73200 WP_000002010.1.7334 WP_000002010.1.73362 WP_000002010.1.73377 WP_000002010.1.73379 WP_000002010.1.73481 WP_000002010.1.73512 WP_000002010.1.7356 WP_000002010.1.73561 WP_000002010.1.73581 WP_000002010.1.73596 WP_000002010.1.73617 WP_000002010.1.73753 WP_000002010.1.73758 WP_000002010.1.73794 WP_000002010.1.73804 WP_000002010.1.73831 WP_000002010.1.7386 WP_000002010.1.7387 WP_000002010.1.73901 WP_000002010.1.73924 WP_000002010.1.73926 WP_000002010.1.74029 WP_000002010.1.74049 WP_000002010.1.74089 WP_000002010.1.74181 WP_000002010.1.74191 WP_000002010.1.74228 WP_000002010.1.7433 WP_000002010.1.74379 WP_000002010.1.74410 WP_000002010.1.74414 WP_000002010.1.74418 WP_000002010.1.74422 WP_000002010.1.74428 WP_000002010.1.7444 WP_000002010.1.74454 WP_000002010.1.74466 WP_000002010.1.74481 WP_000002010.1.74529 WP_000002010.1.74545 WP_000002010.1.74570 WP_000002010.1.7458 WP_000002010.1.74639 WP_000002010.1.74745 WP_000002010.1.74807 WP_000002010.1.74826 WP_000002010.1.75114 WP_000002010.1.75129 WP_000002010.1.75180 WP_000002010.1.75187 WP_000002010.1.75288 WP_000002010.1.75301 WP_000002010.1.7531 WP_000002010.1.75334 WP_000002010.1.75362 WP_000002010.1.75385 WP_000002010.1.75392 WP_000002010.1.75402 WP_000002010.1.75664 WP_000002010.1.75703 WP_000002010.1.75740 WP_000002010.1.75760 WP_000002010.1.75764 WP_000002010.1.75828 WP_000002010.1.75837 WP_000002010.1.75873 WP_000002010.1.75874 WP_000002010.1.75932 WP_000002010.1.75945 WP_000002010.1.75957 WP_000002010.1.76020 WP_000002010.1.76097 WP_000002010.1.76102 WP_000002010.1.76170 WP_000002010.1.76186 WP_000002010.1.76197 WP_000002010.1.76252 WP_000002010.1.7629 WP_000002010.1.7633 WP_000002010.1.76364 WP_000002010.1.76434 WP_000002010.1.76445 WP_000002010.1.7660 WP_000002010.1.76673 WP_000002010.1.76706 WP_000002010.1.7672 WP_000002010.1.76721 WP_000002010.1.76724 WP_000002010.1.76756 WP_000002010.1.76760 WP_000002010.1.76799 WP_000002010.1.76806 WP_000002010.1.7684 WP_000002010.1.76866 WP_000002010.1.76875 WP_000002010.1.76880 WP_000002010.1.76899 WP_000002010.1.77017 WP_000002010.1.77038 WP_000002010.1.77047 WP_000002010.1.77080 WP_000002010.1.7712 WP_000002010.1.77180 WP_000002010.1.77184 WP_000002010.1.77193 WP_000002010.1.77241 WP_000002010.1.77244 WP_000002010.1.77292 WP_000002010.1.77349 WP_000002010.1.77414 WP_000002010.1.77436 WP_000002010.1.77440 WP_000002010.1.77514 WP_000002010.1.77529 WP_000002010.1.77549 WP_000002010.1.77555 WP_000002010.1.77575 WP_000002010.1.77653 WP_000002010.1.77692 WP_000002010.1.77754 WP_000002010.1.7782 WP_000002010.1.77851 WP_000002010.1.77871 WP_000002010.1.77898 WP_000002010.1.77918 WP_000002010.1.77960 WP_000002010.1.77971 WP_000002010.1.78 WP_000002010.1.78016 WP_000002010.1.78026 WP_000002010.1.78033 WP_000002010.1.78053 WP_000002010.1.78076 WP_000002010.1.78096 WP_000002010.1.78100 WP_000002010.1.78110 WP_000002010.1.78120 WP_000002010.1.7814 WP_000002010.1.78168 WP_000002010.1.78201 WP_000002010.1.78383 WP_000002010.1.78407 WP_000002010.1.78495 WP_000002010.1.78496 WP_000002010.1.7861 WP_000002010.1.78618 WP_000002010.1.78673 WP_000002010.1.78715 WP_000002010.1.78735 WP_000002010.1.78789 WP_000002010.1.78802 WP_000002010.1.78830 WP_000002010.1.78835 WP_000002010.1.78862 WP_000002010.1.78871 WP_000002010.1.78874 WP_000002010.1.78881 WP_000002010.1.7891 WP_000002010.1.78913 WP_000002010.1.78918 WP_000002010.1.78930 WP_000002010.1.79140 WP_000002010.1.79151 WP_000002010.1.79167 WP_000002010.1.79335 WP_000002010.1.79370 WP_000002010.1.794 WP_000002010.1.79462 WP_000002010.1.79472 WP_000002010.1.79490 WP_000002010.1.79495 WP_000002010.1.79529 WP_000002010.1.7956 WP_000002010.1.79570 WP_000002010.1.7964 WP_000002010.1.79645 WP_000002010.1.79659 WP_000002010.1.79668 WP_000002010.1.79708 WP_000002010.1.7972 WP_000002010.1.79738 WP_000002010.1.7979 WP_000002010.1.79832 WP_000002010.1.79845 WP_000002010.1.79892 WP_000002010.1.79914 WP_000002010.1.7994 WP_000002010.1.79942 WP_000002010.1.79974 WP_000002010.1.79996 WP_000002010.1.80077 WP_000002010.1.80137 WP_000002010.1.80182 WP_000002010.1.80293 WP_000002010.1.80296 WP_000002010.1.80366 WP_000002010.1.80441 WP_000002010.1.80443 WP_000002010.1.80448 WP_000002010.1.80473 WP_000002010.1.80479 WP_000002010.1.80529 WP_000002010.1.80542 WP_000002010.1.80586 WP_000002010.1.80629 WP_000002010.1.80725 WP_000002010.1.80757 WP_000002010.1.80780 WP_000002010.1.80827 WP_000002010.1.80831 WP_000002010.1.80840 WP_000002010.1.80850 WP_000002010.1.80857 WP_000002010.1.80881 WP_000002010.1.80939 WP_000002010.1.80959 WP_000002010.1.8096 WP_000002010.1.80973 WP_000002010.1.81037 WP_000002010.1.81069 WP_000002010.1.81149 WP_000002010.1.81175 WP_000002010.1.8119 WP_000002010.1.81193 WP_000002010.1.81275 WP_000002010.1.81354 WP_000002010.1.81404 WP_000002010.1.81410 WP_000002010.1.81425 WP_000002010.1.81727 WP_000002010.1.81736 WP_000002010.1.81743 WP_000002010.1.81750 WP_000002010.1.81760 WP_000002010.1.81785 WP_000002010.1.81795 WP_000002010.1.81902 WP_000002010.1.81941 WP_000002010.1.8196 WP_000002010.1.81965 WP_000002010.1.81974 WP_000002010.1.81977 WP_000002010.1.82099 WP_000002010.1.82141 WP_000002010.1.82337 WP_000002010.1.82347 WP_000002010.1.82395 WP_000002010.1.82479 WP_000002010.1.82503 WP_000002010.1.82515 WP_000002010.1.82529 WP_000002010.1.82530 WP_000002010.1.82570 WP_000002010.1.82584 WP_000002010.1.82648 WP_000002010.1.82676 WP_000002010.1.82761 WP_000002010.1.8282 WP_000002010.1.82841 WP_000002010.1.82843 WP_000002010.1.82908 WP_000002010.1.82944 WP_000002010.1.82956 WP_000002010.1.82964 WP_000002010.1.83092 WP_000002010.1.83128 WP_000002010.1.83258 WP_000002010.1.83301 WP_000002010.1.83305 WP_000002010.1.83360 WP_000002010.1.83365 WP_000002010.1.83407 WP_000002010.1.83413 WP_000002010.1.83491 WP_000002010.1.83516 WP_000002010.1.83523 WP_000002010.1.8354 WP_000002010.1.83650 WP_000002010.1.83721 WP_000002010.1.83739 WP_000002010.1.83760 WP_000002010.1.83854 WP_000002010.1.83979 WP_000002010.1.83995 WP_000002010.1.84001 WP_000002010.1.84077 WP_000002010.1.84100 WP_000002010.1.84103 WP_000002010.1.84106 WP_000002010.1.84209 WP_000002010.1.84283 WP_000002010.1.84355 WP_000002010.1.84373 WP_000002010.1.84392 WP_000002010.1.84403 WP_000002010.1.8441 WP_000002010.1.84459 WP_000002010.1.84475 WP_000002010.1.84532 WP_000002010.1.84551 WP_000002010.1.84554 WP_000002010.1.84644 WP_000002010.1.84659 WP_000002010.1.84693 WP_000002010.1.84899 WP_000002010.1.8497 WP_000002010.1.85014 WP_000002010.1.85040 WP_000002010.1.85134 WP_000002010.1.85147 WP_000002010.1.85178 WP_000002010.1.85180 WP_000002010.1.85190 WP_000002010.1.85192 WP_000002010.1.85217 WP_000002010.1.8533 WP_000002010.1.8537 WP_000002010.1.85408 WP_000002010.1.8545 WP_000002010.1.85456 WP_000002010.1.85481 WP_000002010.1.85483 WP_000002010.1.85541 WP_000002010.1.8556 WP_000002010.1.85615 WP_000002010.1.85617 WP_000002010.1.85663 WP_000002010.1.85671 WP_000002010.1.85672 WP_000002010.1.85723 WP_000002010.1.85742 WP_000002010.1.85777 WP_000002010.1.85780 WP_000002010.1.85784 WP_000002010.1.85854 WP_000002010.1.85855 WP_000002010.1.85864 WP_000002010.1.85886 WP_000002010.1.85900 WP_000002010.1.85904 WP_000002010.1.8591 WP_000002010.1.85943 WP_000002010.1.85976 WP_000002010.1.86010 WP_000002010.1.86017 WP_000002010.1.86120 WP_000002010.1.86224 WP_000002010.1.86284 WP_000002010.1.86285 WP_000002010.1.86306 WP_000002010.1.86356 WP_000002010.1.86389 WP_000002010.1.86450 WP_000002010.1.86453 WP_000002010.1.86469 WP_000002010.1.86580 WP_000002010.1.86588 WP_000002010.1.86593 WP_000002010.1.86634 WP_000002010.1.86656 WP_000002010.1.86661 WP_000002010.1.8672 WP_000002010.1.8678 WP_000002010.1.86807 WP_000002010.1.86810 WP_000002010.1.8684 WP_000002010.1.86860 WP_000002010.1.86895 WP_000002010.1.86906 WP_000002010.1.8691 WP_000002010.1.87051 WP_000002010.1.87095 WP_000002010.1.87148 WP_000002010.1.87282 WP_000002010.1.87323 WP_000002010.1.8736 WP_000002010.1.87365 WP_000002010.1.87460 WP_000002010.1.87493 WP_000002010.1.87552 WP_000002010.1.87626 WP_000002010.1.87687 WP_000002010.1.87779 WP_000002010.1.87875 WP_000002010.1.87933 WP_000002010.1.87945 WP_000002010.1.87999 WP_000002010.1.8800 WP_000002010.1.88019 WP_000002010.1.88073 WP_000002010.1.8809 WP_000002010.1.88214 WP_000002010.1.88291 WP_000002010.1.88293 WP_000002010.1.88303 WP_000002010.1.8837 WP_000002010.1.88393 WP_000002010.1.8849 WP_000002010.1.88609 WP_000002010.1.88624 WP_000002010.1.88651 WP_000002010.1.88683 WP_000002010.1.88698 WP_000002010.1.88703 WP_000002010.1.88792 WP_000002010.1.88902 WP_000002010.1.8891 WP_000002010.1.88942 WP_000002010.1.88967 WP_000002010.1.88970 WP_000002010.1.88981 WP_000002010.1.89008 WP_000002010.1.89116 WP_000002010.1.89138 WP_000002010.1.89304 WP_000002010.1.89311 WP_000002010.1.89462 WP_000002010.1.89512 WP_000002010.1.89527 WP_000002010.1.89570 WP_000002010.1.89580 WP_000002010.1.89604 WP_000002010.1.89622 WP_000002010.1.89632 WP_000002010.1.89659 WP_000002010.1.89789 WP_000002010.1.89815 WP_000002010.1.89870 WP_000002010.1.89902 WP_000002010.1.8996 WP_000002010.1.9002 WP_000002010.1.90084 WP_000002010.1.90097 WP_000002010.1.90193 WP_000002010.1.90252 WP_000002010.1.90348 WP_000002010.1.90417 WP_000002010.1.90440 WP_000002010.1.90453 WP_000002010.1.90458 WP_000002010.1.90521 WP_000002010.1.90557 WP_000002010.1.90585 WP_000002010.1.90620 WP_000002010.1.9064 WP_000002010.1.90641 WP_000002010.1.90686 WP_000002010.1.90734 WP_000002010.1.90814 WP_000002010.1.9093 WP_000002010.1.91003 WP_000002010.1.91042 WP_000002010.1.91049 WP_000002010.1.91069 WP_000002010.1.91156 WP_000002010.1.91189 WP_000002010.1.91278 WP_000002010.1.9131 WP_000002010.1.91470 WP_000002010.1.91493 WP_000002010.1.91512 WP_000002010.1.91564 WP_000002010.1.91580 WP_000002010.1.91628 WP_000002010.1.91655 WP_000002010.1.91702 WP_000002010.1.91724 WP_000002010.1.91732 WP_000002010.1.91788 WP_000002010.1.91864 WP_000002010.1.91903 WP_000002010.1.92013 WP_000002010.1.92060 WP_000002010.1.92067 WP_000002010.1.92093 WP_000002010.1.92099 WP_000002010.1.92108 WP_000002010.1.92122 WP_000002010.1.92171 WP_000002010.1.92183 WP_000002010.1.92208 WP_000002010.1.92268 WP_000002010.1.92310 WP_000002010.1.92318 WP_000002010.1.92375 WP_000002010.1.92394 WP_000002010.1.92399 WP_000002010.1.92408 WP_000002010.1.92443 WP_000002010.1.92482 WP_000002010.1.92529 WP_000002010.1.92531 WP_000002010.1.92562 WP_000002010.1.92659 WP_000002010.1.92669 WP_000002010.1.92671 WP_000002010.1.92729 WP_000002010.1.92738 WP_000002010.1.92827 WP_000002010.1.92832 WP_000002010.1.92875 WP_000002010.1.92895 WP_000002010.1.92975 WP_000002010.1.92988 WP_000002010.1.93061 WP_000002010.1.93086 WP_000002010.1.93101 WP_000002010.1.93136 WP_000002010.1.93155 WP_000002010.1.93213 WP_000002010.1.93275 WP_000002010.1.93322 WP_000002010.1.93365 WP_000002010.1.93376 WP_000002010.1.93543 WP_000002010.1.93650 WP_000002010.1.93656 WP_000002010.1.93662 WP_000002010.1.93671 WP_000002010.1.93691 WP_000002010.1.937 WP_000002010.1.93705 WP_000002010.1.93741 WP_000002010.1.93803 WP_000002010.1.93804 WP_000002010.1.9389 WP_000002010.1.93956 WP_000002010.1.93986 WP_000002010.1.93994 WP_000002010.1.94039 WP_000002010.1.94072 WP_000002010.1.94162 WP_000002010.1.94167 WP_000002010.1.94168 WP_000002010.1.94181 WP_000002010.1.94198 WP_000002010.1.9432 WP_000002010.1.94352 WP_000002010.1.94354 WP_000002010.1.94380 WP_000002010.1.94412 WP_000002010.1.94458 WP_000002010.1.94565 WP_000002010.1.94584 WP_000002010.1.94622 WP_000002010.1.94669 WP_000002010.1.94674 WP_000002010.1.94717 WP_000002010.1.94722 WP_000002010.1.94738 WP_000002010.1.94785 WP_000002010.1.94796 WP_000002010.1.9481 WP_000002010.1.94849 WP_000002010.1.94862 WP_000002010.1.94959 WP_000002010.1.94982 WP_000002010.1.94986 WP_000002010.1.94987 WP_000002010.1.9503 WP_000002010.1.95051 WP_000002010.1.95085 WP_000002010.1.95121 WP_000002010.1.95249 WP_000002010.1.95282 WP_000002010.1.95289 WP_000002010.1.9530 WP_000002010.1.95320 WP_000002010.1.95465 WP_000002010.1.95546 WP_000002010.1.95579 WP_000002010.1.95623 WP_000002010.1.95630 WP_000002010.1.95703 WP_000002010.1.95729 WP_000002010.1.95744 WP_000002010.1.95803 WP_000002010.1.95911 WP_000002010.1.96042 WP_000002010.1.96045 WP_000002010.1.96139 WP_000002010.1.96172 WP_000002010.1.96190 WP_000002010.1.96260 WP_000002010.1.96317 WP_000002010.1.96335 WP_000002010.1.96343 WP_000002010.1.9644 WP_000002010.1.96469 WP_000002010.1.96497 WP_000002010.1.96500 WP_000002010.1.96533 WP_000002010.1.96555 WP_000002010.1.96563 WP_000002010.1.96590 WP_000002010.1.96600 WP_000002010.1.96642 WP_000002010.1.96662 WP_000002010.1.96732 WP_000002010.1.96761 WP_000002010.1.96771 WP_000002010.1.96917 WP_000002010.1.97005 WP_000002010.1.97015 WP_000002010.1.97145 WP_000002010.1.97190 WP_000002010.1.97224 WP_000002010.1.97318 WP_000002010.1.97369 WP_000002010.1.97418 WP_000002010.1.97480 WP_000002010.1.97496 WP_000002010.1.97594 WP_000002010.1.97597 WP_000002010.1.97613 WP_000002010.1.97620 WP_000002010.1.97626 WP_000002010.1.97640 WP_000002010.1.97726 WP_000002010.1.97727 WP_000002010.1.97732 WP_000002010.1.97736 WP_000002010.1.9775 WP_000002010.1.97846 WP_000002010.1.97873 WP_000002010.1.98006 WP_000002010.1.98019 WP_000002010.1.98022 WP_000002010.1.9805 WP_000002010.1.9811 WP_000002010.1.98110 WP_000002010.1.98124 WP_000002010.1.98146 WP_000002010.1.98219 WP_000002010.1.98314 WP_000002010.1.98392 WP_000002010.1.98402 WP_000002010.1.9841 WP_000002010.1.98438 WP_000002010.1.98483 WP_000002010.1.98495 WP_000002010.1.98531 WP_000002010.1.98577 WP_000002010.1.9863 WP_000002010.1.98676 WP_000002010.1.98677 WP_000002010.1.98751 WP_000002010.1.98757 WP_000002010.1.98760 WP_000002010.1.98779 WP_000002010.1.98843 WP_000002010.1.98899 WP_000002010.1.98931 WP_000002010.1.9898 WP_000002010.1.99098 WP_000002010.1.99107 WP_000002010.1.99184 WP_000002010.1.99267 WP_000002010.1.99276 WP_000002010.1.99278 WP_000002010.1.99370 WP_000002010.1.99561 WP_000002010.1.99646 WP_000002010.1.99657 WP_000002010.1.99660 WP_000002010.1.99712 WP_000002010.1.99747 WP_000002010.1.99783 WP_000002010.1.99813 WP_000002010.1.99824 WP_000002010.1.99858 WP_000002010.1.99889 WP_000002010.1.99958 gi|378453382|ref|YP_005240742.1| gi|549726930|ref|YP_008647120.1| 361252 APC24199 ABAM02000001|CDS_309410-308601 ABAN01000009|CDS_126998-127807 ABAO01000006|CDS_32385-31576 ABFG01000006|CDS_335533-336342 ABFH02000001|CDS_479180-479989 AE006468|CDS_4663915-4663106 CP000886|CDS_4680518-4679709 CP001138|CDS_4596246-4595437 CP001363|CDS_4676745-4675936 FN424405|CDS_4685902-4685093 gi|526218830|ref|YP_008264091.1| gi|525856304|ref|YP_008259053.1| gi|161617703|ref|YP_001591668.1| gi|378991686|ref|YP_005254850.1| gi|197248540|ref|YP_002149337.1| gi|218688150|ref|YP_002396362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]